F432739

General Info

Members Datasets Scaffolds Average Seq Length
393 197 393 161

Family's Representative Sequence

Representative Sequence 3300050515|nmdc:mga0a205_686415_c1|nmdc:mga0a205_686415_c1_59_649
Length 196
Sequence MRLESKRLEPTRSFSESRRQASPLIKLRQTAARPRGSGGCAMVMKNVINIDELPLEDFRHGEHYASRCLRVGRLLGAKALGYSYDVVPPGKKACPFHSHRAEEEMFFIVQGRGTLRYGSATRQIRAGDFICCPTGGPDTAHQIVNDSDADLAYISVSTMMPAEVCEYPDSKKVGAYGGDFRHLTRTDAAVDYWDGE

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
156 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
166 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
167 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
170 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
171 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
172 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.54
Nodule 0
Rhizoplane 1.78
Rhizosphere 94.91
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10169392 3300005293 Bacteria 1559
2 Ga0065715_10855680 3300005293 Bacteria 590
3 Ga0070658_10023553 3300005327 Bacteria 4940
4 Ga0070658_10226699 3300005327 Bacteria 1581
5 Ga0070658_10547155 3300005327 Bacteria 1002
6 Ga0070676_10033240 3300005328 Bacteria 2959
7 Ga0070676_10092331 3300005328 Bacteria 1856
8 Ga0070676_10222260 3300005328 Bacteria 1248
9 Ga0070670_100071722 3300005331 Bacteria 2974
10 Ga0070670_100204544 3300005331 Bacteria 1716
11 Ga0068869_100210393 3300005334 Bacteria 1537
12 Ga0068869_100487085 3300005334 Bacteria 1028
13 Ga0068869_100639870 3300005334 Bacteria 902
14 Ga0068869_101488318 3300005334 Bacteria 601
15 Ga0070682_100191855 3300005337 Bacteria 1435
16 Ga0068868_100216923 3300005338 Bacteria 1601
17 Ga0070660_100013800 3300005339 Bacteria 5812
18 Ga0070689_100049049 3300005340 Bacteria 3258
19 Ga0070689_100420457 3300005340 Bacteria 1133
20 Ga0070689_101660613 3300005340 Bacteria 581
21 Ga0070661_100009682 3300005344 Bacteria 6682
22 Ga0070668_100007884 3300005347 Bacteria 7905
23 Ga0070669_100052292 3300005353 Bacteria 2988
24 Ga0070669_100077480 3300005353 Bacteria 2470
25 Ga0070675_100001897 3300005354 Bacteria 15424
26 Ga0070675_100010232 3300005354 Bacteria 7317
27 Ga0070675_100014777 3300005354 Bacteria 6161
28 Ga0070675_100020707 3300005354 Bacteria 5249
29 Ga0070675_100198253 3300005354 Bacteria 1742
30 Ga0070675_100356030 3300005354 Bacteria 1299
31 Ga0070675_101491016 3300005354 Bacteria 624
32 Ga0070671_100676032 3300005355 Bacteria 895
33 Ga0070671_101060671 3300005355 Bacteria 711
34 Ga0070674_100433206 3300005356 Bacteria 1082
35 Ga0070674_100705449 3300005356 Bacteria 863
36 Ga0070673_100037207 3300005364 Bacteria 3707
37 Ga0070673_100144096 3300005364 Bacteria 2012
38 Ga0070673_100188628 3300005364 Bacteria 1769
39 Ga0070673_100190763 3300005364 Unclassified 1760
40 Ga0070673_100338653 3300005364 Bacteria 1332
41 Ga0070673_100350465 3300005364 Bacteria 1310
42 Ga0070688_100049872 3300005365 Bacteria 2606
43 Ga0070659_100122183 3300005366 Bacteria 2110
44 Ga0070659_100208314 3300005366 Bacteria 1611
45 Ga0070659_100982195 3300005366 Bacteria 741
46 Ga0070667_100071950 3300005367 Bacteria 2945
47 Ga0070667_100131960 3300005367 Bacteria 2181
48 Ga0070709_10279030 3300005434 Bacteria 1214
49 Ga0070714_100008865 3300005435 Bacteria 7867
50 Ga0070714_100260163 3300005435 Bacteria 1607
51 Ga0070713_100079117 3300005436 Bacteria 2800
52 Ga0070713_100181012 3300005436 Bacteria 1894
53 Ga0070701_10102620 3300005438 Bacteria 1587
54 Ga0070711_100087295 3300005439 Bacteria 2239
55 Ga0070711_100116625 3300005439 Bacteria 1968
56 Ga0070711_101115176 3300005439 Bacteria 680
57 Ga0070705_100274672 3300005440 Bacteria 1195
58 Ga0070700_100533738 3300005441 Bacteria 909
59 Ga0070663_100000598 3300005455 Bacteria 19225
60 Ga0070678_100085328 3300005456 Bacteria 2406
61 Ga0070678_100193690 3300005456 Bacteria 1673
62 Ga0070678_100260286 3300005456 Bacteria 1459
63 Ga0070662_100018924 3300005457 Bacteria 4666
64 Ga0070662_100040119 3300005457 Bacteria 3332
65 Ga0070662_100268786 3300005457 Bacteria 1376
66 Ga0070681_10047713 3300005458 Bacteria 4281
67 Ga0070681_10297602 3300005458 Bacteria 1523
68 Ga0070681_10406170 3300005458 Bacteria 1274
69 Ga0070681_10530238 3300005458 Bacteria 1091
70 Ga0070681_11513328 3300005458 Bacteria 596
71 Ga0068867_100051139 3300005459 Bacteria 3047
72 Ga0068867_100173609 3300005459 Bacteria 1709
73 Ga0068867_100479250 3300005459 Bacteria 1066
74 Ga0068867_100592105 3300005459 Bacteria 966
75 Ga0068867_100926232 3300005459 Unclassified 786
76 Ga0070685_10021010 3300005466 Bacteria 3542
77 Ga0070698_100014033 3300005471 Bacteria 8472
78 Ga0070679_100063464 3300005530 Bacteria 3682
79 Ga0070679_100575479 3300005530 Bacteria 1070
80 Ga0070679_100825833 3300005530 Bacteria 870
81 Ga0070684_100433595 3300005535 Bacteria 1214
82 Ga0068853_100015193 3300005539 Bacteria 6330
83 Ga0070672_100018346 3300005543 Bacteria 5057
84 Ga0070672_100146495 3300005543 Bacteria 1951
85 Ga0070672_100307691 3300005543 Bacteria 1344
86 Ga0070665_100820854 3300005548 Bacteria 943
87 Ga0070704_100000612 3300005549 Bacteria 17183
88 Ga0070704_100504102 3300005549 Bacteria 1051
89 Ga0068855_100017720 3300005563 Bacteria 8563
90 Ga0068855_100054382 3300005563 Bacteria 4705
91 Ga0068855_100122349 3300005563 Bacteria 2977
92 Ga0068855_100209904 3300005563 Bacteria 2189
93 Ga0070664_100000641 3300005564 Bacteria 26808
94 Ga0070664_100016531 3300005564 Bacteria 6050
95 Ga0070664_100068296 3300005564 Bacteria 3038
96 Ga0070664_100153769 3300005564 Bacteria 2032
97 Ga0070664_101357327 3300005564 Bacteria 672
98 Ga0068857_100094424 3300005577 Bacteria 2678
99 Ga0068854_100027729 3300005578 Bacteria 3906
100 Ga0068854_100242058 3300005578 Bacteria 1437
101 Ga0068854_101025418 3300005578 Bacteria 732
102 Ga0068856_100000746 3300005614 Bacteria 35249
103 Ga0068856_100092415 3300005614 Bacteria 3011
104 Ga0068856_100107727 3300005614 Bacteria 2782
105 Ga0068852_100033227 3300005616 Bacteria 4281
106 Ga0068852_100062536 3300005616 Bacteria 3238
107 Ga0068852_100326391 3300005616 Bacteria 1492
108 Ga0068852_100946872 3300005616 Bacteria 879
109 Ga0068852_101074091 3300005616 Unclassified 825
110 Ga0068859_100403496 3300005617 Bacteria 1463
111 Ga0068859_102690353 3300005617 Bacteria 547
112 Ga0068864_100166516 3300005618 Bacteria 2007
113 Ga0068864_102213976 3300005618 Bacteria 556
114 Ga0068866_10222416 3300005718 Bacteria 1140
115 Ga0068861_100039329 3300005719 Bacteria 3528
116 Ga0068851_10037114 3300005834 Bacteria 2443
117 Ga0068851_10037696 3300005834 Bacteria 2424
118 Ga0068851_10062290 3300005834 Bacteria 1914
119 Ga0068851_10276662 3300005834 Unclassified 959
