F432547

General Info

Members Datasets Scaffolds Average Seq Length
393 187 786 236

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_100288244|Ga0068861_1002882442
Length 273
Sequence VFGTGENVNDPFFVLGSWFFVNMTRPVIGVTRCSKIDDYVTSVEKSGAVARVLEVSESPRSLVAELDGLVLTGGGDVDPIFYGEARHPDVYDAEPGRDEFEIDLARRAMDADLPVLAICRGTQVLNVAAGGSLVQDIPSSITTELSHRIDVPKDCVAHDVSVARGSRLHDALGGAVDAACTCRVNSRHHQSVGRLGGRLVATATAPDGVIEGIESPEARFCVGVQWHPENFWQTGEFRPLFDAFVGAARARLAARGSGEDGASGEDSSNDQRQ

Samples

Sample ID Description Type Environment
1 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
104 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
113 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
121 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
124 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
125 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
170 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
184 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
185 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.78
Nodule 0
Rhizoplane 4.07
Rhizosphere 93.64
Stem 0
Stem Tuber 0
Unclassified 13.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068861_100288244 3300005719 Bacteria 1417
2 MRS1b_contig_5790511 2162886011 Bacteria 2140
3 MRS1b_contig_8543927 2162886011 Unclassified 1182
4 Ga0065714_10072324 3300005288 Bacteria 3389
5 Ga0065712_10000203 3300005290 Bacteria 47592
6 Ga0065712_10076572 3300005290 Bacteria 3637
7 Ga0065712_10136443 3300005290 Unclassified 1493
8 Ga0065712_10146363 3300005290 Unclassified 1392
9 Ga0065715_10000324 3300005293 Bacteria 26670
10 Ga0065715_10014250 3300005293 Bacteria 2304
11 Ga0065715_10093214 3300005293 Bacteria 4765
12 Ga0065707_10002337 3300005295 Bacteria 9007
13 Ga0070676_10117903 3300005328 Bacteria 1662
14 Ga0070683_100000009 3300005329 Bacteria 319830
15 Ga0070690_100078114 3300005330 Bacteria 2162
16 Ga0070670_100026931 3300005331 Bacteria 4945
17 Ga0070670_100037758 3300005331 Bacteria 4154
18 Ga0070670_100128760 3300005331 Bacteria 2185
19 Ga0068869_100217104 3300005334 Bacteria 1514
20 Ga0068869_100605524 3300005334 Bacteria 926
21 Ga0068868_100000010 3300005338 Bacteria 117927
22 Ga0070689_100526931 3300005340 Bacteria 1015
23 Ga0070669_100054810 3300005353 Bacteria 2921
24 Ga0070669_100202664 3300005353 Bacteria 1562
25 Ga0070669_100234397 3300005353 Bacteria 1456
26 Ga0070675_100580350 3300005354 Bacteria 1016
27 Ga0070671_100114483 3300005355 Bacteria 2267
28 Ga0070674_100130587 3300005356 Unclassified 1872
29 Ga0070674_100254728 3300005356 Bacteria 1380
30 Ga0070674_100419512 3300005356 Bacteria 1097
31 Ga0070674_100482311 3300005356 Unclassified 1029
32 Ga0070673_100005471 3300005364 Bacteria 8130
33 Ga0070673_100027007 3300005364 Bacteria 4250
34 Ga0070673_100479727 3300005364 Bacteria 1122
35 Ga0070688_100022725 3300005365 Bacteria 3680
36 Ga0070688_100278906 3300005365 Bacteria 1200
37 Ga0070659_100079759 3300005366 Bacteria 2613
