F432721

General Info

Members Datasets Scaffolds Average Seq Length
393 199 786 226

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0421612|Ga0501038_0421612_174_968
Length 264
Sequence MDDVGDGDSLADSEDLDALPPVESELEPGEAHDPPLPDLQIPEPGRTLSAVTVRVGPEADFTEILVRLRDAGADVVSVNSFPATRGEVDVDRVLDVEFRDLDGAVAAAAVRAVRGVVVAEPRATLGQIFGKRVIIIGGGAQVAQVSLGAVSESDRHNLRGERISVDTIALVGEKNIANTVRAVADLPRAHILVLAGSIMGGDITAAVREIQAAGIPVISLNMVGSVVDVADLVVSDPVQAGTMAVMAIADTARFSLERARGRRF

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
90 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
91 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
92 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
93 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
94 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
95 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
98 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
99 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
100 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
109 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
119 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
120 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
121 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
126 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
129 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
130 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
133 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
134 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.41
Rhizosphere 89.82
Stem 0
Stem Tuber 0
Unclassified 9.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0421612 3300049574 Archaea 1030
2 JGI25406J46586_10054311 3300003203 Bacteria 1326
3 Ga0070676_10502560 3300005328 Bacteria 861
4 Ga0070690_100190183 3300005330 Unclassified 1423
5 Ga0070680_100185000 3300005336 Bacteria 1755
6 Ga0068868_100486577 3300005338 Bacteria 1079
7 Ga0070660_100409761 3300005339 Unclassified 1122
8 Ga0070687_100005158 3300005343 Bacteria 5270
9 Ga0070687_100430144 3300005343 Bacteria 873
10 Ga0070692_10004237 3300005345 Bacteria 5953
11 Ga0070692_10183050 3300005345 Bacteria 1216
12 Ga0070675_100285525 3300005354 Bacteria 1451
13 Ga0070674_100012386 3300005356 Bacteria 5237
14 Ga0070674_100101885 3300005356 Unclassified 2093
15 Ga0070673_100043468 3300005364 Bacteria 3472
16 Ga0070667_100160530 3300005367 Bacteria 1980
17 Ga0070705_100057382 3300005440 Unclassified 2297
18 Ga0070705_100169368 3300005440 Bacteria 1468
19 Ga0070705_100250113 3300005440 Bacteria 1244
20 Ga0070700_100196820 3300005441 Bacteria 1413
21 Ga0070700_100254303 3300005441 Unclassified 1262
22 Ga0070708_100042507 3300005445 Bacteria 3990
23 Ga0070708_100258523 3300005445 Bacteria 1637
24 Ga0070662_100260495 3300005457 Bacteria 1397
25 Ga0070681_10069748 3300005458 Bacteria 3481
26 Ga0070681_10327446 3300005458 Bacteria 1442
27 Ga0070706_100005110 3300005467 Bacteria 12521
28 Ga0070706_100012465 3300005467 Bacteria 7875
29 Ga0070706_100729261 3300005467 Bacteria 919
30 Ga0070707_100001989 3300005468 Bacteria 19561
31 Ga0070698_100484090 3300005471 Bacteria 1174
32 Ga0070698_100558732 3300005471 Bacteria 1084
33 Ga0070699_100751514 3300005518 Bacteria 892
34 Ga0070679_100090797 3300005530 Bacteria 3042
35 Ga0070684_100167257 3300005535 Bacteria 1996
36 Ga0070697_100116928 3300005536 Bacteria 2227
37 Ga0070697_100272322 3300005536 Unclassified 1451
38 Ga0070695_100082041 3300005545 Bacteria 2134
39 Ga0070695_100230880 3300005545 Bacteria 1337
40 Ga0070696_100010845 3300005546 Bacteria 6107
41 Ga0070696_100011325 3300005546 Bacteria 5971
42 Ga0070696_100048652 3300005546 Bacteria 2943
43 Ga0070696_100056336 3300005546 Bacteria 2741
44 Ga0070704_100013266 3300005549 Bacteria 5109
45 Ga0070704_100196684 3300005549 Bacteria 1624
46 Ga0068854_100156015 3300005578 Bacteria 1764
47 Ga0070702_100430987 3300005615 Unclassified 952
