F432660

General Info

Members Datasets Scaffolds Average Seq Length
393 231 786 281

Family's Representative Sequence

Representative Sequence 3300041443|Ga0451789_0675435|Ga0451789_0675435_223_1143
Length 296
Sequence MLRTASHPHRSNRNIGLRRITARGFRFIILAVFAVFFIAPVIWLTLAPTKSDEALVTKGAFSFGSFHQVVQAWNNLDAYSDHIYRAWIGNSLLYAFSATAIVLVTAIPAGYGLALGRFPGRKLILTAALVLPIFLELNSMGLIGSSLSVILPFSLFPFGVYLAYIYYTTAIPRDLLDAARVDGCGEWSTFRHIALPLGKPVVALVFFFSFVADWNNFFLPYAFLADSTQYPIQVGLSNLLSSTPAFNPASGAGSAVKIFRPELALATFIAVVPVAIVFMLSQRALVRGLVGGGVKE

Samples

Sample ID Description Type Environment
1 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
96 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
97 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
98 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
99 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
100 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
101 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
102 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
105 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
106 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
118 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
119 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
120 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
123 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
124 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
143 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
144 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
145 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
146 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
147 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
148 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
149 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.8
Nodule 0
Rhizoplane 8.65
Rhizosphere 87.02
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451789_0675435 3300041443 Bacteria 1373
2 JGI25406J46586_10005176 3300003203 Bacteria 6050
3 Ga0070683_100587777 3300005329 Bacteria 1065
4 Ga0070670_100232926 3300005331 Bacteria 1603
5 Ga0070682_100076951 3300005337 Bacteria 2149
6 Ga0070660_100097167 3300005339 Bacteria 2330
7 Ga0070671_100321845 3300005355 Bacteria 1318
8 Ga0070688_100188162 3300005365 Bacteria 1436
9 Ga0070667_100011166 3300005367 Bacteria 7431
10 Ga0070709_10233313 3300005434 Bacteria 1317
11 Ga0070709_10267551 3300005434 Bacteria 1237
12 Ga0070714_100005338 3300005435 Bacteria 9798
13 Ga0070714_100173990 3300005435 Bacteria 1955
14 Ga0070714_100275751 3300005435 Bacteria 1561
15 Ga0070714_100277238 3300005435 Bacteria 1557
16 Ga0070714_100330055 3300005435 Bacteria 1428
17 Ga0070714_100345849 3300005435 Bacteria 1396
18 Ga0070713_100085238 3300005436 Bacteria 2706
19 Ga0070713_100088522 3300005436 Bacteria 2657
20 Ga0070710_10054932 3300005437 Bacteria 2248
21 Ga0070710_10289658 3300005437 Bacteria 1065
22 Ga0070711_100166662 3300005439 Bacteria 1675
23 Ga0070708_100021868 3300005445 Bacteria 5417
24 Ga0070663_100011171 3300005455 Bacteria 5624
25 Ga0070678_100001887 3300005456 Bacteria 11315
26 Ga0070681_10590706 3300005458 Bacteria 1025
27 Ga0070706_100012141 3300005467 Bacteria 7989
28 Ga0070706_100329872 3300005467 Bacteria 1423
29 Ga0070707_100007315 3300005468 Bacteria 10251
30 Ga0070684_100407615 3300005535 Bacteria 1254
31 Ga0070697_100004929 3300005536 Bacteria 10239
32 Ga0070686_100116969 3300005544 Bacteria 1825
33 Ga0070704_100367992 3300005549 Bacteria 1218
34 Ga0068855_100036680 3300005563 Bacteria 5832
35 Ga0068857_100019229 3300005577 Bacteria 5997
36 Ga0068854_100337399 3300005578 Bacteria 1230
37 Ga0068854_100495372 3300005578 Bacteria 1028
38 Ga0068856_100044095 3300005614 Bacteria 4388
39 Ga0068856_100206767 3300005614 Bacteria 1977
40 Ga0070702_100002161 3300005615 Bacteria 8360
41 Ga0068852_100163774 3300005616 Bacteria 2079
