F432632

General Info

Members Datasets Scaffolds Average Seq Length
393 297 786 301

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10102423|Ga0307511_101024232
Length 282
Sequence MQLSGKVALVAGATRGGGRGIAAELGAAGATVYVTGRTTRGGISEYGRPGETIEETAELVDSAGGRGIAVQVDHLEAEQLDVLVNNVWGGEHLFEFEKPVWEHDLANGLRLLRLAVDTHLITAHHALPLLIERPGGLLIEVTDGTREYNEGHYRNTPFYDLAKTAGDRMGWLHARDLERHGATAVSLTPGWMRSEIMLEVFGVTEEHWRDAVAQEPHFALGRAVAALAGDPDRARWNGMSLSSGGLAKEYGFTDLDGSRPDAWRYIPEVQDSGKPADTTGYR

Samples

Sample ID Description Type Environment
1 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
78 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
79 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
138 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
139 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
142 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
143 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
191 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
192 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
193 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
194 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
199 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
200 2509276019 Ensifer aridi TW10 Isolate Nodule
201 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
202 2512875024
203 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
204 2516143018 Ensifer sp. BR816 Isolate Nodule
205 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
206 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
207 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
208 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
209 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
210 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
211 2643221723 Ensifer sp. Root278 Isolate Unclassified
212 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
213 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
214 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
215 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
216 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
217 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
218 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
219 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
220 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
221 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
222 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
223 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
224 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
225 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
226 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
227 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
228 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
229 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
230 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
231 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
232 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
233 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
234 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
235 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
236 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
237 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
238 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
239 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
240 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
241 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
242 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
243 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
244 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
245 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
246 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
247 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
248 2909042592 Labrys sp. LIt4 Isolate Nodule
249 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
250 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
251 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
252 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
253 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
254 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
255 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