48 Ga0068852_100704428 3300005616 Bacteria 1020
49 Ga0068864_100173271 3300005618 Bacteria 1969
50 Ga0068861_100103113 3300005719 Bacteria 2273
51 Ga0068861_100500830 3300005719 Bacteria 1098
52 Ga0068870_10143080 3300005840 Unclassified 1401
53 Ga0068858_100044853 3300005842 Bacteria 4098
54 Ga0068858_100404674 3300005842 Bacteria 1311
55 Ga0068858_101031246 3300005842 Bacteria 806
56 Ga0068860_100106061 3300005843 Unclassified 2684
57 Ga0068860_100140277 3300005843 Bacteria 2323
58 Ga0081538_10049300 3300005981 Bacteria 2555
59 Ga0081539_10005451 3300005985 Bacteria 12980
60 Ga0081539_10016720 3300005985 Bacteria 5211
61 Ga0075428_100075136 3300006844 Bacteria 3691
62 Ga0075431_100128780 3300006847 Bacteria 2612
63 Ga0075433_10384162 3300006852 Bacteria 1239
64 Ga0075434_100041366 3300006871 Bacteria 4567
65 Ga0075434_100149975 3300006871 Bacteria 2352
66 Ga0075434_100167338 3300006871 Bacteria 2218
67 Ga0075434_100869212 3300006871 Bacteria 917
68 Ga0075435_100036534 3300007076 Bacteria 3906
69 Ga0075435_100105965 3300007076 Bacteria 2334
70 Ga0075435_100151327 3300007076 Bacteria 1951
71 Ga0105251_10155703 3300009011 Bacteria 1031
72 Ga0111539_10081833 3300009094 Bacteria 3797
73 Ga0111539_10358934 3300009094 Bacteria 1696
74 Ga0111539_10491200 3300009094 Bacteria 1430
75 Ga0105245_10081191 3300009098 Bacteria 2963
76 Ga0105245_11023864 3300009098 Bacteria 871
77 Ga0105247_10095518 3300009101 Bacteria 1893
78 Ga0114129_10045439 3300009147 Bacteria 6174
79 Ga0114129_10053783 3300009147 Bacteria 5647
80 Ga0114129_10165677 3300009147 Bacteria 3016
81 Ga0114129_10201721 3300009147 Bacteria 2693
82 Ga0105243_10096407 3300009148 Bacteria 2447
83 Ga0105243_10158910 3300009148 Bacteria 1947
84 Ga0105249_10016168 3300009553 Bacteria 6616
85 Ga0105249_10226484 3300009553 Bacteria 1842
86 Ga0105249_10300247 3300009553 Bacteria 1610
87 Ga0105249_10330624 3300009553 Bacteria 1538
88 Ga0099796_10072426 3300010159 Unclassified 1247
89 Ga0105239_11113977 3300010375 Bacteria 909
90 Ga0105246_10133822 3300011119 Bacteria 1855
91 Ga0105246_10201757 3300011119 Bacteria 1547
92 Ga0157375_10183547 3300013308 Bacteria 2245
93 Ga0157375_10350814 3300013308 Bacteria 1641
94 Ga0157375_10448808 3300013308 Bacteria 1455
95 Ga0163163_10061561 3300014325 Bacteria 3719
96 Ga0163163_10103820 3300014325 Bacteria 2867
97 Ga0163163_10230054 3300014325 Bacteria 1903
98 Ga0157380_10296547 3300014326 Bacteria 1487
99 Ga0157377_10026361 3300014745 Bacteria 3110
100 Ga0157377_10107850 3300014745 Bacteria 1670
101 Ga0157379_10005844 3300014968 Bacteria 10577
102 Ga0157379_10947981 3300014968 Unclassified 818
103 Ga0163161_10250963 3300017792 Bacteria 1379
104 Ga0207710_10059806 3300025900 Bacteria 1726
105 Ga0207647_10188572 3300025904 Unclassified 1195
106 Ga0207645_10255961 3300025907 Bacteria 1159
107 Ga0207684_10000540 3300025910 Bacteria 46676
108 Ga0207684_10012636 3300025910 Bacteria 7333
109 Ga0207684_10180038 3300025910 Bacteria 1822
110 Ga0207660_10366661 3300025917 Bacteria 1156
111 Ga0207660_10679211 3300025917 Bacteria 840
112 Ga0207657_10202544 3300025919 Unclassified 1596
113 Ga0207649_10137056 3300025920 Bacteria 1670
114 Ga0207652_10340203 3300025921 Bacteria 1354
115 Ga0207646_10000368 3300025922 Bacteria 60057
116 Ga0207646_10023184 3300025922 Bacteria 5704
117 Ga0207646_10483765 3300025922 Bacteria 1116
118 Ga0207659_10070517 3300025926 Bacteria 2549
119 Ga0207687_10364592 3300025927 Bacteria 1180
120 Ga0207690_10289577 3300025932 Unclassified 1278
121 Ga0207690_10429623 3300025932 Bacteria 1058
122 Ga0207706_10141737 3300025933 Bacteria 2115
123 Ga0207706_10391789 3300025933 Bacteria 1205
124 Ga0207709_10331641 3300025935 Bacteria 1142
125 Ga0207709_10708108 3300025935 Bacteria 806
126 Ga0207669_10315373 3300025937 Bacteria 1194
127 Ga0207669_10542984 3300025937 Bacteria 937
128 Ga0207691_10124465 3300025940 Bacteria 2282