42 Ga0068870_10028994 3300005840 Bacteria 2784
43 Ga0068863_100150476 3300005841 Bacteria 2227
44 Ga0068858_100232489 3300005842 Bacteria 1748
45 Ga0081455_10056305 3300005937 Bacteria 3340
46 Ga0081455_10124248 3300005937 Bacteria 2028
47 Ga0081539_10001931 3300005985 Bacteria 31888
48 Ga0081539_10005085 3300005985 Bacteria 13786
49 Ga0081539_10010191 3300005985 Bacteria 7696
50 Ga0081539_10082388 3300005985 Bacteria 1687
51 Ga0070717_10026315 3300006028 Bacteria 4640
52 Ga0070717_10061874 3300006028 Bacteria 3103
53 Ga0070717_10138357 3300006028 Bacteria 2099
54 Ga0070717_10141643 3300006028 Bacteria 2074
55 Ga0070717_10173498 3300006028 Bacteria 1876
56 Ga0070717_10303802 3300006028 Bacteria 1419
57 Ga0075365_10031294 3300006038 Bacteria 3413
58 Ga0075365_10085693 3300006038 Bacteria 2140
59 Ga0075363_100038163 3300006048 Bacteria 2525
60 Ga0075364_10064778 3300006051 Bacteria 2399
61 Ga0070716_100042366 3300006173 Bacteria 2541
62 Ga0070716_100101408 3300006173 Bacteria 1765
63 Ga0070712_100378706 3300006175 Bacteria 1164
64 Ga0075362_10015466 3300006177 Bacteria 3103
65 Ga0075367_10180321 3300006178 Bacteria 1317
66 Ga0097621_100125215 3300006237 Bacteria 2183
67 Ga0097621_100444845 3300006237 Bacteria 1167
68 Ga0068871_100009009 3300006358 Bacteria 7207
69 Ga0068871_100414512 3300006358 Bacteria 1202
70 Ga0075428_100071089 3300006844 Bacteria 3804
71 Ga0068865_100015409 3300006881 Bacteria 4876
72 Ga0068865_100233070 3300006881 Bacteria 1445
73 Ga0105240_10633887 3300009093 Bacteria 1173
74 Ga0105245_10110312 3300009098 Bacteria 2558
75 Ga0105247_10131959 3300009101 Bacteria 1629
76 Ga0105247_10304308 3300009101 Bacteria 1107
77 Ga0105243_10021424 3300009148 Bacteria 4906
78 Ga0105241_10020035 3300009174 Bacteria 4940
79 Ga0105241_10451721 3300009174 Bacteria 1137
80 Ga0105242_10095612 3300009176 Bacteria 2508
81 Ga0105248_10528422 3300009177 Bacteria 1330
82 Ga0105248_10756150 3300009177 Bacteria 1097
83 Ga0105237_10049160 3300009545 Bacteria 4240
84 Ga0105249_10776228 3300009553 Bacteria 1021
85 Ga0105239_10100051 3300010375 Bacteria 3206
86 Ga0105239_10202624 3300010375 Bacteria 2223
87 Ga0105246_10101285 3300011119 Bacteria 2098
88 Ga0105246_10361345 3300011119 Bacteria 1193
89 Ga0157369_10171728 3300013105 Bacteria 2284
90 Ga0157378_10007512 3300013297 Bacteria 9519
91 Ga0157375_10147366 3300013308 Bacteria 2486
92 Ga0157375_10177447 3300013308 Bacteria 2281
93 Ga0157375_10612477 3300013308 Bacteria 1247
94 Ga0163163_10233021 3300014325 Bacteria 1891
95 Ga0163163_10252909 3300014325 Bacteria 1813
96 Ga0157380_10101565 3300014326 Bacteria 2396
97 Ga0157379_10092341 3300014968 Bacteria 2715
98 Ga0207692_10203108 3300025898 Bacteria 1166
99 Ga0207642_10104423 3300025899 Bacteria 1429
100 Ga0207680_10193471 3300025903 Bacteria 1382
101 Ga0207699_10157674 3300025906 Bacteria 1508
102 Ga0207684_10072086 3300025910 Bacteria 2935
103 Ga0207654_10007166 3300025911 Bacteria 5615
104 Ga0207671_10144879 3300025914 Bacteria 1832
105 Ga0207693_10348867 3300025915 Bacteria 1158
106 Ga0207693_10393885 3300025915 Bacteria 1083
107 Ga0207657_10085891 3300025919 Bacteria 2635
108 Ga0207646_10009129 3300025922 Bacteria 9840
109 Ga0207694_10351289 3300025924 Bacteria 1220
110 Ga0207650_10284469 3300025925 Bacteria 1347
111 Ga0207700_10067059 3300025928 Bacteria 2745
112 Ga0207664_10003317 3300025929 Bacteria 10705
113 Ga0207664_10059706 3300025929 Bacteria 3038
114 Ga0207664_10063717 3300025929 Bacteria 2947
115 Ga0207664_10114296 3300025929 Bacteria 2249
116 Ga0207664_10300819 3300025929 Bacteria 1411
117 Ga0207664_10418514 3300025929 Bacteria 1193
118 Ga0207664_10502031 3300025929 Bacteria 1086
119 Ga0207644_10646632 3300025931 Bacteria 880
120 Ga0207686_10077522 3300025934 Bacteria 2158
121 Ga0207709_10076724 3300025935 Bacteria 2140
122 Ga0207709_10126096 3300025935 Bacteria 1737