256 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
257 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
258 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
259 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
260 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
261 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
262 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
263 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
264 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
265 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
266 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
267 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
268 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
269 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
270 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
271 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
272 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
273 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
274 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
275 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
276 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
277 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
278 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
279 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
280 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
281 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
282 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
283 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
284 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
285 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
286 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
287 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
288 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
289 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
290 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
291 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
292 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
293 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
294 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
295 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
296 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
297 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.81
Metatranscriptomes 0
Isolates 25.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.72
Nodule 18.83
Rhizoplane 6.62
Rhizosphere 54.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307511_10102423 3300030521 Bacteria 1871
2 JGI24740J21852_10001106 3300001979 Bacteria 12184
3 JGI25158J39367_1003315 3300002739 Bacteria 2498
4 JGI25152J39213_1004824 3300002773 Bacteria 4128
5 JGI25159J45721_1000005 3300002987 Bacteria 214315
6 JGI25151J46595_10003803 3300003187 Bacteria 8181
7 JGI25165J46597_1000034 3300003214 Bacteria 292458
8 JGI25160J50197_1000005 3300003354 Bacteria 417280
9 JGI25160J50197_1032066 3300003354 Bacteria 1341
10 JGI25161J50226_1000584 3300003374 Bacteria 15412
11 Ga0055542_1000997 3300003762 Bacteria 18150
12 Ga0055536_1000418 3300003781 Bacteria 30560
13 Ga0055531_10036268 3300003794 Bacteria 1525
14 Ga0055543_1000091 3300004625 Bacteria 79152
15 Ga0065165_1000002 3300005262 Bacteria 444192
16 Ga0070676_10045173 3300005328 Bacteria 2565
17 Ga0068869_100083826 3300005334 Bacteria 2385
18 Ga0070680_100022088 3300005336 Bacteria 5063
19 Ga0070682_100333815 3300005337 Bacteria 1124
20 Ga0068868_100075232 3300005338 Bacteria 2698
21 Ga0068868_100199726 3300005338 Bacteria 1666
22 Ga0070691_10001991 3300005341 Bacteria 9005
23 Ga0070668_100032646 3300005347 Bacteria 3962
24 Ga0070659_100113102 3300005366 Bacteria 2193
25 Ga0070667_100063325 3300005367 Bacteria 3133
26 Ga0070703_10009303 3300005406 Bacteria 2773
27 Ga0070701_10058480 3300005438 Bacteria 2023
28 Ga0070700_100019260 3300005441 Bacteria 3936
29 Ga0070700_100021552 3300005441 Bacteria 3746
30 Ga0070694_100138961 3300005444 Bacteria 1762
31 Ga0070678_100261422 3300005456 Bacteria 1456
32 Ga0070662_100063731 3300005457 Bacteria 2697
33 Ga0068867_100116546 3300005459 Bacteria 2059
34 Ga0070685_10093292 3300005466 Bacteria 1825
35 Ga0068853_100087956 3300005539 Bacteria 2727
36 Ga0070695_100016019 3300005545 Bacteria 4533