120 Ga0068851_10420979 3300005834 Bacteria 789
121 Ga0068870_10054406 3300005840 Bacteria 2129
122 Ga0068870_10170618 3300005840 Bacteria 1298
123 Ga0068863_100208587 3300005841 Bacteria 1881
124 Ga0068863_101350705 3300005841 Bacteria 720
125 Ga0068858_102155623 3300005842 Bacteria 551
126 Ga0068860_100479159 3300005843 Bacteria 1240
127 Ga0068862_100633299 3300005844 Unclassified 1030
128 Ga0081455_10147783 3300005937 Bacteria 1815
129 Ga0081539_10028953 3300005985 Bacteria 3473
130 Ga0075366_10009612 3300006195 Bacteria 5404
131 Ga0075366_10088339 3300006195 Bacteria 1856
132 Ga0075366_10373918 3300006195 Bacteria 876
133 Ga0097621_100179741 3300006237 Bacteria 1828
134 Ga0097621_101383142 3300006237 Bacteria 666
135 Ga0075370_10115692 3300006353 Bacteria 1559
136 Ga0075428_100006524 3300006844 Bacteria 12974
137 Ga0075428_100271754 3300006844 Bacteria 1824
138 Ga0075434_101206584 3300006871 Bacteria 769
139 Ga0075434_101340598 3300006871 Unclassified 726
140 Ga0075429_100004225 3300006880 Bacteria 12307
141 Ga0075429_100792465 3300006880 Bacteria 830
142 Ga0068865_100376142 3300006881 Bacteria 1157
143 Ga0068865_100502575 3300006881 Bacteria 1011
144 Ga0068865_100602552 3300006881 Bacteria 929
145 Ga0097620_100403518 3300006931 Bacteria 1463
146 Ga0097620_102688826 3300006931 Bacteria 547
147 Ga0075435_100230780 3300007076 Bacteria 1572
148 Ga0105240_10026442 3300009093 Bacteria 7614
149 Ga0105240_10075920 3300009093 Bacteria 4144
150 Ga0105240_10273881 3300009093 Bacteria 1942
151 Ga0105240_10364087 3300009093 Bacteria 1637
152 Ga0105240_12422657 3300009093 Bacteria 543
153 Ga0111539_10018966 3300009094 Bacteria 8505
154 Ga0111539_11413805 3300009094 Bacteria 807
155 Ga0114129_10002840 3300009147 Bacteria 24196
156 Ga0105243_10500083 3300009148 Bacteria 1152
157 Ga0105241_10174416 3300009174 Bacteria 1778
158 Ga0105241_10671397 3300009174 Bacteria 943
159 Ga0105242_10103194 3300009176 Bacteria 2419
160 Ga0105242_10442681 3300009176 Bacteria 1223
161 Ga0105242_10751216 3300009176 Bacteria 960
162 Ga0105248_10245536 3300009177 Bacteria 2015
163 Ga0105238_10050504 3300009551 Bacteria 4187
164 Ga0105238_10315585 3300009551 Bacteria 1548
165 Ga0105238_11101058 3300009551 Bacteria 817
166 Ga0105249_11462627 3300009553 Unclassified 755
167 Ga0105239_10236202 3300010375 Unclassified 2052
168 Ga0105239_11017927 3300010375 Bacteria 953
169 Ga0157373_10747923 3300013100 Bacteria 718
170 Ga0157370_10252877 3300013104 Bacteria 1630
171 Ga0157369_10198321 3300013105 Bacteria 2107
172 Ga0157369_10285772 3300013105 Bacteria 1718
173 Ga0157369_10351739 3300013105 Bacteria 1530
174 Ga0157374_10255237 3300013296 Bacteria 1726
175 Ga0157374_12210802 3300013296 Unclassified 577
176 Ga0157378_11737335 3300013297 Bacteria 671
177 Ga0163162_10014626 3300013306 Bacteria 7667
178 Ga0157372_10001849 3300013307 Bacteria 22929
179 Ga0157372_10013542 3300013307 Bacteria 8717
180 Ga0157372_10340623 3300013307 Bacteria 1746
181 Ga0157372_10411812 3300013307 Bacteria 1575
182 Ga0157372_11535923 3300013307 Bacteria 767
183 Ga0157375_10008063 3300013308 Bacteria 9212
184 Ga0157375_10424608 3300013308 Bacteria 1495
185 Ga0157375_10443487 3300013308 Bacteria 1464
186 Ga0157375_10847940 3300013308 Bacteria 1060
187 Ga0163163_10493428 3300014325 Bacteria 1286
188 Ga0157380_10264711 3300014326 Bacteria 1564
189 Ga0182008_10149695 3300014497 Bacteria 1170
190 Ga0157376_10466587 3300014969 Bacteria 1235
191 Ga0157376_11011500 3300014969 Unclassified 854
192 Ga0157376_11169662 3300014969 Bacteria 797
193 Ga0163161_10019567 3300017792 Bacteria 4750
194 Ga0163161_10133869 3300017792 Bacteria 1872
195 Ga0163161_10596741 3300017792 Bacteria 910
196 Ga0207656_10071083 3300025321 Bacteria 1546
197 Ga0207653_10160976 3300025885 Bacteria 831
198 Ga0207688_10056152 3300025901 Bacteria 2211
199 Ga0207680_10648585 3300025903 Unclassified 756
200 Ga0207680_10954328 3300025903 Bacteria 614
201 Ga0207699_10163099 3300025906 Bacteria 1485
202 Ga0207699_10201926 3300025906 Bacteria 1348
203 Ga0207699_10330291 3300025906 Bacteria 1072
204 Ga0207645_10018463 3300025907 Bacteria 4587
205 Ga0207645_10119440 3300025907 Bacteria 1710
206 Ga0207643_10037644 3300025908 Bacteria 2714
207 Ga0207705_10013508 3300025909 Bacteria 5893
208 Ga0207705_10386882 3300025909 Bacteria 1081
209 Ga0207705_10434287 3300025909 Bacteria 1017
210 Ga0207705_10462244 3300025909 Bacteria 984
211 Ga0207707_10019619 3300025912 Bacteria 5900
212 Ga0207707_10272640 3300025912 Bacteria 1466
213 Ga0207695_10029027 3300025913 Bacteria 6121
214 Ga0207695_10070403 3300025913 Bacteria 3576
215 Ga0207662_10187054 3300025918 Bacteria 1335
216 Ga0207657_10002489 3300025919 Bacteria 19920
217 Ga0207657_10162622 3300025919 Bacteria 1812
218 Ga0207657_10276190 3300025919 Bacteria 1335
219 Ga0207649_10045559 3300025920 Bacteria 2689
220 Ga0207649_10144071 3300025920 Bacteria 1634
221 Ga0207652_10084710 3300025921 Bacteria 2777
222 Ga0207652_10439762 3300025921 Bacteria 1176
223 Ga0207652_10574101 3300025921 Bacteria 1012
224 Ga0207681_10020470 3300025923 Bacteria 4193
225 Ga0207694_10400122 3300025924 Unclassified 1142
226 Ga0207694_10754224 3300025924 Bacteria 822
227 Ga0207650_10135141 3300025925 Bacteria 1934
228 Ga0207650_10442825 3300025925 Bacteria 1080
229 Ga0207659_10012976 3300025926 Bacteria 5323
230 Ga0207659_10071929 3300025926 Bacteria 2527
231 Ga0207659_10151270 3300025926 Bacteria 1813
232 Ga0207659_10168582 3300025926 Bacteria 1726
233 Ga0207659_10943444 3300025926 Bacteria 742
234 Ga0207700_10410766 3300025928 Bacteria 1187
235 Ga0207700_10557253 3300025928 Bacteria 1018
236 Ga0207664_10291457 3300025929 Bacteria 1434
237 Ga0207644_10011396 3300025931 Bacteria 5882
238 Ga0207644_10323713 3300025931 Bacteria 1247
239 Ga0207690_10153335 3300025932 Bacteria 1710
240 Ga0207690_10827754 3300025932 Bacteria 766
241 Ga0207706_10000149 3300025933 Bacteria 76532
242 Ga0207706_10245177 3300025933 Bacteria 1566
243 Ga0207706_10726141 3300025933 Bacteria 847
244 Ga0207706_11652249 3300025933 Unclassified 517
245 Ga0207686_10114947 3300025934 Bacteria 1822
246 Ga0207709_10089149 3300025935 Bacteria 2010
247 Ga0207670_10011737 3300025936 Bacteria 5099
248 Ga0207670_10523572 3300025936 Bacteria 966
249 Ga0207669_10293082 3300025937 Bacteria 1233
250 Ga0207669_10448971 3300025937 Bacteria 1021
251 Ga0207669_10546302 3300025937 Bacteria 934
252 Ga0207669_10693938 3300025937 Bacteria 836
253 Ga0207704_10120716 3300025938 Bacteria 1793
254 Ga0207704_10144390 3300025938 Bacteria 1670
255 Ga0207704_10185404 3300025938 Bacteria 1508
256 Ga0207691_10011498 3300025940 Bacteria 8494