123 Ga0207704_10318013 3300025938 Bacteria 1199
124 Ga0207711_10120714 3300025941 Bacteria 2339
125 Ga0207661_10521472 3300025944 Bacteria 1087
126 Ga0207667_10092642 3300025949 Bacteria 3121
127 Ga0207703_10102227 3300026035 Bacteria 2431
128 Ga0207678_10000318 3300026067 Bacteria 43470
129 Ga0207678_10217191 3300026067 Unclassified 1636
130 Ga0207702_10096377 3300026078 Bacteria 2602
131 Ga0207702_10182497 3300026078 Bacteria 1933
132 Ga0207702_10205068 3300026078 Bacteria 1830
133 Ga0207641_10090986 3300026088 Bacteria 2670
134 Ga0207648_10163820 3300026089 Bacteria 1964
135 Ga0207674_10026271 3300026116 Bacteria 6190
136 Ga0207683_10003521 3300026121 Bacteria 13653
137 Ga0207698_10019244 3300026142 Bacteria 4671
138 Ga0268264_10069177 3300028381 Bacteria 2985
139 Ga0265337_1000156 3300028556 Bacteria 34716
140 Ga0265326_10010570 3300028558 Bacteria 2735
141 Ga0265319_1000843 3300028563 Bacteria 19562
142 Ga0265319_1000874 3300028563 Bacteria 19171
143 Ga0265319_1013580 3300028563 Bacteria 3229
144 Ga0265334_10000743 3300028573 Bacteria 16337
145 Ga0265334_10013801 3300028573 Bacteria 3376
146 Ga0265318_10004859 3300028577 Bacteria 6417
147 Ga0265318_10031092 3300028577 Bacteria 2073
148 Ga0265318_10035652 3300028577 Bacteria 1912
149 Ga0265323_10003677 3300028653 Bacteria 6723
150 Ga0265322_10008263 3300028654 Bacteria 3033
151 Ga0265336_10001413 3300028666 Bacteria 11078
152 Ga0265338_10005379 3300028800 Bacteria 16731
153 Ga0265338_10018594 3300028800 Bacteria 7425
154 Ga0265338_10173531 3300028800 Bacteria 1650
155 Ga0265324_10001619 3300029957 Bacteria 12511
156 Ga0265332_10002633 3300031238 Bacteria 9038
157 Ga0265320_10013347 3300031240 Bacteria 4729
158 Ga0265320_10015738 3300031240 Bacteria 4265
159 Ga0265320_10016495 3300031240 Bacteria 4137
160 Ga0265325_10011589 3300031241 Bacteria 5065
161 Ga0265340_10006442 3300031247 Bacteria 6460
162 Ga0265339_10039591 3300031249 Bacteria 2624
163 Ga0265327_10028978 3300031251 Bacteria 3156
164 Ga0265316_10005960 3300031344 Bacteria 11735
165 Ga0265316_10121218 3300031344 Bacteria 1975
166 Ga0265313_10023877 3300031595 Bacteria 3283
167 Ga0265313_10058734 3300031595 Bacteria 1812
168 Ga0265314_10005141 3300031711 Bacteria 11898
169 Ga0265314_10008586 3300031711 Bacteria 8736
170 Ga0265314_10049668 3300031711 Bacteria 2935
171 Ga0265314_10173192 3300031711 Bacteria 1301
172 Ga0265342_10010346 3300031712 Bacteria 6483
173 Ga0307416_100086148 3300032002 Bacteria 2677
174 Ga0307415_100030531 3300032126 Bacteria 3461
175 Ga0373926_0011982 3300035083 Bacteria 2926
176 Ga0373934_0016988 3300035086 Bacteria 2772
177 Ga0373934_0048423 3300035086 Bacteria 1683
178 Ga0373944_0042324 3300035089 Bacteria 1412
179 Ga0373923_0000111 3300035111 Bacteria 14710
180 Ga0373936_0009306 3300035113 Bacteria 3701
181 Ga0373936_0011275 3300035113 Bacteria 3381
182 Ga0373941_0034141 3300035115 Bacteria 1533
183 Ga0373954_0008679 3300035118 Bacteria 4469
184 Ga0373954_0150974 3300035118 Bacteria 1135
185 Ga0373956_0051032 3300035119 Bacteria 1858
186 Ga0373956_0079291 3300035119 Bacteria 1505
187 Ga0373943_0000380 3300035170 Bacteria 18645
188 Ga0373943_0002832 3300035170 Bacteria 7879
189 Ga0373946_0000551 3300035171 Bacteria 12406
190 Ga0373946_0001699 3300035171 Bacteria 7672
191 Ga0373955_0007319 3300035172 Bacteria 5070
192 Ga0373924_0000341 3300035410 Bacteria 14305
193 Ga0373935_0001054 3300035692 Bacteria 15012
194 Ga0373935_0010286 3300035692 Bacteria 5609
195 Ga0373927_0006486 3300035695 Bacteria 7970
196 Ga0373933_0003331 3300035724 Bacteria 8958
197 Ga0373933_0108740 3300035724 Bacteria 1727
198 Ga0373947_0005279 3300035725 Bacteria 7552
199 Ga0373947_0008591 3300035725 Bacteria 5880
200 Ga0373937_0015781 3300036401 Bacteria 6692
201 Ga0373937_0093591 3300036401 Bacteria 2786
202 Ga0373937_0113607 3300036401 Bacteria 2520
203 Ga0373937_0462204 3300036401 Bacteria 1205