37 Ga0070696_100001812 3300005546 Bacteria 14026
38 Ga0070696_100057054 3300005546 Bacteria 2725
39 Ga0070704_100118529 3300005549 Bacteria 2028
40 Ga0070664_100306229 3300005564 Bacteria 1437
41 Ga0068857_100069593 3300005577 Bacteria 3134
42 Ga0068857_100107767 3300005577 Bacteria 2503
43 Ga0068854_100106991 3300005578 Bacteria 2105
44 Ga0068856_100209166 3300005614 Bacteria 1966
45 Ga0070702_100041036 3300005615 Bacteria 2592
46 Ga0068852_100049770 3300005616 Bacteria 3587
47 Ga0068859_100038025 3300005617 Bacteria 4830
48 Ga0068861_100108496 3300005719 Bacteria 2220
49 Ga0068870_10196249 3300005840 Bacteria 1221
50 Ga0068858_100139790 3300005842 Bacteria 2273
51 Ga0068862_100297542 3300005844 Bacteria 1484
52 Ga0068862_100315453 3300005844 Bacteria 1442
53 Ga0081538_10001651 3300005981 Bacteria 22862
54 Ga0081538_10016366 3300005981 Bacteria 5691
55 Ga0081538_10100848 3300005981 Bacteria 1454
56 Ga0081538_10107844 3300005981 Bacteria 1377
57 Ga0075365_10001689 3300006038 Bacteria 10212
58 Ga0075363_100001983 3300006048 Bacteria 8142
59 Ga0075363_100068964 3300006048 Bacteria 1918
60 Ga0075363_100139100 3300006048 Bacteria 1366
61 Ga0075364_10003022 3300006051 Bacteria 9501
62 Ga0075364_10146743 3300006051 Bacteria 1589
63 Ga0075367_10003174 3300006178 Bacteria 7753
64 Ga0075367_10079957 3300006178 Bacteria 1976
65 Ga0075428_100106486 3300006844 Bacteria 3057
66 Ga0075430_100029935 3300006846 Bacteria 4622
67 Ga0075431_100051502 3300006847 Bacteria 4245
68 Ga0075431_100085496 3300006847 Bacteria 3256
69 Ga0075429_100034018 3300006880 Bacteria 4427
70 Ga0075429_100174551 3300006880 Bacteria 1883
71 Ga0097620_100038024 3300006931 Bacteria 4830
72 Ga0099794_10047061 3300007265 Bacteria 2067
73 Ga0105240_10308413 3300009093 Bacteria 1808
74 Ga0105240_10384136 3300009093 Bacteria 1585
75 Ga0111539_10162048 3300009094 Bacteria 2616
76 Ga0105245_10001579 3300009098 Bacteria 20694
77 Ga0105245_10074611 3300009098 Bacteria 3087
78 Ga0105245_10292619 3300009098 Bacteria 1595
79 Ga0105247_10189228 3300009101 Bacteria 1377
80 Ga0114129_10018049 3300009147 Bacteria 10050
81 Ga0105243_10024122 3300009148 Bacteria 4637
82 Ga0105243_10172135 3300009148 Bacteria 1876
83 Ga0105243_10188760 3300009148 Bacteria 1798
84 Ga0105241_10273984 3300009174 Bacteria 1439
85 Ga0105242_10010872 3300009176 Bacteria 6989
86 Ga0105237_10276554 3300009545 Bacteria 1681
87 Ga0105237_10295974 3300009545 Bacteria 1621
88 Ga0105238_10012461 3300009551 Bacteria 8575
89 Ga0105238_10233743 3300009551 Bacteria 1815
90 Ga0105249_10011487 3300009553 Bacteria 7779
91 Ga0105249_10335526 3300009553 Bacteria 1527
92 Ga0123342_1026302 3300009766 Bacteria 3397
93 Ga0105239_10018970 3300010375 Bacteria 7602
94 Ga0105239_10029955 3300010375 Bacteria 5985
95 Ga0105239_10080895 3300010375 Bacteria 3575
96 Ga0105239_10279104 3300010375 Bacteria 1880
97 Ga0105239_10426113 3300010375 Bacteria 1503
98 Ga0105239_10637314 3300010375 Bacteria 1217
99 Ga0157369_10166897 3300013105 Bacteria 2321
100 Ga0157369_10213557 3300013105 Bacteria 2022
101 Ga0157374_10193056 3300013296 Bacteria 1992
102 Ga0163162_10074668 3300013306 Bacteria 3449
103 Ga0163162_10300186 3300013306 Bacteria 1738
104 Ga0157372_10673599 3300013307 Bacteria 1204
105 Ga0157379_10096510 3300014968 Bacteria 2653
106 Ga0163161_10307525 3300017792 Bacteria 1250
107 Ga0214542_1025524 3300021321 Bacteria 3067
108 Ga0214543_1002177 3300021327 Bacteria 38571
109 Ga0209436_101266 3300025208 Bacteria 9072
110 Ga0209148_1000069 3300025254 Bacteria 334444
111 Ga0209129_1000279 3300025258 Bacteria 48588
112 Ga0209233_1000028 3300025261 Bacteria 642062
113 Ga0209455_1000135 3300025272 Bacteria 148007
114 Ga0209130_1000010 3300025284 Bacteria 444920
115 Ga0209130_1000297 3300025284 Bacteria 60549
116 Ga0209676_1011162 3300025292 Bacteria 3652
117 Ga0209025_1000234 3300025294 Bacteria 130341
118 Ga0209025_1004636 3300025294 Bacteria 11761
119 Ga0209025_1025600 3300025294 Bacteria 2996
120 Ga0209564_1000025 3300025295 Bacteria 520535
121 Ga0209256_1000311 3300025299 Bacteria 84751
122 Ga0207426_1000036 3300025302 Bacteria 444920
123 Ga0207426_1000196 3300025302 Bacteria 146687
124 Ga0209051_1029246 3300025303 Bacteria 2159
125 Ga0209257_1000902 3300025304 Bacteria 41639
126 Ga0207653_10002232 3300025885 Bacteria 6174
127 Ga0207688_10063634 3300025901 Bacteria 2081