257 Ga0207691_10018892 3300025940 Bacteria 6529
258 Ga0207691_10025537 3300025940 Bacteria 5545
259 Ga0207691_10160838 3300025940 Bacteria 1970
260 Ga0207691_10292215 3300025940 Bacteria 1401
261 Ga0207691_10461660 3300025940 Bacteria 1080
262 Ga0207691_10992811 3300025940 Bacteria 701
263 Ga0207711_10221702 3300025941 Bacteria 1730
264 Ga0207689_10156731 3300025942 Bacteria 1877
265 Ga0207661_10557073 3300025944 Bacteria 1050
266 Ga0207679_10143667 3300025945 Bacteria 1932
267 Ga0207679_10168863 3300025945 Bacteria 1799
268 Ga0207679_10535820 3300025945 Bacteria 1049
269 Ga0207679_11614034 3300025945 Bacteria 594
270 Ga0207667_10034933 3300025949 Bacteria 5395
271 Ga0207667_10051134 3300025949 Bacteria 4357
272 Ga0207667_10098981 3300025949 Bacteria 3008
273 Ga0207667_10162219 3300025949 Bacteria 2299
274 Ga0207667_10213425 3300025949 Bacteria 1978
275 Ga0207667_10452791 3300025949 Archaea 1304
276 Ga0207651_10027832 3300025960 Bacteria 3557
277 Ga0207651_10130163 3300025960 Bacteria 1925
278 Ga0207668_10020786 3300025972 Bacteria 4178
279 Ga0207668_10038683 3300025972 Bacteria 3204
280 Ga0207640_10274637 3300025981 Bacteria 1320
281 Ga0207658_10085152 3300025986 Bacteria 2434
282 Ga0207658_10356994 3300025986 Bacteria 1274
283 Ga0207677_10488174 3300026023 Bacteria 1063
284 Ga0207677_10582580 3300026023 Bacteria 979
285 Ga0207639_10002413 3300026041 Bacteria 12552
286 Ga0207639_11070860 3300026041 Unclassified 756
287 Ga0207678_10004148 3300026067 Bacteria 13014
288 Ga0207678_10317415 3300026067 Bacteria 1340
289 Ga0207708_10085971 3300026075 Bacteria 2420
290 Ga0207702_10089666 3300026078 Bacteria 2689
291 Ga0207702_10144054 3300026078 Bacteria 2160
292 Ga0207702_10303571 3300026078 Bacteria 1515
293 Ga0207641_10102199 3300026088 Bacteria 2527
294 Ga0207641_10351052 3300026088 Bacteria 1406
295 Ga0207648_10188055 3300026089 Bacteria 1829
296 Ga0207648_10189544 3300026089 Bacteria 1822
297 Ga0207648_10464289 3300026089 Bacteria 1154
298 Ga0207648_10495148 3300026089 Bacteria 1118
299 Ga0207648_10847068 3300026089 Unclassified 853
300 Ga0207676_10039182 3300026095 Bacteria 3623
301 Ga0207676_10748620 3300026095 Bacteria 950
302 Ga0207676_11280372 3300026095 Bacteria 728
303 Ga0207674_10098155 3300026116 Bacteria 2913
304 Ga0207675_100008960 3300026118 Bacteria 9388
305 Ga0207675_100225437 3300026118 Bacteria 1807
306 Ga0207683_10089623 3300026121 Bacteria 2738
307 Ga0207683_10203386 3300026121 Bacteria 1801
308 Ga0207683_10292780 3300026121 Bacteria 1489
309 Ga0207698_10011345 3300026142 Bacteria 5772
310 Ga0207698_10050709 3300026142 Bacteria 3168
311 Ga0207698_10051688 3300026142 Bacteria 3143
312 Ga0207698_10316611 3300026142 Bacteria 1459
313 Ga0207698_10368175 3300026142 Bacteria 1363
314 Ga0207698_10897031 3300026142 Bacteria 893
315 Ga0210000_1053016 3300027462 Bacteria 652
316 Ga0209974_10018572 3300027876 Bacteria 2307
317 Ga0207428_10059762 3300027907 Bacteria 3021
318 Ga0207428_10658259 3300027907 Unclassified 751
319 Ga0268265_11462304 3300028380 Unclassified 686
320 Ga0268264_10935465 3300028381 Unclassified 871
321 Ga0265340_10260724 3300031247 Bacteria 772
322 Ga0307408_100028549 3300031548 Bacteria 3856
323 Ga0307408_100698951 3300031548 Bacteria 911
324 Ga0307408_101119389 3300031548 Bacteria 731
325 Ga0307508_10330894 3300031616 Unclassified 1115
326 Ga0265342_10192369 3300031712 Bacteria 1113
327 Ga0307413_10791081 3300031824 Bacteria 796
328 Ga0307410_11030549 3300031852 Bacteria 711
329 Ga0307406_10018730 3300031901 Bacteria 4050
330 Ga0307409_100060019 3300031995 Bacteria 2963
331 Ga0307416_100026822 3300032002 Bacteria 4253
332 Ga0307416_101986863 3300032002 Bacteria 684
333 Ga0307416_102058051 3300032002 Bacteria 673
334 Ga0307411_10175736 3300032005 Bacteria 1620
335 Ga0307411_10615336 3300032005 Bacteria 936
336 Ga0373928_0057431 3300035084 Bacteria 934
337 Ga0373961_0119525 3300035241 Bacteria 872
338 Ga0373931_0056519 3300035691 Bacteria 2103
339 Ga0373931_0083476 3300035691 Bacteria 1767
340 Ga0373927_0032781 3300035695 Bacteria 3383
341 Ga0373927_0037272 3300035695 Bacteria 3161
342 Ga0373937_0587064 3300036401 Bacteria 1058
343 Ga0373925_0077811 3300037068 Bacteria 2518
344 Ga0373925_0124010 3300037068 Bacteria 2008
345 Ga0395900_0000638 3300037418 Bacteria 47165
346 Ga0395900_0014025 3300037418 Bacteria 8184
347 Ga0395900_1609474 3300037418 Unclassified 561
348 Ga0395898_0000741 3300037466 Bacteria 57011
349 Ga0395898_0333318 3300037466 Bacteria 1447
350 Ga0395905_0054353 3300037471 Bacteria 3748
351 Ga0395905_0136170 3300037471 Bacteria 2310
352 Ga0395901_0018171 3300038443 Bacteria 7177
353 Ga0436360_1355698 3300039438 Unclassified 758
354 Ga0451798_0947245 3300041458 Unclassified 933
355 Ga0451847_0350097 3300041503 Unclassified 541
356 Ga0451853_1474999 3300041512 Unclassified 926
357 Ga0439431_0005116 3300041997 Bacteria 2892
358 Ga0450888_011408 3300042126 Bacteria 1041
359 Ga0439446_0083583 3300042156 Bacteria 992
360 Ga0439434_0035987 3300042435 Bacteria 1514
361 Ga0451577_0141163 3300042876 Bacteria 2165
362 Ga0451577_0278289 3300042876 Bacteria 1516
363 Ga0466966_0209437 3300044684 Bacteria 1178
364 Ga0466961_0009850 3300044693 Bacteria 6085
365 Ga0466957_0128986 3300044842 Bacteria 1618
366 Ga0466959_0075585 3300045049 Bacteria 2433
367 Ga0466958_0072206 3300045836 Bacteria 2113
368 Ga0466967_0977293 3300045976 Bacteria 843
369 Ga0496102_0333130 3300048905 Bacteria 1429
370 Ga0496103_0123547 3300048906 Bacteria 1650
371 Ga0496105_0550196 3300048908 Bacteria 901
372 Ga0496107_0004925 3300048910 Bacteria 9081
373 Ga0496109_0278276 3300048912 Bacteria 1577
374 Ga0496111_1264262 3300048914 Bacteria 521
375 nmdc:mga00v17_129509_c1 3300050491 Bacteria 1612
376 nmdc:mga0k408_1373_c1 3300050493 Bacteria 13133
377 nmdc:mga0k408_321181_c1 3300050493 Bacteria 924
378 nmdc:mga0k408_62929_c1 3300050493 Bacteria 2158
379 nmdc:mga07m45_25291_c1 3300050496 Bacteria 3255
380 nmdc:mga05p37_457538_c1 3300050507 Bacteria 1475
381 nmdc:mga05p37_643896_c1 3300050507 Bacteria 1188
382 nmdc:mga05p37_6446_c1 3300050507 Bacteria 13838
383 nmdc:mga09592_540_c1 3300050508 Bacteria 28649
384 nmdc:mga09592_708787_c1 3300050508 Bacteria 856
385 nmdc:mga06r32_1364_c1 3300050510 Bacteria 22076
386 nmdc:mga08y16_16262_c1 3300050511 Bacteria 7823
387 nmdc:mga0n895_1140487_c1 3300050512 Unclassified 755
388 nmdc:mga0n895_1403410_c1 3300050512 Bacteria 667
389 nmdc:mga0rr50_259355_c1 3300050513 Bacteria 1446
390 nmdc:mga0rr50_712900_c1 3300050513 Bacteria 856
391 nmdc:mga08x19_745_c1 3300050514 Bacteria 20774
392 nmdc:mga0a205_686415_c1 3300050515 Unclassified 874
393 Ga0500587_028936 3300053739 Bacteria 753