38 Ga0070667_100028127 3300005367 Bacteria 4679
39 Ga0070703_10031465 3300005406 Bacteria 1605
40 Ga0070701_10016588 3300005438 Bacteria 3428
41 Ga0070705_100280194 3300005440 Bacteria 1185
42 Ga0070700_100037608 3300005441 Bacteria 2945
43 Ga0070694_100037336 3300005444 Bacteria 3222
44 Ga0070694_100076440 3300005444 Unclassified 2318
45 Ga0070708_100003635 3300005445 Bacteria 12093
46 Ga0070708_100086293 3300005445 Bacteria 2850
47 Ga0070663_100082908 3300005455 Bacteria 2360
48 Ga0070678_100408537 3300005456 Bacteria 1181
49 Ga0070678_100448002 3300005456 Bacteria 1130
50 Ga0068867_100079436 3300005459 Bacteria 2469
51 Ga0070685_10055578 3300005466 Bacteria 2300
52 Ga0070685_10235470 3300005466 Unclassified 1206
53 Ga0070706_100005113 3300005467 Bacteria 12518
54 Ga0070706_100025905 3300005467 Bacteria 5397
55 Ga0070706_100829668 3300005467 Bacteria 855
56 Ga0070707_100002373 3300005468 Bacteria 17972
57 Ga0070707_100104029 3300005468 Unclassified 2752
58 Ga0070707_100396585 3300005468 Bacteria 1340
59 Ga0070698_100000739 3300005471 Bacteria 35167
60 Ga0070698_100179785 3300005471 Bacteria 2054
61 Ga0070684_100001256 3300005535 Bacteria 18193
62 Ga0070684_100141077 3300005535 Unclassified 2179
63 Ga0070697_100000424 3300005536 Bacteria 32431
64 Ga0068853_100463202 3300005539 Bacteria 1193
65 Ga0070672_100116460 3300005543 Bacteria 2183
66 Ga0070665_100024117 3300005548 Bacteria 6126
67 Ga0070665_100610109 3300005548 Bacteria 1104
68 Ga0070704_100001713 3300005549 Bacteria 11957
69 Ga0070704_100109186 3300005549 Bacteria 2102
70 Ga0070664_100001512 3300005564 Bacteria 18540
71 Ga0070664_100058229 3300005564 Bacteria 3286
72 Ga0070664_100108516 3300005564 Bacteria 2421
73 Ga0068857_100243457 3300005577 Bacteria 1647
74 Ga0068857_100249752 3300005577 Bacteria 1626
75 Ga0068854_100435229 3300005578 Bacteria 1092
76 Ga0068859_100035832 3300005617 Bacteria 4979
77 Ga0068859_100186706 3300005617 Bacteria 2157
78 Ga0068864_100473417 3300005618 Unclassified 1201
79 Ga0068861_100211145 3300005719 Bacteria 1635
80 Ga0068861_100458586 3300005719 Bacteria 1144
81 Ga0068870_10241656 3300005840 Bacteria 1115
82 Ga0068863_100531330 3300005841 Bacteria 1160
83 Ga0068862_100143148 3300005844 Bacteria 2123
84 Ga0068862_100154600 3300005844 Bacteria 2044
85 Ga0075363_100012584 3300006048 Bacteria 4082
86 Ga0075367_10036499 3300006178 Unclassified 2850
87 Ga0075366_10014247 3300006195 Bacteria 4540
88 Ga0097621_100136656 3300006237 Bacteria 2091
89 Ga0068871_100051330 3300006358 Bacteria 3339
90 Ga0075428_100000750 3300006844 Bacteria 33763
91 Ga0075428_100000794 3300006844 Bacteria 32944
92 Ga0075428_100005605 3300006844 Bacteria 13946
93 Ga0075428_100013812 3300006844 Bacteria 8992
94 Ga0075428_100546116 3300006844 Bacteria 1239
95 Ga0075430_100001197 3300006846 Bacteria 20806
96 Ga0075430_100008017 3300006846 Bacteria 8931
97 Ga0075430_100019307 3300006846 Bacteria 5794