129 Ga0207689_10077735 3300025942 Unclassified 2727
130 Ga0207689_10303763 3300025942 Bacteria 1323
131 Ga0207689_10625979 3300025942 Bacteria 906
132 Ga0207689_10692267 3300025942 Bacteria 859
133 Ga0207661_10083825 3300025944 Bacteria 2639
134 Ga0207651_10177311 3300025960 Bacteria 1687
135 Ga0207651_10267898 3300025960 Bacteria 1406
136 Ga0207651_10302189 3300025960 Unclassified 1331
137 Ga0207712_10149857 3300025961 Bacteria 1801
138 Ga0207712_10347813 3300025961 Bacteria 1231
139 Ga0207640_10212574 3300025981 Unclassified 1475
140 Ga0207640_10308430 3300025981 Bacteria 1255
141 Ga0207703_10547977 3300026035 Bacteria 1090
142 Ga0207703_10684568 3300026035 Unclassified 974
143 Ga0207708_10151738 3300026075 Bacteria 1825
144 Ga0207708_10199463 3300026075 Bacteria 1596
145 Ga0207708_10364470 3300026075 Unclassified 1188
146 Ga0207641_10210319 3300026088 Unclassified 1799
147 Ga0207675_100050707 3300026118 Bacteria 3873
148 Ga0207675_100121907 3300026118 Bacteria 2468
149 Ga0207675_100466925 3300026118 Bacteria 1253
150 Ga0207683_10709498 3300026121 Bacteria 933
151 Ga0207428_10095075 3300027907 Bacteria 2309
152 Ga0268265_10369740 3300028380 Bacteria 1316
153 Ga0268264_10175010 3300028381 Bacteria 1944
154 Ga0268264_10242137 3300028381 Unclassified 1671
155 Ga0265326_10074062 3300028558 Bacteria 963
156 Ga0265319_1004544 3300028563 Bacteria 6842
157 Ga0265319_1038618 3300028563 Bacteria 1622
158 Ga0265334_10033343 3300028573 Bacteria 2050
159 Ga0265318_10038786 3300028577 Bacteria 1820
160 Ga0265318_10173574 3300028577 Bacteria 789
161 Ga0265323_10067832 3300028653 Bacteria 1226
162 Ga0265322_10017559 3300028654 Bacteria 2060
163 Ga0265336_10006539 3300028666 Bacteria 4194
164 Ga0265338_10062805 3300028800 Bacteria 3244
165 Ga0265324_10008873 3300029957 Bacteria 3963
166 Ga0265324_10012035 3300029957 Bacteria 3277
167 Ga0265330_10083828 3300031235 Bacteria 1372
168 Ga0265328_10021481 3300031239 Bacteria 2463
169 Ga0265328_10061256 3300031239 Bacteria 1382
170 Ga0265320_10026376 3300031240 Bacteria 3042
171 Ga0265325_10030684 3300031241 Bacteria 2881
172 Ga0265329_10002788 3300031242 Bacteria 7817
173 Ga0265329_10015956 3300031242 Bacteria 2614
174 Ga0265329_10040643 3300031242 Bacteria 1492
175 Ga0265339_10045562 3300031249 Bacteria 2413
176 Ga0265339_10051637 3300031249 Bacteria 2243
177 Ga0265316_10051929 3300031344 Bacteria 3218
178 Ga0265316_10242697 3300031344 Bacteria 1324
179 Ga0265313_10037978 3300031595 Bacteria 2403
180 Ga0265313_10068917 3300031595 Bacteria 1633
181 Ga0265314_10335914 3300031711 Bacteria 836
182 Ga0265342_10026314 3300031712 Bacteria 3647
183 Ga0316576_10051579 3300031727 Bacteria 2994
184 Ga0316576_10083021 3300031727 Bacteria 2380
185 Ga0316576_10091120 3300031727 Bacteria 2271
186 Ga0316576_10225743 3300031727 Bacteria 1408
187 Ga0316578_10117931 3300031728 Bacteria 1595
188 Ga0307405_10544256 3300031731 Unclassified 938
189 Ga0307413_10638013 3300031824 Bacteria 877
190 Ga0307406_10039165 3300031901 Bacteria 2939
191 Ga0307407_10060997 3300031903 Bacteria 2203
192 Ga0307412_10078652 3300031911 Bacteria 2273
193 Ga0307409_100064764 3300031995 Bacteria 2873
194 Ga0307409_100231890 3300031995 Bacteria 1674
195 Ga0307409_100393655 3300031995 Bacteria 1321
196 Ga0307416_100055928 3300032002 Bacteria 3180
197 Ga0307416_100123788 3300032002 Bacteria 2312
198 Ga0307416_100265382 3300032002 Bacteria 1681
199 Ga0307415_100059346 3300032126 Bacteria 2638
200 Ga0307415_100226961 3300032126 Bacteria 1501
201 Ga0316580_10057429 3300032139 Bacteria 1196
202 Ga0373961_0065012 3300035241 Bacteria 1116
203 Ga0373962_0105983 3300035242 Bacteria 882
204 Ga0316574_0124793 3300035398 Bacteria 1654
205 Ga0316574_0169575 3300035398 Bacteria 1405
206 Ga0373931_0407480 3300035691 Bacteria 862
207 Ga0373947_0237520 3300035725 Bacteria 1202
208 Ga0373937_0239687 3300036401 Bacteria 1709
209 Ga0373937_0297703 3300036401 Unclassified 1525