128 Ga0207647_10028548 3300025904 Bacteria 3621
129 Ga0207645_10053360 3300025907 Bacteria 2583
130 Ga0207645_10279331 3300025907 Bacteria 1109
131 Ga0207643_10005580 3300025908 Bacteria 6722
132 Ga0207643_10024724 3300025908 Bacteria 3314
133 Ga0207654_10049829 3300025911 Bacteria 2404
134 Ga0207695_10229983 3300025913 Bacteria 1759
135 Ga0207695_10326691 3300025913 Bacteria 1423
136 Ga0207671_10452360 3300025914 Bacteria 1023
137 Ga0207662_10199252 3300025918 Bacteria 1295
138 Ga0207657_10052547 3300025919 Bacteria 3536
139 Ga0207649_10398324 3300025920 Bacteria 1030
140 Ga0207681_10075393 3300025923 Bacteria 2366
141 Ga0207681_10273550 3300025923 Bacteria 1327
142 Ga0207694_10164032 3300025924 Bacteria 1796
143 Ga0207694_10190264 3300025924 Bacteria 1667
144 Ga0207687_10009511 3300025927 Bacteria 6357
145 Ga0207687_10058933 3300025927 Bacteria 2703
146 Ga0207690_10136358 3300025932 Bacteria 1802
147 Ga0207690_10441186 3300025932 Bacteria 1045
148 Ga0207706_10027905 3300025933 Bacteria 5046
149 Ga0207686_10019249 3300025934 Bacteria 3879
150 Ga0207709_10061812 3300025935 Bacteria 2342
151 Ga0207689_10237070 3300025942 Bacteria 1508
152 Ga0207712_10009811 3300025961 Bacteria 6067
153 Ga0207712_10146566 3300025961 Bacteria 1818
154 Ga0207668_10108208 3300025972 Bacteria 2080
155 Ga0207658_10477482 3300025986 Bacteria 1107
156 Ga0207639_10077981 3300026041 Bacteria 2613
157 Ga0207639_10123866 3300026041 Bacteria 2128
158 Ga0207678_10457622 3300026067 Bacteria 1110
159 Ga0207708_10040839 3300026075 Bacteria 3538
160 Ga0207708_10100948 3300026075 Bacteria 2233
161 Ga0207708_10147718 3300026075 Bacteria 1848
162 Ga0207702_10125517 3300026078 Bacteria 2303
163 Ga0207674_10023040 3300026116 Bacteria 6678
164 Ga0207674_10041025 3300026116 Bacteria 4789
165 Ga0207675_100014163 3300026118 Bacteria 7437
166 Ga0207675_100770356 3300026118 Bacteria 974
167 Ga0207683_10346762 3300026121 Bacteria 1362
168 Ga0207698_10077556 3300026142 Bacteria 2665
169 Ga0209588_1033624 3300027671 Bacteria 1645
170 Ga0207428_10055811 3300027907 Bacteria 3139
171 Ga0268265_10217153 3300028380 Bacteria 1670
172 Ga0307515_10006226 3300028794 Bacteria 23962
173 Ga0316181_1091826 3300030744 Bacteria 3088
174 Ga0307408_100125942 3300031548 Bacteria 1992
175 Ga0307413_10043998 3300031824 Bacteria 2636
176 Ga0307412_10104489 3300031911 Bacteria 2010
177 Ga0307412_10181606 3300031911 Bacteria 1583
178 Ga0307409_100062368 3300031995 Bacteria 2918
179 Ga0307409_100156784 3300031995 Bacteria 1985
180 Ga0307416_100021606 3300032002 Bacteria 4625
181 Ga0307416_100173136 3300032002 Bacteria 2013
182 Ga0307415_100048049 3300032126 Bacteria 2877
183 Ga0395900_0023239 3300037418 Bacteria 6345
184 Ga0395900_0172037 3300037418 Bacteria 2204
185 Ga0395900_0177388 3300037418 Bacteria 2167
186 Ga0395900_0473779 3300037418 Bacteria 1205
187 Ga0395898_0024103 3300037466 Bacteria 6142
188 Ga0395905_0021854 3300037471 Bacteria 6051
189 Ga0395905_0074402 3300037471 Bacteria 3183
190 Ga0395905_0246280 3300037471 Bacteria 1670
191 Ga0395905_0463363 3300037471 Bacteria 1166
192 Ga0395901_0006132 3300038443 Bacteria 12179
193 Ga0395901_0018243 3300038443 Bacteria 7164
194 Ga0395901_0045404 3300038443 Bacteria 4559
195 Ga0395901_0156063 3300038443 Bacteria 2397
196 Ga0395901_0275843 3300038443 Bacteria 1748
197 Ga0439439_0041546 3300041406 Bacteria 1193
198 Ga0439466_0063196 3300041411 Bacteria 1189
199 Ga0439465_0079587 3300041413 Bacteria 1109
200 Ga0439448_0048304 3300042005 Bacteria 1389
201 Ga0439463_044618 3300042016 Bacteria 1129
202 Ga0450906_016589 3300042145 Bacteria 1332
203 Ga0439440_0016004 3300042993 Bacteria 1636
204 Ga0466960_0131962 3300044901 Bacteria 1319
205 Ga0495638_0062761 3300046460 Bacteria 2292
206 Ga0495638_0164396 3300046460 Bacteria 1278
207 Ga0495606_0011617 3300046507 Bacteria 7158
208 Ga0495668_0000216 3300046616 Bacteria 83845
209 Ga0495625_0000181 3300046660 Bacteria 98246
210 Ga0495625_0068373 3300046660 Bacteria 2497
211 Ga0495625_0184828 3300046660 Bacteria 1384
212 Ga0495626_0000133 3300048091 Bacteria 93962
213 Ga0496102_0065848 3300048905 Bacteria 3321
214 Ga0496102_0322908 3300048905 Bacteria 1454
215 Ga0496104_0096356 3300048907 Bacteria 2830
216 Ga0496104_0208522 3300048907 Bacteria 1866
217 Ga0496104_0312491 3300048907 Bacteria 1484
218 Ga0496105_0118671 3300048908 Bacteria 2182
219 Ga0496108_0007672 3300048911 Bacteria 8736