98 Ga0075430_100095353 3300006846 Bacteria 2487
99 Ga0075430_100228575 3300006846 Bacteria 1543
100 Ga0075431_100001704 3300006847 Bacteria 20659
101 Ga0075431_100001839 3300006847 Bacteria 20075
102 Ga0075431_100013298 3300006847 Bacteria 8318
103 Ga0075431_100023580 3300006847 Bacteria 6298
104 Ga0075431_100037200 3300006847 Bacteria 5016
105 Ga0075431_100088558 3300006847 Bacteria 3195
106 Ga0075431_100196482 3300006847 Bacteria 2065
107 Ga0075431_100213796 3300006847 Unclassified 1969
108 Ga0075431_100439520 3300006847 Bacteria 1301
109 Ga0075433_10004947 3300006852 Bacteria 10436
110 Ga0075433_10037555 3300006852 Bacteria 4179
111 Ga0075433_10084759 3300006852 Bacteria 2797
112 Ga0075433_10160407 3300006852 Bacteria 2001
113 Ga0075433_10311939 3300006852 Bacteria 1392
114 Ga0075433_10852855 3300006852 Bacteria 795
115 Ga0075434_100054009 3300006871 Bacteria 3991
116 Ga0075434_100176148 3300006871 Bacteria 2159
117 Ga0075434_100585884 3300006871 Bacteria 1135
118 Ga0075434_101044033 3300006871 Bacteria 831
119 Ga0075429_100004818 3300006880 Bacteria 11620
120 Ga0075429_100021343 3300006880 Bacteria 5614
121 Ga0075429_100059455 3300006880 Bacteria 3329
122 Ga0075429_100275517 3300006880 Bacteria 1473
123 Ga0075429_100373114 3300006880 Bacteria 1249
124 Ga0075436_100117653 3300006914 Bacteria 1858
125 Ga0097620_100035828 3300006931 Bacteria 4979
126 Ga0097620_100186721 3300006931 Bacteria 2157
127 Ga0075435_100168487 3300007076 Bacteria 1847
128 Ga0111539_10000043 3300009094 Bacteria 128570
129 Ga0111539_10018139 3300009094 Bacteria 8717
130 Ga0111539_10045317 3300009094 Bacteria 5265
131 Ga0111539_10052342 3300009094 Bacteria 4860
132 Ga0111539_10138138 3300009094 Bacteria 2854
133 Ga0111539_10746937 3300009094 Bacteria 1139
134 Ga0111539_11047517 3300009094 Bacteria 948
135 Ga0114129_10001842 3300009147 Bacteria 28876
136 Ga0114129_10002858 3300009147 Bacteria 24162
137 Ga0114129_10004156 3300009147 Bacteria 20460
138 Ga0114129_10007131 3300009147 Bacteria 15909
139 Ga0114129_10009286 3300009147 Bacteria 14023
140 Ga0114129_10019123 3300009147 Bacteria 9756
141 Ga0114129_10028044 3300009147 Bacteria 7976
142 Ga0114129_10036924 3300009147 Bacteria 6898
143 Ga0114129_10039574 3300009147 Bacteria 6647
144 Ga0114129_10230090 3300009147 Bacteria 2497
145 Ga0114129_10258475 3300009147 Bacteria 2335
146 Ga0114129_10421421 3300009147 Bacteria 1755
147 Ga0114129_10564237 3300009147 Bacteria 1479
148 Ga0114129_10799488 3300009147 Bacteria 1203
149 Ga0105248_10074572 3300009177 Bacteria 3813
150 Ga0105248_10143325 3300009177 Bacteria 2696
151 Ga0105249_10092244 3300009553 Bacteria 2835
152 Ga0105249_10667694 3300009553 Bacteria 1098
153 Ga0105239_10764212 3300010375 Bacteria 1106
154 Ga0157374_10217732 3300013296 Bacteria 1873
155 Ga0157378_11147576 3300013297 Unclassified 815
156 Ga0163162_10108523 3300013306 Bacteria 2872
157 Ga0157375_10116141 3300013308 Bacteria 2780
158 Ga0157375_10278529 3300013308 Bacteria 1835