210 Ga0316582_0130869 3300036647 Bacteria 1685
211 Ga0316584_0093387 3300036712 Bacteria 2253
212 Ga0395901_0191494 3300038443 Bacteria 2145
213 Ga0439465_0031447 3300041413 Bacteria 1691
214 Ga0451793_0351195 3300041452 Bacteria 811
215 Ga0451835_0081341 3300041492 Bacteria 659
216 Ga0451853_0638184 3300041512 Bacteria 3311
217 Ga0451853_0853517 3300041512 Bacteria 1885
218 Ga0450920_027302 3300042122 Bacteria 1117
219 Ga0450910_002557 3300042147 Bacteria 2395
220 Ga0439446_0039803 3300042156 Bacteria 1382
221 Ga0451577_0013630 3300042876 Bacteria 7603
222 Ga0451576_0277356 3300045051 Bacteria 1753
223 Ga0495651_0009460 3300046462 Bacteria 7485
224 Ga0495630_0117698 3300046517 Bacteria 2015
225 Ga0495665_0317608 3300046531 Bacteria 796
226 Ga0495640_0220999 3300046533 Bacteria 1195
227 Ga0495640_0292064 3300046533 Unclassified 1014
228 Ga0495656_0186374 3300046615 Bacteria 1023
229 Ga0495659_0063517 3300046664 Bacteria 1369
230 Ga0495658_0144108 3300046683 Bacteria 1459
231 Ga0495581_0215451 3300047315 Bacteria 1123
232 Ga0495674_0270208 3300047319 Bacteria 1395
233 Ga0495680_0503801 3300047322 Bacteria 821
234 Ga0495675_0223484 3300047444 Bacteria 1139
235 Ga0496101_0028060 3300048904 Bacteria 3927
236 Ga0496101_0042228 3300048904 Bacteria 3255
237 Ga0496102_0027910 3300048905 Bacteria 5043
238 Ga0496102_0058014 3300048905 Bacteria 3536
239 Ga0496102_0207414 3300048905 Bacteria 1848
240 Ga0496102_0353707 3300048905 Bacteria 1383
241 Ga0496103_0037499 3300048906 Bacteria 2970
242 Ga0496105_0000897 3300048908 Bacteria 20356
243 Ga0496105_0057067 3300048908 Unclassified 3224
244 Ga0496106_0146983 3300048909 Bacteria 1857
245 Ga0496106_0222731 3300048909 Bacteria 1505
246 Ga0496106_0457679 3300048909 Bacteria 1025
247 Ga0496108_0014211 3300048911 Bacteria 6496
248 Ga0496108_0114590 3300048911 Bacteria 2308
249 Ga0496108_0542887 3300048911 Bacteria 1014
250 Ga0496109_0013982 3300048912 Bacteria 6979
251 Ga0496109_0036325 3300048912 Bacteria 4446
252 Ga0496109_0088046 3300048912 Bacteria 2869
253 Ga0496109_0185449 3300048912 Bacteria 1955
254 Ga0496109_0420658 3300048912 Bacteria 1262
255 Ga0496109_0488782 3300048912 Bacteria 1162
256 Ga0496109_0669632 3300048912 Bacteria 975
257 Ga0496110_0167100 3300048913 Unclassified 1995
258 Ga0496110_0524696 3300048913 Bacteria 1077
259 Ga0496111_0029698 3300048914 Bacteria 3884
260 Ga0496111_0038587 3300048914 Bacteria 3423
261 Ga0496112_0000001 3300048915 Bacteria 1346031
262 Ga0496112_0045160 3300048915 Bacteria 4318
263 Ga0496112_0135705 3300048915 Bacteria 2431
264 Ga0496112_0138252 3300048915 Bacteria 2406
265 Ga0496112_0160026 3300048915 Bacteria 2218
266 Ga0496112_0435873 3300048915 Bacteria 1249
267 Ga0496112_0858659 3300048915 Bacteria 831
268 Ga0496113_0040124 3300048916 Bacteria 3448
269 Ga0496113_0096487 3300048916 Bacteria 2286
270 Ga0496113_0322684 3300048916 Bacteria 1238
271 Ga0501031_0012319 3300049568 Bacteria 5575
272 Ga0501031_0032783 3300049568 Bacteria 3388
273 Ga0501034_0302179 3300049571 Bacteria 1537
274 Ga0501036_0045097 3300049572 Bacteria 3735
275 Ga0501036_0216642 3300049572 Bacteria 1608
276 Ga0501037_0212669 3300049573 Bacteria 1363
277 Ga0501038_0052889 3300049574 Bacteria 3499
278 Ga0501039_0009038 3300049575 Bacteria 7591
279 Ga0501039_0065740 3300049575 Bacteria 2814
280 Ga0501039_0237256 3300049575 Bacteria 1434
281 Ga0501040_0090766 3300049576 Bacteria 2123
282 Ga0501040_0293252 3300049576 Bacteria 1162
283 Ga0501040_0380601 3300049576 Unclassified 1012
284 Ga0501040_0410381 3300049576 Bacteria 973
285 Ga0501041_0020723 3300049577 Bacteria 3933
286 Ga0501041_0038360 3300049577 Bacteria 2905
287 Ga0501041_0050850 3300049577 Bacteria 2526
288 Ga0501041_0215981 3300049577 Bacteria 1203
289 Ga0501042_0013445 3300049578 Bacteria 5571
290 Ga0501042_0119726 3300049578 Bacteria 1895
291 Ga0501042_0228746 3300049578 Bacteria 1341
292 Ga0501043_0045751 3300049579 Bacteria 3441