220 Ga0496108_0025616 3300048911 Bacteria 4862
221 Ga0496108_0150866 3300048911 Bacteria 2005
222 Ga0496109_0059597 3300048912 Bacteria 3487
223 Ga0496109_0071128 3300048912 Bacteria 3193
224 Ga0496110_0075999 3300048913 Bacteria 2985
225 Ga0496110_0093853 3300048913 Bacteria 2686
226 Ga0496111_0015633 3300048914 Bacteria 5215
227 Ga0496111_0198260 3300048914 Bacteria 1492
228 Ga0496112_0001731 3300048915 Bacteria 17084
229 Ga0496112_0065381 3300048915 Bacteria 3589
230 Ga0496112_0320052 3300048915 Bacteria 1495
231 Ga0496113_0061291 3300048916 Bacteria 2838
232 Ga0496113_0154185 3300048916 Bacteria 1813
233 Ga0496113_0350528 3300048916 Bacteria 1184
234 Ga0496114_0423890 3300048917 Bacteria 1179
235 Ga0496115_0195377 3300048918 Bacteria 1672
236 Ga0496115_0237891 3300048918 Bacteria 1501
237 Ga0496115_0376224 3300048918 Bacteria 1156
238 Ga0496117_0139729 3300048920 Bacteria 1453
239 Ga0496118_0055261 3300048921 Bacteria 2998
240 Ga0496119_0026957 3300048922 Bacteria 3967
241 Ga0496120_0002155 3300048923 Bacteria 20986
242 Ga0496126_0076964 3300048929 Bacteria 2959
243 Ga0501032_0040565 3300049569 Bacteria 3164
244 Ga0501032_0244435 3300049569 Bacteria 1166
245 Ga0501038_0276416 3300049574 Bacteria 1323
246 Ga0501040_0042973 3300049576 Bacteria 3080
247 Ga0501040_0241083 3300049576 Bacteria 1289
248 Ga0501041_0276309 3300049577 Bacteria 1057
249 Ga0501042_0032976 3300049578 Bacteria 3670
250 Ga0501047_0039515 3300049581 Bacteria 4563
251 Ga0501047_0409178 3300049581 Bacteria 1189
252 Ga0501048_0065098 3300049582 Bacteria 2578
253 Ga0501072_0275394 3300049588 Bacteria 1339
254 Ga0501075_0066746 3300049591 Bacteria 2715
255 Ga0501076_0107712 3300049592 Bacteria 2251
256 Ga0501076_0244282 3300049592 Bacteria 1469
257 Ga0501077_0001135 3300049593 Bacteria 16070
258 Ga0501077_0111491 3300049593 Bacteria 1734
259 Ga0501079_0262486 3300049741 Bacteria 1350
260 Ga0501080_0291646 3300049742 Bacteria 1481
261 Ga0501044_0245152 3300049823 Bacteria 1735
262 Ga0501045_0192748 3300049824 Bacteria 1519
263 nmdc:mga03n38_9404_c1 3300050490 Bacteria 3556
264 nmdc:mga00v17_48292_c1 3300050491 Bacteria 2579
265 nmdc:mga0yw44_1048_c1 3300050492 Bacteria 10625
266 nmdc:mga0yw44_37710_c1 3300050492 Bacteria 2855
267 nmdc:mga06z11_18901_c2 3300050494 Bacteria 2814
268 nmdc:mga05p37_814042_c1 3300050507 Bacteria 1020
269 nmdc:mga05p37_86679_c1 3300050507 Bacteria 3859
270 nmdc:mga05p37_99891_c1 3300050507 Bacteria 3573
271 nmdc:mga09592_135090_c1 3300050508 Bacteria 2124
272 nmdc:mga09592_166546_c1 3300050508 Bacteria 1905
273 nmdc:mga0qj67_182423_c1 3300050509 Bacteria 1705
274 nmdc:mga0qj67_28720_c1 3300050509 Bacteria 4320
275 nmdc:mga0qj67_404780_c1 3300050509 Bacteria 1101
276 nmdc:mga06r32_311934_c1 3300050510 Bacteria 1558
277 nmdc:mga06r32_53938_c1 3300050510 Bacteria 3853
278 nmdc:mga06r32_57224_c1 3300050510 Bacteria 3745
279 nmdc:mga06r32_61055_c1 3300050510 Bacteria 3627
280 nmdc:mga08y16_758339_c1 3300050511 Bacteria 966
281 nmdc:mga0sz30_48202_c1 3300050516 Bacteria 1802
282 Ga0500578_0006687 3300053086 Bacteria 7672
283 Ga0500578_0262004 3300053086 Bacteria 1038
284 Ga0500641_0002649 3300053096 Bacteria 6321
285 Ga0500658_0009518 3300053134 Bacteria 3581
286 Ga0500658_0037753 3300053134 Bacteria 1922
287 Ga0500568_0087176 3300053139 Bacteria 1180
288 Ga0501084_0059379 3300054114 Bacteria 3201
289 Ga0590071_032087 3300059421 Bacteria 1253
290 Ga0501082_0008539 3300060353 Bacteria 8835
291 Ga0501082_0057910 3300060353 Bacteria 3338
292 Ga0530510_0108907 3300061734 Bacteria 2028
293 Ga0530510_0158489 3300061734 Bacteria 1674
294 Ga0530510_0254682 3300061734 Bacteria 1308
295 2509110949 2508501122 Bacteria 6292184
296 2509376340 2509276019 Bacteria 6802256
297 2510318766 2510065059 Bacteria 6847884
298 2512960878 2512875024 Bacteria 7195110
299 2513996509 2513237159 Bacteria 6810126
300 2516209876 2516143018 Bacteria 6951533
301 2558867835 2558860100 Bacteria 8458965
302 2558909447 2558860112 Bacteria 9931328
303 2585392168 2582581866 Bacteria 6859583
304 2588518911 2588253730 Bacteria 6881675
305 2600196409 2599185352 Bacteria 7228948
306 2644132851 2643221623 Bacteria 5239945
307 2644674891 2643221723 Bacteria 7095460
308 2692315666 2690316117 Bacteria 6800650
309 2694630238 2693429783 Bacteria 7019804
310 2694634318 2693429784 Bacteria 7241525
311 2734967698 2734482000 Bacteria 5525167