204 Ga0373925_0000630 3300037068 Bacteria 33327
205 Ga0395900_0306622 3300037418 Bacteria 1572
206 Ga0395898_0094685 3300037466 Bacteria 2870
207 Ga0395898_0115100 3300037466 Bacteria 2577
208 Ga0395898_0485937 3300037466 Bacteria 1175
209 Ga0395905_0298619 3300037471 Bacteria 1498
210 Ga0395901_0006011 3300038443 Bacteria 12297
211 Ga0395901_0171323 3300038443 Bacteria 2278
212 Ga0395901_0347960 3300038443 Bacteria 1530
213 Ga0436365_0932945 3300039437 Bacteria 1988
214 Ga0436360_0595335 3300039438 Bacteria 967
215 Ga0436360_0777850 3300039438 Bacteria 12828
216 Ga0436361_0037866 3300039447 Bacteria 1487
217 Ga0436362_0585504 3300039453 Bacteria 970
218 Ga0451791_1014293 3300041451 Bacteria 1499
219 Ga0451800_0585469 3300041459 Bacteria 1553
220 Ga0451833_0843542 3300041491 Bacteria 1465
221 Ga0451835_0324031 3300041492 Bacteria 1064
222 Ga0451837_0846799 3300041494 Bacteria 1329
223 Ga0451839_0483270 3300041496 Bacteria 2069
224 Ga0451841_0655692 3300041498 Bacteria 2708
225 Ga0466972_0007582 3300044658 Bacteria 5449
226 Ga0466966_0002695 3300044684 Bacteria 11638
227 Ga0466966_0026031 3300044684 Bacteria 3820
228 Ga0466966_0065625 3300044684 Bacteria 2282
229 Ga0466961_0000491 3300044693 Bacteria 25161
230 Ga0466963_0007064 3300044694 Bacteria 6685
231 Ga0466963_0012937 3300044694 Bacteria 5115
232 Ga0466963_0014394 3300044694 Bacteria 4876
233 Ga0466963_0015060 3300044694 Bacteria 4781
234 Ga0466963_0095251 3300044694 Bacteria 2032
235 Ga0466963_0105160 3300044694 Bacteria 1935
236 Ga0466963_0110922 3300044694 Bacteria 1883
237 Ga0466963_0126526 3300044694 Bacteria 1762
238 Ga0466963_0129390 3300044694 Bacteria 1743
239 Ga0466963_0137084 3300044694 Bacteria 1694
240 Ga0466963_0246261 3300044694 Bacteria 1254
241 Ga0466964_0000622 3300044706 Bacteria 11276
242 Ga0466964_0115453 3300044706 Bacteria 1203
243 Ga0466971_0020040 3300044719 Bacteria 2973
244 Ga0466971_0051506 3300044719 Bacteria 1853
245 Ga0466971_0071775 3300044719 Bacteria 1573
246 Ga0466970_0004956 3300044765 Bacteria 6577
247 Ga0466957_0066216 3300044842 Bacteria 2226
248 Ga0466957_0283669 3300044842 Bacteria 1109
249 Ga0466959_0003921 3300045049 Bacteria 9881
250 Ga0466959_0043738 3300045049 Bacteria 3300
251 Ga0466958_0000872 3300045836 Bacteria 13467
252 Ga0466958_0041983 3300045836 Bacteria 2753
253 Ga0466958_0102657 3300045836 Bacteria 1779
254 Ga0466967_0010476 3300045976 Bacteria 6959
255 Ga0466967_0013089 3300045976 Bacteria 6390
256 Ga0466967_0017885 3300045976 Bacteria 5647
257 Ga0466967_0022143 3300045976 Bacteria 5179
258 Ga0466967_0044539 3300045976 Bacteria 3849
259 Ga0466967_0127992 3300045976 Bacteria 2354
260 Ga0466967_0154907 3300045976 Bacteria 2145
261 Ga0466967_0241833 3300045976 Bacteria 1722
262 Ga0466967_0250802 3300045976 Bacteria 1691
263 Ga0466967_0508602 3300045976 Bacteria 1183
264 Ga0466967_0538920 3300045976 Bacteria 1148
265 Ga0495603_0002107 3300046455 Bacteria 11707
266 Ga0495603_0053291 3300046455 Bacteria 2400
267 Ga0495603_0152925 3300046455 Bacteria 1340
268 Ga0495629_0003673 3300046459 Bacteria 11592
269 Ga0495629_0104023 3300046459 Bacteria 1980
270 Ga0495641_0000503 3300046461 Bacteria 32708
271 Ga0495641_0011922 3300046461 Bacteria 4904
272 Ga0495651_0001840 3300046462 Bacteria 16392
273 Ga0495653_0019301 3300046463 Bacteria 5528
274 Ga0495653_0060764 3300046463 Bacteria 2861
275 Ga0495653_0071945 3300046463 Bacteria 2583
276 Ga0495653_0325220 3300046463 Bacteria 995
277 Ga0495580_0002808 3300046472 Bacteria 14980
278 Ga0495582_0003261 3300046473 Bacteria 9111
279 Ga0495639_0000258 3300046475 Bacteria 26363
280 Ga0495662_0000059 3300046476 Bacteria 37941
281 Ga0495664_0027558 3300046477 Bacteria 3313
282 Ga0495664_0115975 3300046477 Bacteria 1619
283 Ga0495594_0012655 3300046499 Bacteria 4399
284 Ga0495608_0002973 3300046511 Bacteria 12119
285 Ga0495608_0050564 3300046511 Bacteria 2757