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044693 Ga0466961_0009850 Ga0466961_0009850_5226_5738 156
2 3300045049 Ga0466959_0075585 Ga0466959_0075585_1257_1769 156
3 3300005328 Ga0070676_10092331 Ga0070676_100923313 157
4 3300005334 Ga0068869_101488318 Ga0068869_1014883181 157
5 3300005340 Ga0070689_100420457 Ga0070689_1004204572 157
6 3300005340 Ga0070689_101660613 Ga0070689_1016606131 157
7 3300005364 Ga0070673_100188628 Ga0070673_1001886283 157
8 3300005458 Ga0070681_10047713 Ga0070681_100477134 157
9 3300005459 Ga0068867_100479250 Ga0068867_1004792502 157
10 3300005543 Ga0070672_100307691 Ga0070672_1003076912 157
11 3300005564 Ga0070664_101357327 Ga0070664_1013573272 157
12 3300005718 Ga0068866_10222416 Ga0068866_102224162 157
13 3300006195 Ga0075366_10088339 Ga0075366_100883392 157
14 3300006195 Ga0075366_10373918 Ga0075366_103739182 157
15 3300006237 Ga0097621_101383142 Ga0097621_1013831422 157
16 3300006353 Ga0075370_10115692 Ga0075370_101156921 157
17 3300006844 Ga0075428_100271754 Ga0075428_1002717542 157
18 3300006880 Ga0075429_100792465 Ga0075429_1007924652 157
19 3300006881 Ga0068865_100602552 Ga0068865_1006025521 157
20 3300007076 Ga0075435_100230780 Ga0075435_1002307802 157
21 3300009094 Ga0111539_10018966 Ga0111539_100189665 157
22 3300009551 Ga0105238_11101058 Ga0105238_111010582 157
23 3300013297 Ga0157378_11737335 Ga0157378_117373352 157
24 3300014325 Ga0163163_10493428 Ga0163163_104934282 157
25 3300014326 Ga0157380_10264711 Ga0157380_102647112 157
26 3300025907 Ga0207645_10119440 Ga0207645_101194403 157
27 3300025912 Ga0207707_10019619 Ga0207707_100196193 157
28 3300025921 Ga0207652_10084710 Ga0207652_100847102 157
29 3300025926 Ga0207659_10943444 Ga0207659_109434442 157
30 3300025936 Ga0207670_10523572 Ga0207670_105235722 157
31 3300025937 Ga0207669_10293082 Ga0207669_102930822 157
32 3300025938 Ga0207704_10120716 Ga0207704_101207162 157
33 3300025940 Ga0207691_10461660 Ga0207691_104616602 157
34 3300025945 Ga0207679_11614034 Ga0207679_116140341 157
35 3300026089 Ga0207648_10189544 Ga0207648_101895442 157
36 3300027907 Ga0207428_10059762 Ga0207428_100597623 157
37 3300031247 Ga0265340_10260724 Ga0265340_102607242 157
38 3300031548 Ga0307408_100698951 Ga0307408_1006989512 157
39 3300031548 Ga0307408_101119389 Ga0307408_1011193891 157
40 3300031712 Ga0265342_10192369 Ga0265342_101923692 157
41 3300031824 Ga0307413_10791081 Ga0307413_107910811 157
42 3300031852 Ga0307410_11030549 Ga0307410_110305492 157
43 3300032002 Ga0307416_100026822 Ga0307416_1000268224 157
44 3300032002 Ga0307416_101986863 Ga0307416_1019868631 157
45 3300032002 Ga0307416_102058051 Ga0307416_1020580512 157
46 3300032005 Ga0307411_10175736 Ga0307411_101757363 157
47 3300032005 Ga0307411_10615336 Ga0307411_106153362 157
48 3300041997 Ga0439431_0005116 Ga0439431_0005116_1267_1767 157
49 3300042126 Ga0450888_011408 Ga0450888_011408_466_966 157
50 3300042156 Ga0439446_0083583 Ga0439446_0083583_352_852 157
51 3300042435 Ga0439434_0035987 Ga0439434_0035987_597_1094 157
52 3300050493 nmdc:mga0k408_1373_c1 nmdc:mga0k408_1373_c1_352_840 157
53 3300050493 nmdc:mga0k408_321181_c1 nmdc:mga0k408_321181_c1_248_733 157
54 3300050496 nmdc:mga07m45_25291_c1 nmdc:mga07m45_25291_c1_873_1361 157
55 3300050507 nmdc:mga05p37_643896_c1 nmdc:mga05p37_643896_c1_554_1057 157
56 3300050508 nmdc:mga09592_708787_c1 nmdc:mga09592_708787_c1_260_745 157
57 3300050511 nmdc:mga08y16_16262_c1 nmdc:mga08y16_16262_c1_4189_4674 157
58 3300050513 nmdc:mga0rr50_259355_c1 nmdc:mga0rr50_259355_c1_524_1027 157
59 3300050514 nmdc:mga08x19_745_c1 nmdc:mga08x19_745_c1_8711_9214 157
60 3300050515 nmdc:mga0a205_686415_c1 nmdc:mga0a205_686415_c1_59_649 157
61 3300005293 Ga0065715_10169392 Ga0065715_101693922 158
62 3300005293 Ga0065715_10855680 Ga0065715_108556801 158
63 3300005327 Ga0070658_10023553 Ga0070658_100235534 158
64 3300005327 Ga0070658_10226699 Ga0070658_102266993 158
65 3300005327 Ga0070658_10547155 Ga0070658_105471551 158
66 3300005328 Ga0070676_10033240 Ga0070676_100332402 158
67 3300005328 Ga0070676_10222260 Ga0070676_102222602 158
68 3300005331 Ga0070670_100071722 Ga0070670_1000717224 158
69 3300005331 Ga0070670_100204544 Ga0070670_1002045442 158
70 3300005334 Ga0068869_100210393 Ga0068869_1002103932 158
71 3300005334 Ga0068869_100487085 Ga0068869_1004870852 158
72 3300005334 Ga0068869_100639870 Ga0068869_1006398701 158
73 3300005337 Ga0070682_100191855 Ga0070682_1001918551 158
74 3300005338 Ga0068868_100216923 Ga0068868_1002169232 158
75 3300005339 Ga0070660_100013800 Ga0070660_1000138003 158
76 3300005340 Ga0070689_100049049 Ga0070689_1000490493 158
77 3300005344 Ga0070661_100009682 Ga0070661_1000096826 158
78 3300005347 Ga0070668_100007884 Ga0070668_1000078844 158
79 3300005353 Ga0070669_100052292 Ga0070669_1000522925 158
80 3300005353 Ga0070669_100077480 Ga0070669_1000774802 158
81 3300005354 Ga0070675_100001897 Ga0070675_1000018972 158
82 3300005354 Ga0070675_100010232 Ga0070675_1000102327 158
83 3300005354 Ga0070675_100014777 Ga0070675_1000147773 158
84 3300005354 Ga0070675_100020707 Ga0070675_1000207072 158
85 3300005354 Ga0070675_100198253 Ga0070675_1001982532 158
86 3300005354 Ga0070675_100356030 Ga0070675_1003560302 158
87 3300005354 Ga0070675_101491016 Ga0070675_1014910161 158
88 3300005355 Ga0070671_100676032 Ga0070671_1006760322 158
89 3300005355 Ga0070671_101060671 Ga0070671_1010606711 158
90 3300005356 Ga0070674_100433206 Ga0070674_1004332061 158
91 3300005356 Ga0070674_100705449 Ga0070674_1007054492 158
92 3300005364 Ga0070673_100037207 Ga0070673_1000372072 158
93 3300005364 Ga0070673_100144096 Ga0070673_1001440962 158
94 3300005364 Ga0070673_100190763 Ga0070673_1001907633 158
95 3300005364 Ga0070673_100338653 Ga0070673_1003386532 158
96 3300005364 Ga0070673_100350465 Ga0070673_1003504651 158
97 3300005365 Ga0070688_100049872 Ga0070688_1000498722 158
98 3300005366 Ga0070659_100122183 Ga0070659_1001221832 158