159 Ga0157375_11472604 3300013308 Bacteria 803
160 Ga0163163_10090307 3300014325 Bacteria 3076
161 Ga0163163_10110018 3300014325 Bacteria 2783
162 Ga0157380_10388965 3300014326 Bacteria 1319
163 Ga0157380_10761196 3300014326 Bacteria 981
164 Ga0157376_10324883 3300014969 Bacteria 1464
165 Ga0157376_11101765 3300014969 Bacteria 820
166 Ga0207697_10000776 3300025315 Bacteria 18081
167 Ga0207697_10025182 3300025315 Bacteria 2433
168 Ga0207688_10014199 3300025901 Unclassified 4334
169 Ga0207645_10077422 3300025907 Bacteria 2131
170 Ga0207645_10255228 3300025907 Bacteria 1161
171 Ga0207684_10002446 3300025910 Bacteria 18731
172 Ga0207684_10006887 3300025910 Bacteria 10284
173 Ga0207646_10006324 3300025922 Bacteria 12271
174 Ga0207681_10271690 3300025923 Bacteria 1331
175 Ga0207650_10008256 3300025925 Bacteria 7108
176 Ga0207650_10054221 3300025925 Bacteria 2973
177 Ga0207650_10137879 3300025925 Bacteria 1915
178 Ga0207706_10045083 3300025933 Bacteria 3908
179 Ga0207706_10073808 3300025933 Unclassified 3000
180 Ga0207669_10156630 3300025937 Bacteria 1603
181 Ga0207691_10069625 3300025940 Bacteria 3178
182 Ga0207711_10148742 3300025941 Bacteria 2112
183 Ga0207661_10006957 3300025944 Bacteria 8021
184 Ga0207679_10002090 3300025945 Bacteria 12396
185 Ga0207679_10028993 3300025945 Bacteria 3849
186 Ga0207651_10020714 3300025960 Bacteria 3977
187 Ga0207658_10223256 3300025986 Bacteria 1586
188 Ga0207677_10000256 3300026023 Bacteria 40824
189 Ga0207703_10435007 3300026035 Unclassified 1223
190 Ga0207678_10107281 3300026067 Bacteria 2382
191 Ga0207708_10096627 3300026075 Bacteria 2283
192 Ga0207641_10527041 3300026088 Bacteria 1150
193 Ga0207648_10107051 3300026089 Bacteria 2454
194 Ga0207648_10670241 3300026089 Unclassified 960
195 Ga0207674_10084642 3300026116 Bacteria 3169
196 Ga0207674_10141452 3300026116 Bacteria 2365
197 Ga0207675_100066720 3300026118 Bacteria 3363
198 Ga0207675_100094421 3300026118 Bacteria 2814
199 Ga0207675_100377987 3300026118 Bacteria 1392
200 Ga0207675_100401489 3300026118 Bacteria 1351
201 Ga0207683_10077035 3300026121 Bacteria 2953
202 Ga0207428_10000163 3300027907 Bacteria 92085
203 Ga0207428_10102498 3300027907 Bacteria 2210
204 Ga0268266_10250825 3300028379 Unclassified 1637
205 Ga0268265_10084586 3300028380 Bacteria 2515
206 Ga0268265_10300179 3300028380 Unclassified 1446
207 Ga0268265_11029302 3300028380 Bacteria 815
208 Ga0307408_100015393 3300031548 Bacteria 5091
209 Ga0307408_100023451 3300031548 Bacteria 4202
210 Ga0316579_10145215 3300031691 Bacteria 1144
211 Ga0316576_10036292 3300031727 Bacteria 3524
212 Ga0307405_10089365 3300031731 Bacteria 2035
213 Ga0307405_10098361 3300031731 Bacteria 1956
214 Ga0307413_10150203 3300031824 Unclassified 1622
215 Ga0307413_10151358 3300031824 Bacteria 1617
216 Ga0307410_10255949 3300031852 Bacteria 1363
217 Ga0307412_10108725 3300031911 Unclassified 1976
218 Ga0307409_100117409 3300031995 Bacteria 2245