293 Ga0501046_0023948 3300049580 Bacteria 5013
294 Ga0501046_0344328 3300049580 Bacteria 1083
295 Ga0501048_0057411 3300049582 Bacteria 2761
296 Ga0501048_0058724 3300049582 Bacteria 2726
297 Ga0501048_0089475 3300049582 Unclassified 2172
298 Ga0501048_0114892 3300049582 Bacteria 1902
299 Ga0501068_0071995 3300049584 Bacteria 2110
300 Ga0501068_0186004 3300049584 Bacteria 1314
301 Ga0501068_0188165 3300049584 Bacteria 1307
302 Ga0501069_0008495 3300049585 Bacteria 5401
303 Ga0501069_0326729 3300049585 Bacteria 902
304 Ga0501069_0440788 3300049585 Bacteria 773
305 Ga0501070_0026478 3300049586 Bacteria 4864
306 Ga0501070_0052441 3300049586 Bacteria 3386
307 Ga0501071_0010007 3300049587 Bacteria 6338
308 Ga0501071_0157617 3300049587 Bacteria 1695
309 Ga0501071_0209147 3300049587 Bacteria 1467
310 Ga0501071_0338929 3300049587 Unclassified 1143
311 Ga0501071_0440165 3300049587 Bacteria 997
312 Ga0501071_0450884 3300049587 Bacteria 985
313 Ga0501072_0046891 3300049588 Bacteria 3402
314 Ga0501072_0152888 3300049588 Bacteria 1840
315 Ga0501072_0166723 3300049588 Unclassified 1757
316 Ga0501072_0189799 3300049588 Bacteria 1639
317 Ga0501072_0356480 3300049588 Bacteria 1161
318 Ga0501073_0025585 3300049589 Bacteria 4230
319 Ga0501073_0314103 3300049589 Bacteria 1081
320 Ga0501074_0016858 3300049590 Bacteria 5301
321 Ga0501074_0026509 3300049590 Bacteria 4202
322 Ga0501075_0005896 3300049591 Bacteria 8380
323 Ga0501075_0046519 3300049591 Bacteria 3259
324 Ga0501075_0165124 3300049591 Bacteria 1689
325 Ga0501075_0265625 3300049591 Bacteria 1308
326 Ga0501076_0009312 3300049592 Bacteria 7247
327 Ga0501076_0031240 3300049592 Bacteria 4152
328 Ga0501076_0066583 3300049592 Bacteria 2875
329 Ga0501076_0198430 3300049592 Bacteria 1638
330 Ga0501076_0313306 3300049592 Bacteria 1287
331 Ga0501076_0371855 3300049592 Bacteria 1174
332 Ga0501077_0009167 3300049593 Bacteria 6144
333 Ga0501077_0088530 3300049593 Unclassified 1962
334 Ga0501077_0150429 3300049593 Bacteria 1477
335 Ga0501077_0428243 3300049593 Unclassified 847
336 Ga0501216_048788 3300049660 Bacteria 828
337 Ga0501079_0028237 3300049741 Bacteria 4305
338 Ga0501079_0053098 3300049741 Bacteria 3127
339 Ga0501079_0090872 3300049741 Bacteria 2365
340 Ga0501079_0092508 3300049741 Bacteria 2343
341 Ga0501079_0103176 3300049741 Bacteria 2212
342 Ga0501079_0161852 3300049741 Bacteria 1745
343 Ga0501079_0229011 3300049741 Bacteria 1452
344 Ga0501080_0139756 3300049742 Bacteria 2240
345 Ga0501080_0147044 3300049742 Bacteria 2178
346 Ga0501080_0295082 3300049742 Bacteria 1471
347 Ga0501080_0377458 3300049742 Bacteria 1278
348 Ga0501081_0166876 3300049743 Bacteria 1588
349 Ga0501083_0079438 3300049744 Bacteria 2175
350 Ga0501083_0322393 3300049744 Unclassified 1005
351 Ga0501083_0333877 3300049744 Bacteria 986
352 Ga0501035_0011241 3300049822 Bacteria 8293
353 Ga0501035_0306214 3300049822 Bacteria 1338
354 Ga0501044_0535913 3300049823 Bacteria 1069
355 Ga0501045_0003587 3300049824 Bacteria 10659
356 Ga0501045_0021240 3300049824 Bacteria 4642
357 Ga0501045_0081150 3300049824 Bacteria 2391
358 Ga0501045_0164414 3300049824 Bacteria 1652
359 Ga0501045_0264336 3300049824 Bacteria 1281
360 Ga0501045_0322310 3300049824 Bacteria 1150
361 nmdc:mga05p37_119231_c1 3300050507 Bacteria 3242
362 nmdc:mga05p37_233042_c1 3300050507 Bacteria 2217
363 nmdc:mga05p37_99300_c1 3300050507 Bacteria 3585
364 nmdc:mga08y16_188371_c1 3300050511 Bacteria 2141
365 nmdc:mga08y16_65587_c1 3300050511 Bacteria 3790
366 nmdc:mga0n895_157946_c1 3300050512 Bacteria 2299
367 nmdc:mga0n895_805160_c1 3300050512 Bacteria 930
368 nmdc:mga0n895_89726_c1 3300050512 Bacteria 3075
369 nmdc:mga0rr50_129055_c1 3300050513 Bacteria 2022
370 nmdc:mga0rr50_405290_c1 3300050513 Bacteria 1152
371 nmdc:mga0a205_260450_c1 3300050515 Bacteria 1612
372 nmdc:mga0a205_364072_c1 3300050515 Bacteria 1312
373 nmdc:mga0a205_90421_c1 3300050515 Bacteria 2958