99 3300005366 Ga0070659_100208314 Ga0070659_1002083142 158
100 3300005366 Ga0070659_100982195 Ga0070659_1009821951 158
101 3300005367 Ga0070667_100071950 Ga0070667_1000719502 158
102 3300005367 Ga0070667_100131960 Ga0070667_1001319602 158
103 3300005434 Ga0070709_10279030 Ga0070709_102790301 158
104 3300005435 Ga0070714_100008865 Ga0070714_1000088658 158
105 3300005435 Ga0070714_100260163 Ga0070714_1002601633 158
106 3300005436 Ga0070713_100079117 Ga0070713_1000791171 158
107 3300005436 Ga0070713_100181012 Ga0070713_1001810123 158
108 3300005438 Ga0070701_10102620 Ga0070701_101026202 158
109 3300005439 Ga0070711_100087295 Ga0070711_1000872952 158
110 3300005439 Ga0070711_100116625 Ga0070711_1001166252 158
111 3300005439 Ga0070711_101115176 Ga0070711_1011151761 158
112 3300005440 Ga0070705_100274672 Ga0070705_1002746721 158
113 3300005441 Ga0070700_100533738 Ga0070700_1005337381 158
114 3300005455 Ga0070663_100000598 Ga0070663_10000059819 158
115 3300005456 Ga0070678_100085328 Ga0070678_1000853284 158
116 3300005456 Ga0070678_100193690 Ga0070678_1001936902 158
117 3300005456 Ga0070678_100260286 Ga0070678_1002602861 158
118 3300005457 Ga0070662_100018924 Ga0070662_1000189247 158
119 3300005457 Ga0070662_100040119 Ga0070662_1000401191 158
120 3300005457 Ga0070662_100268786 Ga0070662_1002687862 158
121 3300005458 Ga0070681_10297602 Ga0070681_102976022 158
122 3300005458 Ga0070681_10406170 Ga0070681_104061702 158
123 3300005458 Ga0070681_10530238 Ga0070681_105302382 158
124 3300005458 Ga0070681_11513328 Ga0070681_115133281 158
125 3300005459 Ga0068867_100051139 Ga0068867_1000511392 158
126 3300005459 Ga0068867_100173609 Ga0068867_1001736092 158
127 3300005459 Ga0068867_100592105 Ga0068867_1005921052 158
128 3300005459 Ga0068867_100926232 Ga0068867_1009262321 158
129 3300005466 Ga0070685_10021010 Ga0070685_100210104 158
130 3300005471 Ga0070698_100014033 Ga0070698_1000140334 158
131 3300005530 Ga0070679_100063464 Ga0070679_1000634644 158
132 3300005530 Ga0070679_100575479 Ga0070679_1005754792 158
133 3300005530 Ga0070679_100825833 Ga0070679_1008258332 158
134 3300005535 Ga0070684_100433595 Ga0070684_1004335952 158
135 3300005539 Ga0068853_100015193 Ga0068853_1000151937 158
136 3300005543 Ga0070672_100018346 Ga0070672_1000183462 158
137 3300005543 Ga0070672_100146495 Ga0070672_1001464951 158
138 3300005548 Ga0070665_100820854 Ga0070665_1008208542 158
139 3300005549 Ga0070704_100000612 Ga0070704_1000006122 158
140 3300005549 Ga0070704_100504102 Ga0070704_1005041021 158
141 3300005563 Ga0068855_100017720 Ga0068855_1000177204 158
142 3300005563 Ga0068855_100054382 Ga0068855_1000543827 158
143 3300005563 Ga0068855_100122349 Ga0068855_1001223493 158
144 3300005563 Ga0068855_100209904 Ga0068855_1002099042 158
145 3300005564 Ga0070664_100000641 Ga0070664_10000064121 158
146 3300005564 Ga0070664_100016531 Ga0070664_1000165313 158
147 3300005564 Ga0070664_100068296 Ga0070664_1000682964 158
148 3300005564 Ga0070664_100153769 Ga0070664_1001537692 158
149 3300005577 Ga0068857_100094424 Ga0068857_1000944243 158
150 3300005578 Ga0068854_100027729 Ga0068854_1000277294 158
151 3300005578 Ga0068854_100242058 Ga0068854_1002420582 158
152 3300005578 Ga0068854_101025418 Ga0068854_1010254182 158
153 3300005614 Ga0068856_100000746 Ga0068856_10000074613 158
154 3300005614 Ga0068856_100092415 Ga0068856_1000924153 158
155 3300005614 Ga0068856_100107727 Ga0068856_1001077273 158
156 3300005616 Ga0068852_100033227 Ga0068852_1000332274 158
157 3300005616 Ga0068852_100062536 Ga0068852_1000625362 158
158 3300005616 Ga0068852_100326391 Ga0068852_1003263912 158
159 3300005616 Ga0068852_100946872 Ga0068852_1009468722 158
160 3300005616 Ga0068852_101074091 Ga0068852_1010740911 158
161 3300005617 Ga0068859_100403496 Ga0068859_1004034962 158
162 3300005617 Ga0068859_102690353 Ga0068859_1026903531 158
163 3300005618 Ga0068864_100166516 Ga0068864_1001665162 158
164 3300005618 Ga0068864_102213976 Ga0068864_1022139761 158
165 3300005719 Ga0068861_100039329 Ga0068861_1000393292 158
166 3300005834 Ga0068851_10037114 Ga0068851_100371142 158
167 3300005834 Ga0068851_10037696 Ga0068851_100376962 158
168 3300005834 Ga0068851_10062290 Ga0068851_100622902 158
169 3300005834 Ga0068851_10276662 Ga0068851_102766622 158
170 3300005834 Ga0068851_10420979 Ga0068851_104209792 158
171 3300005840 Ga0068870_10054406 Ga0068870_100544062 158
172 3300005840 Ga0068870_10170618 Ga0068870_101706181 158
173 3300005841 Ga0068863_100208587 Ga0068863_1002085872 158
174 3300005841 Ga0068863_101350705 Ga0068863_1013507052 158
175 3300005842 Ga0068858_102155623 Ga0068858_1021556231 158
176 3300005843 Ga0068860_100479159 Ga0068860_1004791592 158
177 3300005844 Ga0068862_100633299 Ga0068862_1006332992 158
178 3300005937 Ga0081455_10147783 Ga0081455_101477832 158
179 3300005985 Ga0081539_10028953 Ga0081539_100289534 158
180 3300006195 Ga0075366_10009612 Ga0075366_100096128 158
181 3300006237 Ga0097621_100179741 Ga0097621_1001797413 158
182 3300006844 Ga0075428_100006524 Ga0075428_1000065247 158
183 3300006871 Ga0075434_101206584 Ga0075434_1012065841 158
184 3300006871 Ga0075434_101340598 Ga0075434_1013405981 158
185 3300006880 Ga0075429_100004225 Ga0075429_10000422514 158
186 3300006881 Ga0068865_100376142 Ga0068865_1003761422 158
187 3300006881 Ga0068865_100502575 Ga0068865_1005025751 158
188 3300006931 Ga0097620_100403518 Ga0097620_1004035182 158
189 3300006931 Ga0097620_102688826 Ga0097620_1026888261 158
190 3300009093 Ga0105240_10026442 Ga0105240_100264425 158
191 3300009093 Ga0105240_10075920 Ga0105240_100759204 158
192 3300009093 Ga0105240_10273881 Ga0105240_102738812 158
193 3300009093 Ga0105240_10364087 Ga0105240_103640873 158
194 3300009093 Ga0105240_12422657 Ga0105240_124226571 158
195 3300009094 Ga0111539_11413805 Ga0111539_114138052 158
196 3300009147 Ga0114129_10002840 Ga0114129_1000284018 158
197 3300009148 Ga0105243_10500083 Ga0105243_105000832 158