312 2753460361 2751185821 Bacteria 6189929
313 2756670944 2756170246 Bacteria 7451806
314 2776270016 2775506902 Bacteria 6208009
315 2776281322 2775506904 Bacteria 5954060
316 2842521434 2842521101 Bacteria 6569494
317 2844008964 2844002411 Bacteria 7168230
318 2844012321 2844009547 Bacteria 6728125
319 2847419274 2847417321 Bacteria 6913799
320 2848994297 2848992105 Bacteria 6810864
321 2850081308 2850079185 Bacteria 6848280
322 2855875932 2855872281 Bacteria 6964271
323 2856322818 2856320880 Bacteria 7263508
324 2856349212 2856342000 Bacteria 7176905
325 2869175181 2869169390 Bacteria 6659796
326 2869241677 2869234852 Bacteria 6654993
327 2869249201 2869242130 Bacteria 6609239
328 2869262923 2869256925 Bacteria 6981691
329 2869285639 2869278585 Bacteria 7077053
330 2871473286 2871466892 Bacteria 6923287
331 2871486421 2871481445 Bacteria 6700002
332 2874112427 2874109183 Bacteria 6517025
333 2874122759 2874116593 Bacteria 6674494
334 2876387065 2876386047 Bacteria 6698674
335 2876422197 2876420981 Bacteria 6687741
336 2878737410 2878730984 Bacteria 6380721
337 2878744794 2878738818 Bacteria 7136951
338 2878796185 2878788777 Bacteria 6567085
339 2884793426 2884791551 Bacteria 8511252
340 2903517272 2903513507 Bacteria 6344008
341 2906380610 2906378014 Bacteria 6911440
342 2906407974 2906401398 Bacteria 6693206
343 2906427807 2906427513 Bacteria 6375796
344 2909047113 2909042592 Bacteria 6499737
345 2920761759 2920760137 Bacteria 7427611
346 2924722098 2924718760 Bacteria 6331356
347 2924745398 2924741084 Bacteria 6661321
348 2924782825 2924776078 Bacteria 7492003
349 2937840290 2937836603 Bacteria 6811263
350 2937883634 2937877337 Bacteria 7246526
351 2937977556 2937972304 Bacteria 7532020
352 2937985325 2937980651 Bacteria 6517427
353 2941502518 2941499720 Bacteria 7599444
354 2958041654 2958034702 Bacteria 6989922
355 2958047964 2958041894 Bacteria 13082850
356 2958070649 2958064165 Bacteria 7158582
357 2958071499 2958071322 Bacteria 6815895
358 2958090802 2958084443 Bacteria 7312792
359 2958093729 2958092219 Bacteria 6861151
360 2958113615 2958108152 Bacteria 6681128
361 2958148019 2958144490 Bacteria 6677056
362 2968020474 2968016561 Bacteria 7022047
363 2968143102 2968138860 Bacteria 6605449
364 2970473771 2970469710 Bacteria 6969209
365 2970490416 2970489779 Bacteria 6517260
366 2970518097 2970510686 Bacteria 7006402
367 2970527106 2970524798 Bacteria 6840927
368 2970534701 2970532167 Bacteria 6553173
369 2970600255 2970593180 Bacteria 7073582
370 2970620155 2970619444 Bacteria 6986144
371 2970633041 2970627176 Bacteria 6680862
372 2977854171 2977851361 Bacteria 6694324
373 2977902987 2977898635 Bacteria 6675551
374 2977907681 2977907340 Bacteria 6577984
375 2977991301 2977986579 Bacteria 6581278
376 2979771335 2979764755 Bacteria 6610066
377 2979776678 2979772303 Bacteria 6618277
378 2996315477 2996310559 Bacteria 6357320
379 2996337929 2996336353 Bacteria 5511628
380 2996352906 2996348954 Bacteria 7239054
381 3004217785 3004211236 Bacteria 7417683
382 3004221167 3004218560 Bacteria 7421728
383 3004234110 3004232784 Bacteria 6662140
384 3004252576 3004248173 Bacteria 6563236
385 3004279588 3004275668 Bacteria 7114440
386 3004294966 3004289098 Bacteria 6135450
387 637075939 637000159 Bacteria 7596297
388 643826161 643692032 Bacteria 6891900
389 8002287865 8002285264 Bacteria 6717907
390 8004316367 8004312739 Bacteria 7444653
391 8004730231 8004727605 Bacteria 6643904
392 8055175549 8055172936 Bacteria 9305943
393 8056057787 8056054917 Bacteria 5736694
394 Ga0307511_10102423
395 JGI24740J21852_10001106
396 JGI25158J39367_1003315
397 JGI25152J39213_1004824
398 JGI25159J45721_1000005
399 JGI25151J46595_10003803
400 JGI25165J46597_1000034
401 JGI25160J50197_1000005
402 JGI25160J50197_1032066
403 JGI25161J50226_1000584
404 Ga0055542_1000997
405 Ga0055536_1000418
406 Ga0055531_10036268
407 Ga0055543_1000091
408 Ga0065165_1000002
409 Ga0070676_10045173
410 Ga0068869_100083826
411 Ga0070680_100022088
412 Ga0070682_100333815
413 Ga0068868_100075232
414 Ga0068868_100199726
415 Ga0070691_10001991
416 Ga0070668_100032646
417 Ga0070659_100113102
418 Ga0070667_100063325
419 Ga0070703_10009303
420 Ga0070701_10058480
421 Ga0070700_100019260
422 Ga0070700_100021552
423 Ga0070694_100138961
424 Ga0070678_100261422
425 Ga0070662_100063731
426 Ga0068867_100116546
427 Ga0070685_10093292
428 Ga0068853_100087956