219 Ga0307409_100963891 3300031995 Unclassified 869
220 Ga0307416_100006461 3300032002 Bacteria 7341
221 Ga0307416_100080207 3300032002 Unclassified 2753
222 Ga0307416_100166843 3300032002 Bacteria 2043
223 Ga0307411_10059770 3300032005 Bacteria 2528
224 Ga0307411_10266253 3300032005 Bacteria 1356
225 Ga0307411_10343759 3300032005 Bacteria 1213
226 Ga0373934_0000420 3300035086 Bacteria 14843
227 Ga0373953_0007471 3300035117 Bacteria 3662
228 Ga0373956_0002115 3300035119 Bacteria 8230
229 Ga0373955_0009637 3300035172 Bacteria 4534
230 Ga0373933_0002184 3300035724 Bacteria 11197
231 Ga0373937_0000136 3300036401 Bacteria 71049
232 Ga0316584_0246985 3300036712 Bacteria 1305
233 Ga0395901_0895148 3300038443 Bacteria 870
234 Ga0400489_88603 3300039093 Bacteria 8195
235 Ga0439461_0083486 3300041410 Bacteria 757
236 Ga0451853_2167201 3300041512 Bacteria 2442
237 Ga0439435_0000624 3300042436 Bacteria 5793
238 Ga0439435_0018427 3300042436 Bacteria 1776
239 Ga0439460_0024718 3300042461 Unclassified 1667
240 Ga0439440_0074740 3300042993 Bacteria 888
241 Ga0451576_0924728 3300045051 Bacteria 915
242 Ga0495638_0007891 3300046460 Bacteria 7596
243 Ga0495653_0082826 3300046463 Bacteria 2367
244 Ga0495587_0045120 3300046536 Unclassified 2621
245 Ga0495647_0123636 3300046681 Bacteria 1091
246 Ga0495672_0019977 3300047320 Bacteria 4402
247 Ga0496100_0290436 3300048903 Bacteria 1222
248 Ga0496101_0107176 3300048904 Bacteria 2099
249 Ga0496104_0036980 3300048907 Bacteria 4565
250 Ga0496104_0304885 3300048907 Bacteria 1505
251 Ga0496106_0041389 3300048909 Bacteria 3453
252 Ga0496107_0343765 3300048910 Bacteria 1110
253 Ga0496108_0002599 3300048911 Bacteria 14462
254 Ga0496109_0005585 3300048912 Bacteria 10525
255 Ga0496109_0074509 3300048912 Bacteria 3120
256 Ga0496109_0507182 3300048912 Unclassified 1139
257 Ga0496110_0008889 3300048913 Bacteria 8098
258 Ga0496110_0043661 3300048913 Bacteria 3915
259 Ga0496110_0098048 3300048913 Bacteria 2626
260 Ga0496111_0351361 3300048914 Unclassified 1091
261 Ga0496112_0003047 3300048915 Bacteria 13714
262 Ga0496112_0050036 3300048915 Bacteria 4096
263 Ga0501291_016723 3300049514 Bacteria 1123
264 Ga0501031_0248932 3300049568 Bacteria 1155
265 Ga0501034_0001017 3300049571 Bacteria 40194
266 Ga0501036_0012814 3300049572 Bacteria 6957
267 Ga0501036_0031479 3300049572 Bacteria 4483
268 Ga0501036_0110662 3300049572 Bacteria 2321
269 Ga0501038_0236122 3300049574 Unclassified 1453
270 Ga0501038_0361417 3300049574 Unclassified 1129
271 Ga0501038_0445554 3300049574 Bacteria 996
272 Ga0501038_0568719 3300049574 Unclassified 860
273 Ga0501039_0027647 3300049575 Bacteria 4362
274 Ga0501039_0053747 3300049575 Bacteria 3117
275 Ga0501039_0070162 3300049575 Unclassified 2722
276 Ga0501039_0313713 3300049575 Bacteria 1233
277 Ga0501040_0047212 3300049576 Bacteria 2941
278 Ga0501040_0047310 3300049576 Bacteria 2938
279 Ga0501040_0117118 3300049576 Bacteria 1867