286 Ga0495618_0002534 3300046514 Bacteria 11703
287 Ga0495628_0045097 3300046516 Bacteria 3506
288 Ga0495630_0013476 3300046517 Bacteria 5946
289 Ga0495630_0319990 3300046517 Bacteria 1186
290 Ga0495666_0004557 3300046526 Bacteria 7003
291 Ga0495652_0065613 3300046529 Bacteria 3049
292 Ga0495665_0000181 3300046531 Bacteria 32208
293 Ga0495665_0010347 3300046531 Bacteria 5048
294 Ga0495640_0003942 3300046533 Bacteria 11883
295 Ga0495586_0001645 3300046535 Bacteria 12256
296 Ga0495586_0014580 3300046535 Bacteria 4176
297 Ga0495586_0173940 3300046535 Bacteria 1217
298 Ga0495587_0028953 3300046536 Bacteria 3364
299 Ga0495667_0012865 3300046559 Bacteria 5670
300 Ga0495667_0101045 3300046559 Bacteria 1866
301 Ga0495667_0161659 3300046559 Bacteria 1440
302 Ga0495634_0006618 3300046642 Bacteria 8788
303 Ga0495634_0021360 3300046642 Bacteria 4577
304 Ga0495634_0146438 3300046642 Bacteria 1496
305 Ga0495635_0002232 3300046663 Bacteria 13160
306 Ga0495635_0035255 3300046663 Bacteria 3469
307 Ga0495635_0085448 3300046663 Bacteria 2159
308 Ga0495635_0146604 3300046663 Bacteria 1607
309 Ga0495588_0003918 3300046674 Bacteria 6525
310 Ga0495657_0004267 3300046675 Bacteria 11431
311 Ga0495657_0073057 3300046675 Bacteria 2235
312 Ga0495599_0033678 3300046678 Bacteria 3219
313 Ga0495599_0221409 3300046678 Bacteria 1158
314 Ga0495623_0059431 3300046679 Bacteria 2400
315 Ga0495658_0002615 3300046683 Bacteria 9047
316 Ga0495658_0016993 3300046683 Bacteria 3751
317 Ga0495613_0009619 3300046689 Bacteria 7181
318 Ga0495613_0027066 3300046689 Bacteria 4268
319 Ga0495613_0044464 3300046689 Bacteria 3286
320 Ga0495613_0053460 3300046689 Bacteria 2972
321 Ga0495624_0018365 3300046690 Bacteria 4676
322 Ga0495600_0035368 3300046809 Bacteria 3244
323 Ga0495600_0143703 3300046809 Bacteria 1547
324 Ga0495581_0015087 3300047315 Bacteria 4485
325 Ga0495581_0069151 3300047315 Bacteria 2042
326 Ga0495604_0096743 3300047317 Bacteria 2178
327 Ga0495674_0001685 3300047319 Bacteria 21696
328 Ga0495674_0042173 3300047319 Bacteria 4071
329 Ga0495674_0047280 3300047319 Bacteria 3816
330 Ga0495674_0241622 3300047319 Bacteria 1488
331 Ga0495674_0342894 3300047319 Bacteria 1214
332 Ga0495676_0042691 3300047321 Bacteria 3720
333 Ga0495676_0256094 3300047321 Bacteria 1192
334 Ga0495680_0004608 3300047322 Bacteria 13139
335 Ga0495680_0008133 3300047322 Bacteria 9560
336 Ga0495680_0013553 3300047322 Bacteria 7106
337 Ga0495680_0015119 3300047322 Bacteria 6665
338 Ga0495675_0012848 3300047444 Bacteria 5276
339 Ga0495675_0111826 3300047444 Bacteria 1705
340 Ga0495684_0020865 3300047471 Bacteria 5048
341 Ga0495684_0067568 3300047471 Bacteria 2718
342 Ga0495684_0096144 3300047471 Bacteria 2242
343 Ga0495684_0185710 3300047471 Bacteria 1539
344 Ga0495593_0001208 3300047673 Bacteria 15108
345 Ga0495602_0056959 3300048088 Bacteria 3432
346 Ga0495602_0148027 3300048088 Bacteria 1849
347 Ga0495614_0004056 3300048089 Bacteria 6583
348 Ga0496100_0046496 3300048903 Bacteria 2791
349 Ga0496100_0106634 3300048903 Bacteria 1940
350 Ga0496101_0020112 3300048904 Bacteria 4565
351 Ga0496101_0321136 3300048904 Bacteria 1215
352 Ga0496102_0060439 3300048905 Bacteria 3465
353 Ga0496103_0079031 3300048906 Bacteria 2066
354 Ga0496104_0017512 3300048907 Bacteria 6526
355 Ga0496104_0051088 3300048907 Bacteria 3901
356 Ga0496104_0052323 3300048907 Bacteria 3857
357 Ga0496104_0187955 3300048907 Bacteria 1977
358 Ga0496104_0277065 3300048907 Bacteria 1590
359 Ga0496105_0060662 3300048908 Bacteria 3121
360 Ga0496105_0111533 3300048908 Bacteria 2257
361 Ga0496105_0145063 3300048908 Bacteria 1952
362 Ga0496106_0010535 3300048909 Bacteria 6828
363 Ga0496107_0061201 3300048910 Bacteria 2725
364 Ga0496108_0051370 3300048911 Bacteria 3454
365 Ga0496108_0089271 3300048911 Bacteria 2619
366 Ga0496109_0100864 3300048912 Bacteria 2678
367 Ga0496109_0131520 3300048912 Bacteria 2336