198 3300009174 Ga0105241_10174416 Ga0105241_101744163 158
199 3300009174 Ga0105241_10671397 Ga0105241_106713971 158
200 3300009176 Ga0105242_10103194 Ga0105242_101031942 158
201 3300009176 Ga0105242_10442681 Ga0105242_104426811 158
202 3300009176 Ga0105242_10751216 Ga0105242_107512162 158
203 3300009177 Ga0105248_10245536 Ga0105248_102455362 158
204 3300009551 Ga0105238_10050504 Ga0105238_100505044 158
205 3300009551 Ga0105238_10315585 Ga0105238_103155852 158
206 3300009553 Ga0105249_11462627 Ga0105249_114626272 158
207 3300010375 Ga0105239_10236202 Ga0105239_102362024 158
208 3300010375 Ga0105239_11017927 Ga0105239_110179271 158
209 3300013100 Ga0157373_10747923 Ga0157373_107479232 158
210 3300013104 Ga0157370_10252877 Ga0157370_102528772 158
211 3300013105 Ga0157369_10198321 Ga0157369_101983212 158
212 3300013105 Ga0157369_10285772 Ga0157369_102857722 158
213 3300013105 Ga0157369_10351739 Ga0157369_103517391 158
214 3300013296 Ga0157374_10255237 Ga0157374_102552372 158
215 3300013296 Ga0157374_12210802 Ga0157374_122108021 158
216 3300013306 Ga0163162_10014626 Ga0163162_100146264 158
217 3300013307 Ga0157372_10001849 Ga0157372_1000184920 158
218 3300013307 Ga0157372_10013542 Ga0157372_1001354210 158
219 3300013307 Ga0157372_10340623 Ga0157372_103406232 158
220 3300013307 Ga0157372_10411812 Ga0157372_104118123 158
221 3300013307 Ga0157372_11535923 Ga0157372_115359232 158
222 3300013308 Ga0157375_10008063 Ga0157375_100080633 158
223 3300013308 Ga0157375_10424608 Ga0157375_104246082 158
224 3300013308 Ga0157375_10443487 Ga0157375_104434872 158
225 3300013308 Ga0157375_10847940 Ga0157375_108479402 158
226 3300014497 Ga0182008_10149695 Ga0182008_101496951 158
227 3300014969 Ga0157376_10466587 Ga0157376_104665872 158
228 3300014969 Ga0157376_11011500 Ga0157376_110115002 158
229 3300014969 Ga0157376_11169662 Ga0157376_111696622 158
230 3300017792 Ga0163161_10019567 Ga0163161_100195676 158
231 3300017792 Ga0163161_10133869 Ga0163161_101338692 158
232 3300017792 Ga0163161_10596741 Ga0163161_105967411 158
233 3300025321 Ga0207656_10071083 Ga0207656_100710832 158
234 3300025885 Ga0207653_10160976 Ga0207653_101609762 158
235 3300025901 Ga0207688_10056152 Ga0207688_100561522 158
236 3300025903 Ga0207680_10648585 Ga0207680_106485851 158
237 3300025903 Ga0207680_10954328 Ga0207680_109543281 158
238 3300025906 Ga0207699_10163099 Ga0207699_101630992 158
239 3300025906 Ga0207699_10201926 Ga0207699_102019262 158
240 3300025906 Ga0207699_10330291 Ga0207699_103302912 158
241 3300025907 Ga0207645_10018463 Ga0207645_100184632 158
242 3300025908 Ga0207643_10037644 Ga0207643_100376443 158
243 3300025909 Ga0207705_10013508 Ga0207705_100135085 158
244 3300025909 Ga0207705_10386882 Ga0207705_103868822 158
245 3300025909 Ga0207705_10434287 Ga0207705_104342872 158
246 3300025909 Ga0207705_10462244 Ga0207705_104622442 158
247 3300025912 Ga0207707_10272640 Ga0207707_102726402 158
248 3300025913 Ga0207695_10029027 Ga0207695_100290275 158
249 3300025913 Ga0207695_10070403 Ga0207695_100704035 158
250 3300025918 Ga0207662_10187054 Ga0207662_101870542 158
251 3300025919 Ga0207657_10002489 Ga0207657_1000248915 158
252 3300025919 Ga0207657_10162622 Ga0207657_101626222 158
253 3300025919 Ga0207657_10276190 Ga0207657_102761903 158
254 3300025920 Ga0207649_10045559 Ga0207649_100455593 158
255 3300025920 Ga0207649_10144071 Ga0207649_101440712 158
256 3300025921 Ga0207652_10439762 Ga0207652_104397622 158
257 3300025921 Ga0207652_10574101 Ga0207652_105741012 158
258 3300025923 Ga0207681_10020470 Ga0207681_100204704 158
259 3300025924 Ga0207694_10400122 Ga0207694_104001223 158
260 3300025924 Ga0207694_10754224 Ga0207694_107542242 158
261 3300025925 Ga0207650_10135141 Ga0207650_101351412 158
262 3300025925 Ga0207650_10442825 Ga0207650_104428252 158
263 3300025926 Ga0207659_10012976 Ga0207659_100129762 158
264 3300025926 Ga0207659_10071929 Ga0207659_100719292 158
265 3300025926 Ga0207659_10151270 Ga0207659_101512703 158
266 3300025926 Ga0207659_10168582 Ga0207659_101685822 158
267 3300025928 Ga0207700_10410766 Ga0207700_104107662 158
268 3300025928 Ga0207700_10557253 Ga0207700_105572531 158
269 3300025929 Ga0207664_10291457 Ga0207664_102914572 158
270 3300025931 Ga0207644_10011396 Ga0207644_100113966 158
271 3300025931 Ga0207644_10323713 Ga0207644_103237132 158
272 3300025932 Ga0207690_10153335 Ga0207690_101533352 158
273 3300025932 Ga0207690_10827754 Ga0207690_108277542 158
274 3300025933 Ga0207706_10000149 Ga0207706_1000014968 158
275 3300025933 Ga0207706_10245177 Ga0207706_102451772 158
276 3300025933 Ga0207706_10726141 Ga0207706_107261412 158
277 3300025933 Ga0207706_11652249 Ga0207706_116522491 158
278 3300025934 Ga0207686_10114947 Ga0207686_101149472 158
279 3300025935 Ga0207709_10089149 Ga0207709_100891492 158
280 3300025936 Ga0207670_10011737 Ga0207670_100117372 158
281 3300025937 Ga0207669_10448971 Ga0207669_104489712 158
282 3300025937 Ga0207669_10546302 Ga0207669_105463022 158
283 3300025937 Ga0207669_10693938 Ga0207669_106939381 158
284 3300025938 Ga0207704_10144390 Ga0207704_101443901 158
285 3300025938 Ga0207704_10185404 Ga0207704_101854042 158
286 3300025940 Ga0207691_10011498 Ga0207691_100114982 158
287 3300025940 Ga0207691_10018892 Ga0207691_100188922 158
288 3300025940 Ga0207691_10025537 Ga0207691_100255372 158
289 3300025940 Ga0207691_10160838 Ga0207691_101608381 158
290 3300025940 Ga0207691_10292215 Ga0207691_102922152 158
291 3300025940 Ga0207691_10992811 Ga0207691_109928111 158
292 3300025941 Ga0207711_10221702 Ga0207711_102217022 158
293 3300025942 Ga0207689_10156731 Ga0207689_101567313 158
294 3300025944 Ga0207661_10557073 Ga0207661_105570732 158
295 3300025945 Ga0207679_10143667 Ga0207679_101436673 158
296 3300025945 Ga0207679_10168863 Ga0207679_101688632 158
297 3300025945 Ga0207679_10535820 Ga0207679_105358203 158
298 3300025949 Ga0207667_10034933 Ga0207667_100349337 158