280 Ga0501041_0080873 3300049577 Bacteria 2000
281 Ga0501042_0025626 3300049578 Bacteria 4144
282 Ga0501042_0062538 3300049578 Bacteria 2660
283 Ga0501042_0137430 3300049578 Unclassified 1762
284 Ga0501046_0407866 3300049580 Bacteria 981
285 Ga0501047_0155291 3300049581 Bacteria 2162
286 Ga0501048_0104930 3300049582 Unclassified 1994
287 Ga0501048_0125201 3300049582 Bacteria 1817
288 Ga0501048_0440635 3300049582 Unclassified 932
289 Ga0501068_0001478 3300049584 Bacteria 12507
290 Ga0501070_0003678 3300049586 Bacteria 13256
291 Ga0501071_0059210 3300049587 Bacteria 2771
292 Ga0501071_0069539 3300049587 Bacteria 2564
293 Ga0501071_0073245 3300049587 Bacteria 2498
294 Ga0501071_0096285 3300049587 Unclassified 2178
295 Ga0501071_0251824 3300049587 Unclassified 1333
296 Ga0501071_0390189 3300049587 Bacteria 1062
297 Ga0501071_0540931 3300049587 Unclassified 894
298 Ga0501072_0026677 3300049588 Bacteria 4505
299 Ga0501072_0092835 3300049588 Bacteria 2397
300 Ga0501072_0125881 3300049588 Unclassified 2042
301 Ga0501072_0169757 3300049588 Bacteria 1741
302 Ga0501073_0001444 3300049589 Bacteria 17571
303 Ga0501073_0115003 3300049589 Unclassified 1865
304 Ga0501074_0029052 3300049590 Bacteria 4005
305 Ga0501074_0086038 3300049590 Bacteria 2252
306 Ga0501074_0269384 3300049590 Unclassified 1211
307 Ga0501074_0331456 3300049590 Bacteria 1080
308 Ga0501075_0057051 3300049591 Bacteria 2940
309 Ga0501075_0058565 3300049591 Unclassified 2902
310 Ga0501075_0081522 3300049591 Bacteria 2449
311 Ga0501076_0009440 3300049592 Bacteria 7206
312 Ga0501076_0022194 3300049592 Bacteria 4877
313 Ga0501076_0053111 3300049592 Bacteria 3211
314 Ga0501076_0059187 3300049592 Unclassified 3047
315 Ga0501076_0092554 3300049592 Unclassified 2432
316 Ga0501076_0298647 3300049592 Bacteria 1320
317 Ga0501076_0563492 3300049592 Bacteria 939
318 Ga0501077_0418053 3300049593 Bacteria 858
319 Ga0501079_0079221 3300049741 Bacteria 2541
320 Ga0501079_0097999 3300049741 Bacteria 2273
321 Ga0501079_0286094 3300049741 Bacteria 1289
322 Ga0501079_0330214 3300049741 Unclassified 1194
323 Ga0501080_0002002 3300049742 Bacteria 17586
324 Ga0501080_0047558 3300049742 Unclassified 3994
325 Ga0501080_0459330 3300049742 Bacteria 1141
326 Ga0501080_0671694 3300049742 Bacteria 915
327 Ga0501081_0015505 3300049743 Bacteria 5030
328 Ga0501081_0534127 3300049743 Bacteria 875
329 Ga0501081_0599833 3300049743 Bacteria 824
330 Ga0501083_0510196 3300049744 Bacteria 783
331 Ga0501035_0378518 3300049822 Bacteria 1181
332 Ga0501045_0005439 3300049824 Bacteria 8817
333 Ga0501045_0027644 3300049824 Bacteria 4090
334 Ga0501045_0038676 3300049824 Bacteria 3471
335 Ga0501045_0349873 3300049824 Bacteria 1100
336 Ga0501045_0865528 3300049824 Bacteria 664
337 Ga0501204_007472 3300049850 Bacteria 1231
338 nmdc:mga03n38_36997_c1 3300050490 Bacteria 2102
339 nmdc:mga0k408_117163_c1 3300050493 Bacteria 1576
340 nmdc:mga0k408_12765_c1 3300050493 Bacteria 4595