368 Ga0496110_0051606 3300048913 Bacteria 3614
369 Ga0496110_0151345 3300048913 Bacteria 2101
370 Ga0496110_0244741 3300048913 Bacteria 1632
371 Ga0496111_0084012 3300048914 Bacteria 2327
372 Ga0496111_0098234 3300048914 Bacteria 2150
373 Ga0496111_0126800 3300048914 Bacteria 1887
374 Ga0496111_0198642 3300048914 Bacteria 1491
375 Ga0496112_0365007 3300048915 Bacteria 1386
376 Ga0496114_0034611 3300048917 Bacteria 4169
377 Ga0496114_0134051 3300048917 Bacteria 2141
378 Ga0496115_0019854 3300048918 Bacteria 5177
379 Ga0501067_0050478 3300049583 Bacteria 2305
380 Ga0501070_0729948 3300049586 Unclassified 782
381 nmdc:mga03683_51344_c1 3300050489 Bacteria 1721
382 nmdc:mga00v17_254925_c1 3300050491 Bacteria 1138
383 nmdc:mga0yw44_22660_c1 3300050492 Bacteria 3525
384 nmdc:mga06z11_26843_c1 3300050494 Bacteria 2746
385 nmdc:mga05p37_79798_c1 3300050507 Bacteria 4030
386 nmdc:mga06r32_299809_c1 3300050510 Bacteria 1593
387 nmdc:mga0rr50_221538_c1 3300050513 Bacteria 1562
388 nmdc:mga0a205_148926_c1 3300050515 Bacteria 2240
389 Ga0495601_0009132 3300053077 Bacteria 5854
390 Ga0495612_0003695 3300053078 Bacteria 6352
391 Ga0495612_0254783 3300053078 Bacteria 781
392 Ga0495619_0000806 3300053085 Bacteria 20483
393 Ga0500620_047084 3300053155 Bacteria 1435
394 Ga0451789_0675435
395 JGI25406J46586_10005176
396 Ga0070683_100587777
397 Ga0070670_100232926
398 Ga0070682_100076951
399 Ga0070660_100097167
400 Ga0070671_100321845
401 Ga0070688_100188162
402 Ga0070667_100011166
403 Ga0070709_10233313
404 Ga0070709_10267551
405 Ga0070714_100005338
406 Ga0070714_100173990
407 Ga0070714_100275751
408 Ga0070714_100277238
409 Ga0070714_100330055
410 Ga0070714_100345849
411 Ga0070713_100085238
412 Ga0070713_100088522
413 Ga0070710_10054932
414 Ga0070710_10289658
415 Ga0070711_100166662
416 Ga0070708_100021868
417 Ga0070663_100011171
418 Ga0070678_100001887
419 Ga0070681_10590706
420 Ga0070706_100012141
421 Ga0070706_100329872
422 Ga0070707_100007315
423 Ga0070684_100407615
424 Ga0070697_100004929
425 Ga0070686_100116969
426 Ga0070704_100367992
427 Ga0068855_100036680
428 Ga0068857_100019229
429 Ga0068854_100337399
430 Ga0068854_100495372
431 Ga0068856_100044095
432 Ga0068856_100206767
433 Ga0070702_100002161
434 Ga0068852_100163774
435 Ga0068870_10028994
436 Ga0068863_100150476
437 Ga0068858_100232489
438 Ga0081455_10056305
439 Ga0081455_10124248
440 Ga0081539_10001931
441 Ga0081539_10005085
442 Ga0081539_10010191
443 Ga0081539_10082388
444 Ga0070717_10026315
445 Ga0070717_10061874
446 Ga0070717_10138357
447 Ga0070717_10141643
448 Ga0070717_10173498
449 Ga0070717_10303802
450 Ga0075365_10031294
451 Ga0075365_10085693
452 Ga0075363_100038163
453 Ga0075364_10064778
454 Ga0070716_100042366
455 Ga0070716_100101408
456 Ga0070712_100378706
457 Ga0075362_10015466
458 Ga0075367_10180321
459 Ga0097621_100125215
460 Ga0097621_100444845
461 Ga0068871_100009009
462 Ga0068871_100414512
463 Ga0075428_100071089
464 Ga0068865_100015409
465 Ga0068865_100233070
466 Ga0105240_10633887
467 Ga0105245_10110312
468 Ga0105247_10131959
469 Ga0105247_10304308
470 Ga0105243_10021424
471 Ga0105241_10020035
472 Ga0105241_10451721
473 Ga0105242_10095612
474 Ga0105248_10528422
475 Ga0105248_10756150
476 Ga0105237_10049160
477 Ga0105249_10776228
478 Ga0105239_10100051
479 Ga0105239_10202624
480 Ga0105246_10101285
481 Ga0105246_10361345
482 Ga0157369_10171728
483 Ga0157378_10007512
484 Ga0157375_10147366
485 Ga0157375_10177447
486 Ga0157375_10612477
487 Ga0163163_10233021
488 Ga0163163_10252909
489 Ga0157380_10101565
490 Ga0157379_10092341
491 Ga0207692_10203108
492 Ga0207642_10104423
493 Ga0207680_10193471
494 Ga0207699_10157674
495 Ga0207684_10072086
496 Ga0207654_10007166
497 Ga0207671_10144879
498 Ga0207693_10348867
499 Ga0207693_10393885
500 Ga0207657_10085891
501 Ga0207646_10009129
502 Ga0207694_10351289
503 Ga0207650_10284469