299 3300025949 Ga0207667_10051134 Ga0207667_100511344 158
300 3300025949 Ga0207667_10098981 Ga0207667_100989813 158
301 3300025949 Ga0207667_10162219 Ga0207667_101622192 158
302 3300025949 Ga0207667_10213425 Ga0207667_102134252 158
303 3300025949 Ga0207667_10452791 Ga0207667_104527912 158
304 3300025960 Ga0207651_10027832 Ga0207651_100278322 158
305 3300025960 Ga0207651_10130163 Ga0207651_101301632 158
306 3300025972 Ga0207668_10020786 Ga0207668_100207866 158
307 3300025972 Ga0207668_10038683 Ga0207668_100386832 158
308 3300025981 Ga0207640_10274637 Ga0207640_102746373 158
309 3300025986 Ga0207658_10085152 Ga0207658_100851523 158
310 3300025986 Ga0207658_10356994 Ga0207658_103569942 158
311 3300026023 Ga0207677_10488174 Ga0207677_104881742 158
312 3300026023 Ga0207677_10582580 Ga0207677_105825802 158
313 3300026041 Ga0207639_10002413 Ga0207639_100024135 158
314 3300026041 Ga0207639_11070860 Ga0207639_110708601 158
315 3300026067 Ga0207678_10004148 Ga0207678_100041484 158
316 3300026067 Ga0207678_10317415 Ga0207678_103174152 158
317 3300026075 Ga0207708_10085971 Ga0207708_100859713 158
318 3300026078 Ga0207702_10089666 Ga0207702_100896662 158
319 3300026078 Ga0207702_10144054 Ga0207702_101440542 158
320 3300026078 Ga0207702_10303571 Ga0207702_103035712 158
321 3300026088 Ga0207641_10102199 Ga0207641_101021992 158
322 3300026088 Ga0207641_10351052 Ga0207641_103510522 158
323 3300026089 Ga0207648_10188055 Ga0207648_101880552 158
324 3300026089 Ga0207648_10464289 Ga0207648_104642891 158
325 3300026089 Ga0207648_10495148 Ga0207648_104951482 158
326 3300026089 Ga0207648_10847068 Ga0207648_108470681 158
327 3300026095 Ga0207676_10039182 Ga0207676_100391822 158
328 3300026095 Ga0207676_10748620 Ga0207676_107486201 158
329 3300026095 Ga0207676_11280372 Ga0207676_112803721 158
330 3300026116 Ga0207674_10098155 Ga0207674_100981552 158
331 3300026118 Ga0207675_100008960 Ga0207675_1000089604 158
332 3300026118 Ga0207675_100225437 Ga0207675_1002254372 158
333 3300026121 Ga0207683_10089623 Ga0207683_100896232 158
334 3300026121 Ga0207683_10203386 Ga0207683_102033862 158
335 3300026121 Ga0207683_10292780 Ga0207683_102927802 158
336 3300026142 Ga0207698_10011345 Ga0207698_100113456 158
337 3300026142 Ga0207698_10050709 Ga0207698_100507093 158
338 3300026142 Ga0207698_10051688 Ga0207698_100516884 158
339 3300026142 Ga0207698_10316611 Ga0207698_103166112 158
340 3300026142 Ga0207698_10368175 Ga0207698_103681752 158
341 3300026142 Ga0207698_10897031 Ga0207698_108970311 158
342 3300027462 Ga0210000_1053016 Ga0210000_10530161 158
343 3300027876 Ga0209974_10018572 Ga0209974_100185723 158
344 3300027907 Ga0207428_10658259 Ga0207428_106582592 158
345 3300028380 Ga0268265_11462304 Ga0268265_114623041 158
346 3300028381 Ga0268264_10935465 Ga0268264_109354652 158
347 3300031548 Ga0307408_100028549 Ga0307408_1000285493 158
348 3300031616 Ga0307508_10330894 Ga0307508_103308942 158
349 3300031901 Ga0307406_10018730 Ga0307406_100187303 158
350 3300031995 Ga0307409_100060019 Ga0307409_1000600192 158
351 3300035084 Ga0373928_0057431 Ga0373928_0057431_50_538 158
352 3300035241 Ga0373961_0119525 Ga0373961_0119525_283_786 158
353 3300035691 Ga0373931_0056519 Ga0373931_0056519_1025_1513 158
354 3300035691 Ga0373931_0083476 Ga0373931_0083476_593_1069 158
355 3300035695 Ga0373927_0032781 Ga0373927_0032781_1448_1924 158
356 3300035695 Ga0373927_0037272 Ga0373927_0037272_288_779 158
357 3300036401 Ga0373937_0587064 Ga0373937_0587064_356_832 158
358 3300037068 Ga0373925_0077811 Ga0373925_0077811_190_666 158
359 3300037068 Ga0373925_0124010 Ga0373925_0124010_708_1187 158
360 3300037418 Ga0395900_0000638 Ga0395900_0000638_14202_14681 158
361 3300037418 Ga0395900_0014025 Ga0395900_0014025_5903_6409 158
362 3300037418 Ga0395900_1609474 Ga0395900_1609474_22_510 158
363 3300037466 Ga0395898_0000741 Ga0395898_0000741_34787_35266 158
364 3300037466 Ga0395898_0333318 Ga0395898_0333318_800_1306 158
365 3300037471 Ga0395905_0054353 Ga0395905_0054353_1915_2421 158
366 3300037471 Ga0395905_0136170 Ga0395905_0136170_1352_1840 158
367 3300038443 Ga0395901_0018171 Ga0395901_0018171_3159_3665 158
368 3300039438 Ga0436360_1355698 Ga0436360_1355698_174_650 158
369 3300041458 Ga0451798_0947245 Ga0451798_0947245_297_773 158
370 3300041503 Ga0451847_0350097 Ga0451847_0350097_27_503 158
371 3300041512 Ga0451853_1474999 Ga0451853_1474999_53_529 158
372 3300042876 Ga0451577_0141163 Ga0451577_0141163_457_939 158
373 3300042876 Ga0451577_0278289 Ga0451577_0278289_730_1221 158
374 3300044684 Ga0466966_0209437 Ga0466966_0209437_391_897 158
375 3300044842 Ga0466957_0128986 Ga0466957_0128986_173_679 158
376 3300045836 Ga0466958_0072206 Ga0466958_0072206_465_971 158
377 3300045976 Ga0466967_0977293 Ga0466967_0977293_240_743 158
378 3300048905 Ga0496102_0333130 Ga0496102_0333130_855_1331 158
379 3300048906 Ga0496103_0123547 Ga0496103_0123547_909_1385 158
380 3300048908 Ga0496105_0550196 Ga0496105_0550196_251_727 158
381 3300048910 Ga0496107_0004925 Ga0496107_0004925_2090_2566 158
382 3300048912 Ga0496109_0278276 Ga0496109_0278276_564_1061 158
383 3300048914 Ga0496111_1264262 Ga0496111_1264262_19_495 158
384 3300050491 nmdc:mga00v17_129509_c1 nmdc:mga00v17_129509_c1_855_1349 158
385 3300050493 nmdc:mga0k408_62929_c1 nmdc:mga0k408_62929_c1_208_702 158
386 3300050507 nmdc:mga05p37_457538_c1 nmdc:mga05p37_457538_c1_238_714 158
387 3300050507 nmdc:mga05p37_6446_c1 nmdc:mga05p37_6446_c1_6026_6502 158
388 3300050508 nmdc:mga09592_540_c1 nmdc:mga09592_540_c1_4610_5086 158
389 3300050510 nmdc:mga06r32_1364_c1 nmdc:mga06r32_1364_c1_4507_4983 158
390 3300050512 nmdc:mga0n895_1140487_c1 nmdc:mga0n895_1140487_c1_141_617 158
391 3300050512 nmdc:mga0n895_1403410_c1 nmdc:mga0n895_1403410_c1_170_646 158
392 3300050513 nmdc:mga0rr50_712900_c1 nmdc:mga0rr50_712900_c1_360_836 158
393 3300053739 Ga0500587_028936 Ga0500587_028936_63_551 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