374 Ga0495601_0199595 3300053077 Unclassified 1307
375 Ga0495612_0000105 3300053078 Bacteria 35898
376 Ga0495595_0055402 3300053084 Bacteria 1846
377 Ga0501084_0039018 3300054114 Bacteria 3972
378 Ga0501084_0046024 3300054114 Bacteria 3653
379 Ga0501084_0083681 3300054114 Bacteria 2678
380 Ga0501084_0406080 3300054114 Bacteria 1151
381 Ga0590077_004897 3300059426 Bacteria 2739
382 Ga0501082_0034831 3300060353 Bacteria 4339
383 Ga0501082_0043228 3300060353 Bacteria 3884
384 Ga0501082_0126116 3300060353 Bacteria 2220
385 Ga0501082_0197958 3300060353 Bacteria 1748
386 Ga0501082_0296608 3300060353 Unclassified 1408
387 Ga0530510_0007855 3300061734 Bacteria 7441
388 Ga0530510_0016528 3300061734 Bacteria 5224
389 Ga0530510_0038461 3300061734 Bacteria 3454
390 Ga0530510_0213776 3300061734 Bacteria 1433
391 Ga0530510_0235299 3300061734 Bacteria 1363
392 Ga0530510_0290590 3300061734 Unclassified 1222
393 Ga0530510_0331581 3300061734 Bacteria 1141
394 Ga0501038_0421612
395 JGI25406J46586_10054311
396 Ga0070676_10502560
397 Ga0070690_100190183
398 Ga0070680_100185000
399 Ga0068868_100486577
400 Ga0070660_100409761
401 Ga0070687_100005158
402 Ga0070687_100430144
403 Ga0070692_10004237
404 Ga0070692_10183050
405 Ga0070675_100285525
406 Ga0070674_100012386
407 Ga0070674_100101885
408 Ga0070673_100043468
409 Ga0070667_100160530
410 Ga0070705_100057382
411 Ga0070705_100169368
412 Ga0070705_100250113
413 Ga0070700_100196820
414 Ga0070700_100254303
415 Ga0070708_100042507
416 Ga0070708_100258523
417 Ga0070662_100260495
418 Ga0070681_10069748
419 Ga0070681_10327446
420 Ga0070706_100005110
421 Ga0070706_100012465
422 Ga0070706_100729261
423 Ga0070707_100001989
424 Ga0070698_100484090
425 Ga0070698_100558732
426 Ga0070699_100751514
427 Ga0070679_100090797
428 Ga0070684_100167257
429 Ga0070697_100116928
430 Ga0070697_100272322
431 Ga0070695_100082041
432 Ga0070695_100230880
433 Ga0070696_100010845
434 Ga0070696_100011325
435 Ga0070696_100048652
436 Ga0070696_100056336
437 Ga0070704_100013266
438 Ga0070704_100196684
439 Ga0068854_100156015
440 Ga0070702_100430987
441 Ga0068852_100704428
442 Ga0068864_100173271
443 Ga0068861_100103113
444 Ga0068861_100500830
445 Ga0068870_10143080
446 Ga0068858_100044853
447 Ga0068858_100404674
448 Ga0068858_101031246
449 Ga0068860_100106061
450 Ga0068860_100140277
451 Ga0081538_10049300
452 Ga0081539_10005451
453 Ga0081539_10016720
454 Ga0075428_100075136
455 Ga0075431_100128780
456 Ga0075433_10384162
457 Ga0075434_100041366
458 Ga0075434_100149975
459 Ga0075434_100167338
460 Ga0075434_100869212
461 Ga0075435_100036534
462 Ga0075435_100105965
463 Ga0075435_100151327
464 Ga0105251_10155703
465 Ga0111539_10081833
466 Ga0111539_10358934
467 Ga0111539_10491200
468 Ga0105245_10081191
469 Ga0105245_11023864
470 Ga0105247_10095518
471 Ga0114129_10045439
472 Ga0114129_10053783
473 Ga0114129_10165677
474 Ga0114129_10201721
475 Ga0105243_10096407
476 Ga0105243_10158910
477 Ga0105249_10016168
478 Ga0105249_10226484
479 Ga0105249_10300247
480 Ga0105249_10330624
481 Ga0099796_10072426
482 Ga0105239_11113977
483 Ga0105246_10133822
484 Ga0105246_10201757
485 Ga0157375_10183547
486 Ga0157375_10350814
487 Ga0157375_10448808
488 Ga0163163_10061561
489 Ga0163163_10103820
490 Ga0163163_10230054
491 Ga0157380_10296547
492 Ga0157377_10026361
493 Ga0157377_10107850
494 Ga0157379_10005844
495 Ga0157379_10947981
496 Ga0163161_10250963
497 Ga0207710_10059806
498 Ga0207647_10188572
499 Ga0207645_10255961
500 Ga0207684_10000540
501 Ga0207684_10012636
502 Ga0207684_10180038
503 Ga0207660_10366661
504 Ga0207660_10679211
505 Ga0207657_10202544
506 Ga0207649_10137056
507 Ga0207652_10340203
508 Ga0207646_10000368
509 Ga0207646_10023184
510 Ga0207646_10483765
511 Ga0207659_10070517
512 Ga0207687_10364592
513 Ga0207690_10289577
514 Ga0207690_10429623
515 Ga0207706_10141737
516 Ga0207706_10391789
517 Ga0207709_10331641
518 Ga0207709_10708108