504 Ga0207700_10067059
505 Ga0207664_10003317
506 Ga0207664_10059706
507 Ga0207664_10063717
508 Ga0207664_10114296
509 Ga0207664_10300819
510 Ga0207664_10418514
511 Ga0207664_10502031
512 Ga0207644_10646632
513 Ga0207686_10077522
514 Ga0207709_10076724
515 Ga0207709_10126096
516 Ga0207704_10318013
517 Ga0207711_10120714
518 Ga0207661_10521472
519 Ga0207667_10092642
520 Ga0207703_10102227
521 Ga0207678_10000318
522 Ga0207678_10217191
523 Ga0207702_10096377
524 Ga0207702_10182497
525 Ga0207702_10205068
526 Ga0207641_10090986
527 Ga0207648_10163820
528 Ga0207674_10026271
529 Ga0207683_10003521
530 Ga0207698_10019244
531 Ga0268264_10069177
532 Ga0265337_1000156
533 Ga0265326_10010570
534 Ga0265319_1000843
535 Ga0265319_1000874
536 Ga0265319_1013580
537 Ga0265334_10000743
538 Ga0265334_10013801
539 Ga0265318_10004859
540 Ga0265318_10031092
541 Ga0265318_10035652
542 Ga0265323_10003677
543 Ga0265322_10008263
544 Ga0265336_10001413
545 Ga0265338_10005379
546 Ga0265338_10018594
547 Ga0265338_10173531
548 Ga0265324_10001619
549 Ga0265332_10002633
550 Ga0265320_10013347
551 Ga0265320_10015738
552 Ga0265320_10016495
553 Ga0265325_10011589
554 Ga0265340_10006442
555 Ga0265339_10039591
556 Ga0265327_10028978
557 Ga0265316_10005960
558 Ga0265316_10121218
559 Ga0265313_10023877
560 Ga0265313_10058734
561 Ga0265314_10005141
562 Ga0265314_10008586
563 Ga0265314_10049668
564 Ga0265314_10173192
565 Ga0265342_10010346
566 Ga0307416_100086148
567 Ga0307415_100030531
568 Ga0373926_0011982
569 Ga0373934_0016988
570 Ga0373934_0048423
571 Ga0373944_0042324
572 Ga0373923_0000111
573 Ga0373936_0009306
574 Ga0373936_0011275
575 Ga0373941_0034141
576 Ga0373954_0008679
577 Ga0373954_0150974
578 Ga0373956_0051032
579 Ga0373956_0079291
580 Ga0373943_0000380
581 Ga0373943_0002832
582 Ga0373946_0000551
583 Ga0373946_0001699
584 Ga0373955_0007319
585 Ga0373924_0000341
586 Ga0373935_0001054
587 Ga0373935_0010286
588 Ga0373927_0006486
589 Ga0373933_0003331
590 Ga0373933_0108740
591 Ga0373947_0005279
592 Ga0373947_0008591
593 Ga0373937_0015781
594 Ga0373937_0093591
595 Ga0373937_0113607
596 Ga0373937_0462204
597 Ga0373925_0000630
598 Ga0395900_0306622
599 Ga0395898_0094685
600 Ga0395898_0115100
601 Ga0395898_0485937
602 Ga0395905_0298619
603 Ga0395901_0006011
604 Ga0395901_0171323
605 Ga0395901_0347960
606 Ga0436365_0932945
607 Ga0436360_0595335
608 Ga0436360_0777850
609 Ga0436361_0037866
610 Ga0436362_0585504
611 Ga0451791_1014293
612 Ga0451800_0585469
613 Ga0451833_0843542
614 Ga0451835_0324031
615 Ga0451837_0846799
616 Ga0451839_0483270
617 Ga0451841_0655692
618 Ga0466972_0007582
619 Ga0466966_0002695
620 Ga0466966_0026031
621 Ga0466966_0065625
622 Ga0466961_0000491
623 Ga0466963_0007064
624 Ga0466963_0012937
625 Ga0466963_0014394
626 Ga0466963_0015060
627 Ga0466963_0095251
628 Ga0466963_0105160
629 Ga0466963_0110922
630 Ga0466963_0126526
631 Ga0466963_0129390
632 Ga0466963_0137084
633 Ga0466963_0246261
634 Ga0466964_0000622
635 Ga0466964_0115453
636 Ga0466971_0020040
637 Ga0466971_0051506
638 Ga0466971_0071775
639 Ga0466970_0004956
640 Ga0466957_0066216
641 Ga0466957_0283669
642 Ga0466959_0003921
643 Ga0466959_0043738
644 Ga0466958_0000872
645 Ga0466958_0041983
646 Ga0466958_0102657
647 Ga0466967_0010476
648 Ga0466967_0013089
649 Ga0466967_0017885
650 Ga0466967_0022143
651 Ga0466967_0044539
652 Ga0466967_0127992
653 Ga0466967_0154907
654 Ga0466967_0241833
655 Ga0466967_0250802
656 Ga0466967_0508602
657 Ga0466967_0538920
658 Ga0495603_0002107
659 Ga0495603_0053291
660 Ga0495603_0152925
661 Ga0495629_0003673
662 Ga0495629_0104023
663 Ga0495641_0000503
664 Ga0495641_0011922
665 Ga0495651_0001840
666 Ga0495653_0019301
667 Ga0495653_0060764
668 Ga0495653_0071945
669 Ga0495653_0325220
670 Ga0495580_0002808
671 Ga0495582_0003261
672 Ga0495639_0000258
673 Ga0495662_0000059
674 Ga0495664_0027558
675 Ga0495664_0115975
676 Ga0495594_0012655