83

157

0.96

PF05899

Cupin_3

EutQ-like cupin domain

89

145

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l2h-assembly1.cif.gz_D crystal structure of putative sugar phosphate isomerase (afe_0303) from acidithiobacillus ferrooxidans atcc 23270 at 1.85 a resolution 0.9035 6 149
3i7d-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution 0.8866 8 149
5jsp-assembly1.cif.gz_A new mechanistic insight from substrate and product bound structures of the metal-dependent dimethylsulfoniopropionate lyase dddq 0.8792 38 120
4rd7-assembly1.cif.gz_A-2 the crystal structure of a cupin 2 conserved barrel domain protein from salinispora arenicola cns-205 0.8786 27 120
5fpx-assembly1.cif.gz_A the structure of kdgf from yersinia enterocolitica. 0.8703 5 120
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9372 27 119 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8897 38 120 2.60.120.10
2h0vB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.88 27 118 2.60.120.10
3l2hD01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8781 6 145 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8703 5 120 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A536Z1I6-F1-model_v4 Cupin domain-containing protein 0.9993 1 138
AF-A0A536VHD3-F1-model_v4 Cupin domain-containing protein 0.9937 9 158
AF-A0A536V148-F1-model_v4 Cupin domain-containing protein 0.9932 1 158
AF-A0A536Z1I6-F1-model_v4 Cupin domain-containing protein 0.9921 1 138
AF-A0A536VHD3-F1-model_v4 Cupin domain-containing protein 0.9871 9 158

Feature Viewer

pLDDT pTM Quality
94.59 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map