519 Ga0207669_10315373
520 Ga0207669_10542984
521 Ga0207691_10124465
522 Ga0207689_10077735
523 Ga0207689_10303763
524 Ga0207689_10625979
525 Ga0207689_10692267
526 Ga0207661_10083825
527 Ga0207651_10177311
528 Ga0207651_10267898
529 Ga0207651_10302189
530 Ga0207712_10149857
531 Ga0207712_10347813
532 Ga0207640_10212574
533 Ga0207640_10308430
534 Ga0207703_10547977
535 Ga0207703_10684568
536 Ga0207708_10151738
537 Ga0207708_10199463
538 Ga0207708_10364470
539 Ga0207641_10210319
540 Ga0207675_100050707
541 Ga0207675_100121907
542 Ga0207675_100466925
543 Ga0207683_10709498
544 Ga0207428_10095075
545 Ga0268265_10369740
546 Ga0268264_10175010
547 Ga0268264_10242137
548 Ga0265326_10074062
549 Ga0265319_1004544
550 Ga0265319_1038618
551 Ga0265334_10033343
552 Ga0265318_10038786
553 Ga0265318_10173574
554 Ga0265323_10067832
555 Ga0265322_10017559
556 Ga0265336_10006539
557 Ga0265338_10062805
558 Ga0265324_10008873
559 Ga0265324_10012035
560 Ga0265330_10083828
561 Ga0265328_10021481
562 Ga0265328_10061256
563 Ga0265320_10026376
564 Ga0265325_10030684
565 Ga0265329_10002788
566 Ga0265329_10015956
567 Ga0265329_10040643
568 Ga0265339_10045562
569 Ga0265339_10051637
570 Ga0265316_10051929
571 Ga0265316_10242697
572 Ga0265313_10037978
573 Ga0265313_10068917
574 Ga0265314_10335914
575 Ga0265342_10026314
576 Ga0316576_10051579
577 Ga0316576_10083021
578 Ga0316576_10091120
579 Ga0316576_10225743
580 Ga0316578_10117931
581 Ga0307405_10544256
582 Ga0307413_10638013
583 Ga0307406_10039165
584 Ga0307407_10060997
585 Ga0307412_10078652
586 Ga0307409_100064764
587 Ga0307409_100231890
588 Ga0307409_100393655
589 Ga0307416_100055928
590 Ga0307416_100123788
591 Ga0307416_100265382
592 Ga0307415_100059346
593 Ga0307415_100226961
594 Ga0316580_10057429
595 Ga0373961_0065012
596 Ga0373962_0105983
597 Ga0316574_0124793
598 Ga0316574_0169575
599 Ga0373931_0407480
600 Ga0373947_0237520
601 Ga0373937_0239687
602 Ga0373937_0297703
603 Ga0316582_0130869
604 Ga0316584_0093387
605 Ga0395901_0191494
606 Ga0439465_0031447
607 Ga0451793_0351195
608 Ga0451835_0081341
609 Ga0451853_0638184
610 Ga0451853_0853517
611 Ga0450920_027302
612 Ga0450910_002557
613 Ga0439446_0039803
614 Ga0451577_0013630
615 Ga0451576_0277356
616 Ga0495651_0009460
617 Ga0495630_0117698
618 Ga0495665_0317608
619 Ga0495640_0220999
620 Ga0495640_0292064
621 Ga0495656_0186374
622 Ga0495659_0063517
623 Ga0495658_0144108
624 Ga0495581_0215451
625 Ga0495674_0270208
626 Ga0495680_0503801
627 Ga0495675_0223484
628 Ga0496101_0028060
629 Ga0496101_0042228
630 Ga0496102_0027910
631 Ga0496102_0058014
632 Ga0496102_0207414
633 Ga0496102_0353707
634 Ga0496103_0037499
635 Ga0496105_0000897
636 Ga0496105_0057067
637 Ga0496106_0146983
638 Ga0496106_0222731
639 Ga0496106_0457679
640 Ga0496108_0014211
641 Ga0496108_0114590
642 Ga0496108_0542887
643 Ga0496109_0013982
644 Ga0496109_0036325
645 Ga0496109_0088046
646 Ga0496109_0185449
647 Ga0496109_0420658
648 Ga0496109_0488782
649 Ga0496109_0669632
650 Ga0496110_0167100
651 Ga0496110_0524696
652 Ga0496111_0029698
653 Ga0496111_0038587
654 Ga0496112_0000001
655 Ga0496112_0045160
656 Ga0496112_0135705
657 Ga0496112_0138252
658 Ga0496112_0160026
659 Ga0496112_0435873
660 Ga0496112_0858659
661 Ga0496113_0040124
662 Ga0496113_0096487
663 Ga0496113_0322684
664 Ga0501031_0012319
665 Ga0501031_0032783
666 Ga0501034_0302179
667 Ga0501036_0045097
668 Ga0501036_0216642
669 Ga0501037_0212669
670 Ga0501038_0052889
671 Ga0501039_0009038
672 Ga0501039_0065740
673 Ga0501039_0237256
674 Ga0501040_0090766
675 Ga0501040_0293252
676 Ga0501040_0380601
677 Ga0501040_0410381
678 Ga0501041_0020723
679 Ga0501041_0038360
680 Ga0501041_0050850
681 Ga0501041_0215981
682 Ga0501042_0013445
683 Ga0501042_0119726
684 Ga0501042_0228746
685 Ga0501043_0045751
686 Ga0501046_0023948
687 Ga0501046_0344328
688 Ga0501048_0057411
689 Ga0501048_0058724
690 Ga0501048_0089475
691 Ga0501048_0114892