677 Ga0495608_0002973
678 Ga0495608_0050564
679 Ga0495618_0002534
680 Ga0495628_0045097
681 Ga0495630_0013476
682 Ga0495630_0319990
683 Ga0495666_0004557
684 Ga0495652_0065613
685 Ga0495665_0000181
686 Ga0495665_0010347
687 Ga0495640_0003942
688 Ga0495586_0001645
689 Ga0495586_0014580
690 Ga0495586_0173940
691 Ga0495587_0028953
692 Ga0495667_0012865
693 Ga0495667_0101045
694 Ga0495667_0161659
695 Ga0495634_0006618
696 Ga0495634_0021360
697 Ga0495634_0146438
698 Ga0495635_0002232
699 Ga0495635_0035255
700 Ga0495635_0085448
701 Ga0495635_0146604
702 Ga0495588_0003918
703 Ga0495657_0004267
704 Ga0495657_0073057
705 Ga0495599_0033678
706 Ga0495599_0221409
707 Ga0495623_0059431
708 Ga0495658_0002615
709 Ga0495658_0016993
710 Ga0495613_0009619
711 Ga0495613_0027066
712 Ga0495613_0044464
713 Ga0495613_0053460
714 Ga0495624_0018365
715 Ga0495600_0035368
716 Ga0495600_0143703
717 Ga0495581_0015087
718 Ga0495581_0069151
719 Ga0495604_0096743
720 Ga0495674_0001685
721 Ga0495674_0042173
722 Ga0495674_0047280
723 Ga0495674_0241622
724 Ga0495674_0342894
725 Ga0495676_0042691
726 Ga0495676_0256094
727 Ga0495680_0004608
728 Ga0495680_0008133
729 Ga0495680_0013553
730 Ga0495680_0015119
731 Ga0495675_0012848
732 Ga0495675_0111826
733 Ga0495684_0020865
734 Ga0495684_0067568
735 Ga0495684_0096144
736 Ga0495684_0185710
737 Ga0495593_0001208
738 Ga0495602_0056959
739 Ga0495602_0148027
740 Ga0495614_0004056
741 Ga0496100_0046496
742 Ga0496100_0106634
743 Ga0496101_0020112
744 Ga0496101_0321136
745 Ga0496102_0060439
746 Ga0496103_0079031
747 Ga0496104_0017512
748 Ga0496104_0051088
749 Ga0496104_0052323
750 Ga0496104_0187955
751 Ga0496104_0277065
752 Ga0496105_0060662
753 Ga0496105_0111533
754 Ga0496105_0145063
755 Ga0496106_0010535
756 Ga0496107_0061201
757 Ga0496108_0051370
758 Ga0496108_0089271
759 Ga0496109_0100864
760 Ga0496109_0131520
761 Ga0496110_0051606
762 Ga0496110_0151345
763 Ga0496110_0244741
764 Ga0496111_0084012
765 Ga0496111_0098234
766 Ga0496111_0126800
767 Ga0496111_0198642
768 Ga0496112_0365007
769 Ga0496114_0034611
770 Ga0496114_0134051
771 Ga0496115_0019854
772 Ga0501067_0050478
773 Ga0501070_0729948
774 nmdc:mga03683_51344_c1
775 nmdc:mga00v17_254925_c1
776 nmdc:mga0yw44_22660_c1
777 nmdc:mga06z11_26843_c1
778 nmdc:mga05p37_79798_c1
779 nmdc:mga06r32_299809_c1
780 nmdc:mga0rr50_221538_c1
781 nmdc:mga0a205_148926_c1
782 Ga0495601_0009132
783 Ga0495612_0003695
784 Ga0495612_0254783
785 Ga0495619_0000806
786 Ga0500620_047084

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

15

291

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jbw-assembly1.cif.gz_F crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.6904 56 200
3pv0-assembly1.cif.gz_F crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide 0.6587 54 200
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.6377 9 265
8hpr-assembly1.cif.gz_B lpqy-sugabc in state 4 0.6099 7 203
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.6011 7 269
ID Description Score Start End Superfamily
af_P0AGH5_85_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6626 55 270 1.10.3720.10
3puzF04 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.652 67 200 1.10.3720.10
af_P0AGH5_85_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6518 55 270 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.648 3 268 1.10.3720.10
4xtcN00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6445 1 267 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A0F4KR46-F1-model_v4 Putative ABC transporter 0.7485 8 201 GO:0005886
GO:0055085
AF-A0A4Q3IQD2-F1-model_v4 Carbohydrate ABC transporter permease 0.7136 10 166 GO:0005886
GO:0055085
AF-W4U7B1-F1-model_v4 deleted 0.7099 22 204
AF-A0A6M5J5B7-F1-model_v4 Carbohydrate ABC transporter permease 0.7095 2 278 GO:0005886
GO:0055085
AF-D7CH83-F1-model_v4 ABC transporter permease protein 0.7075 1 272 GO:0005886
GO:0055085

Map