429 Ga0070695_100016019
430 Ga0070696_100001812
431 Ga0070696_100057054
432 Ga0070704_100118529
433 Ga0070664_100306229
434 Ga0068857_100069593
435 Ga0068857_100107767
436 Ga0068854_100106991
437 Ga0068856_100209166
438 Ga0070702_100041036
439 Ga0068852_100049770
440 Ga0068859_100038025
441 Ga0068861_100108496
442 Ga0068870_10196249
443 Ga0068858_100139790
444 Ga0068862_100297542
445 Ga0068862_100315453
446 Ga0081538_10001651
447 Ga0081538_10016366
448 Ga0081538_10100848
449 Ga0081538_10107844
450 Ga0075365_10001689
451 Ga0075363_100001983
452 Ga0075363_100068964
453 Ga0075363_100139100
454 Ga0075364_10003022
455 Ga0075364_10146743
456 Ga0075367_10003174
457 Ga0075367_10079957
458 Ga0075428_100106486
459 Ga0075430_100029935
460 Ga0075431_100051502
461 Ga0075431_100085496
462 Ga0075429_100034018
463 Ga0075429_100174551
464 Ga0097620_100038024
465 Ga0099794_10047061
466 Ga0105240_10308413
467 Ga0105240_10384136
468 Ga0111539_10162048
469 Ga0105245_10001579
470 Ga0105245_10074611
471 Ga0105245_10292619
472 Ga0105247_10189228
473 Ga0114129_10018049
474 Ga0105243_10024122
475 Ga0105243_10172135
476 Ga0105243_10188760
477 Ga0105241_10273984
478 Ga0105242_10010872
479 Ga0105237_10276554
480 Ga0105237_10295974
481 Ga0105238_10012461
482 Ga0105238_10233743
483 Ga0105249_10011487
484 Ga0105249_10335526
485 Ga0123342_1026302
486 Ga0105239_10018970
487 Ga0105239_10029955
488 Ga0105239_10080895
489 Ga0105239_10279104
490 Ga0105239_10426113
491 Ga0105239_10637314
492 Ga0157369_10166897
493 Ga0157369_10213557
494 Ga0157374_10193056
495 Ga0163162_10074668
496 Ga0163162_10300186
497 Ga0157372_10673599
498 Ga0157379_10096510
499 Ga0163161_10307525
500 Ga0214542_1025524
501 Ga0214543_1002177
502 Ga0209436_101266
503 Ga0209148_1000069
504 Ga0209129_1000279
505 Ga0209233_1000028
506 Ga0209455_1000135
507 Ga0209130_1000010
508 Ga0209130_1000297
509 Ga0209676_1011162
510 Ga0209025_1000234
511 Ga0209025_1004636
512 Ga0209025_1025600
513 Ga0209564_1000025
514 Ga0209256_1000311
515 Ga0207426_1000036
516 Ga0207426_1000196
517 Ga0209051_1029246
518 Ga0209257_1000902
519 Ga0207653_10002232
520 Ga0207688_10063634
521 Ga0207647_10028548
522 Ga0207645_10053360
523 Ga0207645_10279331
524 Ga0207643_10005580
525 Ga0207643_10024724
526 Ga0207654_10049829
527 Ga0207695_10229983
528 Ga0207695_10326691
529 Ga0207671_10452360
530 Ga0207662_10199252
531 Ga0207657_10052547
532 Ga0207649_10398324
533 Ga0207681_10075393
534 Ga0207681_10273550
535 Ga0207694_10164032
536 Ga0207694_10190264
537 Ga0207687_10009511
538 Ga0207687_10058933
539 Ga0207690_10136358
540 Ga0207690_10441186
541 Ga0207706_10027905
542 Ga0207686_10019249
543 Ga0207709_10061812
544 Ga0207689_10237070
545 Ga0207712_10009811
546 Ga0207712_10146566
547 Ga0207668_10108208
548 Ga0207658_10477482
549 Ga0207639_10077981
550 Ga0207639_10123866
551 Ga0207678_10457622
552 Ga0207708_10040839
553 Ga0207708_10100948
554 Ga0207708_10147718
555 Ga0207702_10125517
556 Ga0207674_10023040
557 Ga0207674_10041025
558 Ga0207675_100014163
559 Ga0207675_100770356
560 Ga0207683_10346762
561 Ga0207698_10077556
562 Ga0209588_1033624
563 Ga0207428_10055811
564 Ga0268265_10217153
565 Ga0307515_10006226
566 Ga0316181_1091826
567 Ga0307408_100125942
568 Ga0307413_10043998
569 Ga0307412_10104489
570 Ga0307412_10181606
571 Ga0307409_100062368
572 Ga0307409_100156784
573 Ga0307416_100021606
574 Ga0307416_100173136
575 Ga0307415_100048049
576 Ga0395900_0023239
577 Ga0395900_0172037
578 Ga0395900_0177388
579 Ga0395900_0473779
580 Ga0395898_0024103
581 Ga0395905_0021854
582 Ga0395905_0074402
583 Ga0395905_0246280
584 Ga0395905_0463363
585 Ga0395901_0006132
586 Ga0395901_0018243
587 Ga0395901_0045404
588 Ga0395901_0156063
589 Ga0395901_0275843
590 Ga0439439_0041546
591 Ga0439466_0063196
592 Ga0439465_0079587
593 Ga0439448_0048304
594 Ga0439463_044618
595 Ga0450906_016589
596 Ga0439440_0016004
597 Ga0466960_0131962
598 Ga0495638_0062761
599 Ga0495638_0164396
600 Ga0495606_0011617
601 Ga0495668_0000216
602 Ga0495625_0000181
603 Ga0495625_0068373
604 Ga0495625_0184828
605 Ga0495626_0000133
606 Ga0496102_0065848
607 Ga0496102_0322908
608 Ga0496104_0096356
609 Ga0496104_0208522
610 Ga0496104_0312491
611 Ga0496105_0118671
612 Ga0496108_0007672
613 Ga0496108_0025616
614 Ga0496108_0150866
615 Ga0496109_0059597
616 Ga0496109_0071128
617 Ga0496110_0075999
618 Ga0496110_0093853
619 Ga0496111_0015633