692 Ga0501068_0071995
693 Ga0501068_0186004
694 Ga0501068_0188165
695 Ga0501069_0008495
696 Ga0501069_0326729
697 Ga0501069_0440788
698 Ga0501070_0026478
699 Ga0501070_0052441
700 Ga0501071_0010007
701 Ga0501071_0157617
702 Ga0501071_0209147
703 Ga0501071_0338929
704 Ga0501071_0440165
705 Ga0501071_0450884
706 Ga0501072_0046891
707 Ga0501072_0152888
708 Ga0501072_0166723
709 Ga0501072_0189799
710 Ga0501072_0356480
711 Ga0501073_0025585
712 Ga0501073_0314103
713 Ga0501074_0016858
714 Ga0501074_0026509
715 Ga0501075_0005896
716 Ga0501075_0046519
717 Ga0501075_0165124
718 Ga0501075_0265625
719 Ga0501076_0009312
720 Ga0501076_0031240
721 Ga0501076_0066583
722 Ga0501076_0198430
723 Ga0501076_0313306
724 Ga0501076_0371855
725 Ga0501077_0009167
726 Ga0501077_0088530
727 Ga0501077_0150429
728 Ga0501077_0428243
729 Ga0501216_048788
730 Ga0501079_0028237
731 Ga0501079_0053098
732 Ga0501079_0090872
733 Ga0501079_0092508
734 Ga0501079_0103176
735 Ga0501079_0161852
736 Ga0501079_0229011
737 Ga0501080_0139756
738 Ga0501080_0147044
739 Ga0501080_0295082
740 Ga0501080_0377458
741 Ga0501081_0166876
742 Ga0501083_0079438
743 Ga0501083_0322393
744 Ga0501083_0333877
745 Ga0501035_0011241
746 Ga0501035_0306214
747 Ga0501044_0535913
748 Ga0501045_0003587
749 Ga0501045_0021240
750 Ga0501045_0081150
751 Ga0501045_0164414
752 Ga0501045_0264336
753 Ga0501045_0322310
754 nmdc:mga05p37_119231_c1
755 nmdc:mga05p37_233042_c1
756 nmdc:mga05p37_99300_c1
757 nmdc:mga08y16_188371_c1
758 nmdc:mga08y16_65587_c1
759 nmdc:mga0n895_157946_c1
760 nmdc:mga0n895_805160_c1
761 nmdc:mga0n895_89726_c1
762 nmdc:mga0rr50_129055_c1
763 nmdc:mga0rr50_405290_c1
764 nmdc:mga0a205_260450_c1
765 nmdc:mga0a205_364072_c1
766 nmdc:mga0a205_90421_c1
767 Ga0495601_0199595
768 Ga0495612_0000105
769 Ga0495595_0055402
770 Ga0501084_0039018
771 Ga0501084_0046024
772 Ga0501084_0083681
773 Ga0501084_0406080
774 Ga0590077_004897
775 Ga0501082_0034831
776 Ga0501082_0043228
777 Ga0501082_0126116
778 Ga0501082_0197958
779 Ga0501082_0296608
780 Ga0530510_0007855
781 Ga0530510_0016528
782 Ga0530510_0038461
783 Ga0530510_0213776
784 Ga0530510_0235299
785 Ga0530510_0290590
786 Ga0530510_0331581

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18462

DUF5612

Domain of unknown function (DUF5612)

122

263

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ru1-assembly9.cif.gz_I error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8002 80 183
3gbv-assembly1.cif.gz_B crystal structure of a putative laci transcriptional regulator from bacteroides fragilis 0.7993 80 183
7x0h-assembly2.cif.gz_B crystal structure of sugar binding protein cbpa complexed wtih glucose from clostridium thermocellum 0.7892 80 183
3g1w-assembly1.cif.gz_A crystal structure of sugar abc transporter (sugar-binding protein) from bacillus halodurans 0.7834 80 183
1dbp-assembly1.cif.gz_A identical mutations at corresponding positions in two homologous proteins with non-identical effects 0.7777 80 183
ID Description Score Start End Superfamily
1y7pC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Hypothetical protein af1403; domain 2 0.9698 79 212 3.40.50.10550
1y7pC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Hypothetical protein af1403; domain 2 0.9422 79 212 3.40.50.10550
3ejwB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7724 80 196 3.40.50.2300
4ru1C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7666 80 197 3.40.50.2300
3g1wB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7642 80 197 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A536AH28-F1-model_v4 DUF5612 domain-containing protein 0.9749 85 213
AF-A0A832CBH7-F1-model_v4 DUF5612 domain-containing protein 0.97 110 213
AF-A0A7C2XLJ4-F1-model_v4 DUF5612 domain-containing protein 0.9645 128 213
AF-A0A832CBH7-F1-model_v4 DUF5612 domain-containing protein 0.9609 110 213
AF-A0A536AH28-F1-model_v4 DUF5612 domain-containing protein 0.9603 85 213

Map