620 Ga0496111_0198260
621 Ga0496112_0001731
622 Ga0496112_0065381
623 Ga0496112_0320052
624 Ga0496113_0061291
625 Ga0496113_0154185
626 Ga0496113_0350528
627 Ga0496114_0423890
628 Ga0496115_0195377
629 Ga0496115_0237891
630 Ga0496115_0376224
631 Ga0496117_0139729
632 Ga0496118_0055261
633 Ga0496119_0026957
634 Ga0496120_0002155
635 Ga0496126_0076964
636 Ga0501032_0040565
637 Ga0501032_0244435
638 Ga0501038_0276416
639 Ga0501040_0042973
640 Ga0501040_0241083
641 Ga0501041_0276309
642 Ga0501042_0032976
643 Ga0501047_0039515
644 Ga0501047_0409178
645 Ga0501048_0065098
646 Ga0501072_0275394
647 Ga0501075_0066746
648 Ga0501076_0107712
649 Ga0501076_0244282
650 Ga0501077_0001135
651 Ga0501077_0111491
652 Ga0501079_0262486
653 Ga0501080_0291646
654 Ga0501044_0245152
655 Ga0501045_0192748
656 nmdc:mga03n38_9404_c1
657 nmdc:mga00v17_48292_c1
658 nmdc:mga0yw44_1048_c1
659 nmdc:mga0yw44_37710_c1
660 nmdc:mga06z11_18901_c2
661 nmdc:mga05p37_814042_c1
662 nmdc:mga05p37_86679_c1
663 nmdc:mga05p37_99891_c1
664 nmdc:mga09592_135090_c1
665 nmdc:mga09592_166546_c1
666 nmdc:mga0qj67_182423_c1
667 nmdc:mga0qj67_28720_c1
668 nmdc:mga0qj67_404780_c1
669 nmdc:mga06r32_311934_c1
670 nmdc:mga06r32_53938_c1
671 nmdc:mga06r32_57224_c1
672 nmdc:mga06r32_61055_c1
673 nmdc:mga08y16_758339_c1
674 nmdc:mga0sz30_48202_c1
675 Ga0500578_0006687
676 Ga0500578_0262004
677 Ga0500641_0002649
678 Ga0500658_0009518
679 Ga0500658_0037753
680 Ga0500568_0087176
681 Ga0501084_0059379
682 Ga0590071_032087
683 Ga0501082_0008539
684 Ga0501082_0057910
685 Ga0530510_0108907
686 Ga0530510_0158489
687 Ga0530510_0254682
688 2509110949
689 2509376340
690 2510318766
691 2512960878
692 2513996509
693 2516209876
694 2558867835
695 2558909447
696 2585392168
697 2588518911
698 2600196409
699 2644132851
700 2644674891
701 2692315666
702 2694630238
703 2694634318
704 2734967698
705 2753460361
706 2756670944
707 2776270016
708 2776281322
709 2842521434
710 2844008964
711 2844012321
712 2847419274
713 2848994297
714 2850081308
715 2855875932
716 2856322818
717 2856349212
718 2869175181
719 2869241677
720 2869249201
721 2869262923
722 2869285639
723 2871473286
724 2871486421
725 2874112427
726 2874122759
727 2876387065
728 2876422197
729 2878737410
730 2878744794
731 2878796185
732 2884793426
733 2903517272
734 2906380610
735 2906407974
736 2906427807
737 2909047113
738 2920761759
739 2924722098
740 2924745398
741 2924782825
742 2937840290
743 2937883634
744 2937977556
745 2937985325
746 2941502518
747 2958041654
748 2958047964
749 2958070649
750 2958071499
751 2958090802
752 2958093729
753 2958113615
754 2958148019
755 2968020474
756 2968143102
757 2970473771
758 2970490416
759 2970518097
760 2970527106
761 2970534701
762 2970600255
763 2970620155
764 2970633041
765 2977854171
766 2977902987
767 2977907681
768 2977991301
769 2979771335
770 2979776678
771 2996315477
772 2996337929
773 2996352906
774 3004217785
775 3004221167
776 3004234110
777 3004252576
778 3004279588
779 3004294966
780 637075939
781 643826161
782 8002287865
783 8004316367
784 8004730231
785 8055175549
786 8056057787

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

6

202

0.85

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

12

230

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bsx-assembly3.cif.gz_C sdr protein napw-nadp 0.9909 2 299
7btm-assembly2.cif.gz_B sdr protein/resistance protein napw 0.9896 2 299
7btm-assembly2.cif.gz_C sdr protein/resistance protein napw 0.9886 2 299
7btm-assembly4.cif.gz_F sdr protein/resistance protein napw 0.9866 2 299
7btm-assembly4.cif.gz_G-2 sdr protein/resistance protein napw 0.9865 2 299
ID Description Score Start End Superfamily
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9049 5 259 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.885 2 198 3.40.50.720
3rkrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8832 2 259 3.40.50.720
af_Q6GQN9_2_259_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8777 1 267 3.40.50.720
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8773 5 259 3.40.50.720
ID Description Score Start End GO Terms
AF-F2A3Y7-F1-model_v4 deleted 0.9971 140 299
AF-A0A7K3DPU7-F1-model_v4 SDR family oxidoreductase 0.9949 110 299
AF-S3HJW4-F1-model_v4 Short chain dehydrogenase 0.9909 2 299
AF-F2A3Y7-F1-model_v4 deleted 0.9909 140 299
AF-A0A0K9Z1C7-F1-model_v4 Short-chain dehydrogenase 0.9904 2 299

Map