341 nmdc:mga06z11_84084_c1 3300050494 Bacteria 1714
342 nmdc:mga05p37_1052_c2 3300050507 Bacteria 14256
343 nmdc:mga05p37_11667_c1 3300050507 Bacteria 10472
344 nmdc:mga05p37_170034_c1 3300050507 Bacteria 2658
345 nmdc:mga05p37_20475_c1 3300050507 Bacteria 8002
346 nmdc:mga05p37_208369_c1 3300050507 Bacteria 2364
347 nmdc:mga05p37_221233_c1 3300050507 Bacteria 2285
348 nmdc:mga05p37_355292_c1 3300050507 Unclassified 1724
349 nmdc:mga05p37_4552_c1 3300050507 Bacteria 16207
350 nmdc:mga05p37_517840_c1 3300050507 Bacteria 1365
351 nmdc:mga05p37_7652_c1 3300050507 Bacteria 12747
352 nmdc:mga05p37_7947_c1 3300050507 Bacteria 12519
353 nmdc:mga05p37_844020_c1 3300050507 Bacteria 996
354 nmdc:mga09592_14020_c1 3300050508 Bacteria 6544
355 nmdc:mga09592_33845_c1 3300050508 Bacteria 4269
356 nmdc:mga09592_403910_c1 3300050508 Bacteria 1181
357 nmdc:mga0qj67_181626_c1 3300050509 Unclassified 1709
358 nmdc:mga0qj67_80640_c1 3300050509 Bacteria 2608
359 nmdc:mga06r32_131912_c1 3300050510 Unclassified 2471
360 nmdc:mga06r32_195854_c1 3300050510 Unclassified 2008
361 nmdc:mga06r32_1994_c1 3300050510 Bacteria 18241
362 nmdc:mga06r32_272468_c1 3300050510 Unclassified 1680
363 nmdc:mga06r32_35567_c1 3300050510 Bacteria 4699
364 nmdc:mga06r32_65354_c1 3300050510 Bacteria 3508
365 nmdc:mga06r32_713505_c1 3300050510 Bacteria 968
366 nmdc:mga06r32_743139_c1 3300050510 Unclassified 945
367 nmdc:mga08y16_121606_c1 3300050511 Bacteria 2717
368 nmdc:mga08y16_25_c1 3300050511 Bacteria 235789
369 nmdc:mga08y16_614971_c1 3300050511 Bacteria 1094
370 nmdc:mga08y16_748211_c1 3300050511 Bacteria 974
371 nmdc:mga0n895_152748_c1 3300050512 Bacteria 2339
372 nmdc:mga0n895_50772_c1 3300050512 Bacteria 4067
373 nmdc:mga0n895_524303_c1 3300050512 Bacteria 1192
374 nmdc:mga0rr50_261836_c1 3300050513 Bacteria 1439
375 nmdc:mga0rr50_445557_c1 3300050513 Bacteria 1097
376 nmdc:mga08x19_64955_c1 3300050514 Bacteria 2369
377 nmdc:mga0a205_174120_c1 3300050515 Bacteria 2048
378 nmdc:mga0a205_26993_c1 3300050515 Bacteria 3472
379 nmdc:mga0a205_298789_c1 3300050515 Unclassified 1483
380 nmdc:mga0a205_31444_c1 3300050515 Bacteria 5085
381 Ga0501084_0031796 3300054114 Bacteria 4413
382 Ga0501084_0032985 3300054114 Bacteria 4332
383 Ga0501084_0468551 3300054114 Bacteria 1065
384 Ga0590071_034491 3300059421 Bacteria 1211
385 Ga0590075_000815 3300059424 Bacteria 8188
386 Ga0590077_000760 3300059426 Bacteria 8438
387 Ga0501082_0055657 3300060353 Bacteria 3407
388 Ga0501082_0159495 3300060353 Bacteria 1960
389 Ga0501082_0267039 3300060353 Unclassified 1489
390 Ga0501082_0287782 3300060353 Unclassified 1430
391 Ga0501082_0515543 3300060353 Bacteria 1045
392 Ga0530510_0084177 3300061734 Bacteria 2316
393 Ga0530510_0427115 3300061734 Bacteria 1001
394 Ga0068861_100288244
395 MRS1b_contig_5790511
396 MRS1b_contig_8543927
397 Ga0065714_10072324
398 Ga0065712_10000203
399 Ga0065712_10076572
400 Ga0065712_10136443
401 Ga0065712_10146363
402 Ga0065715_10000324
403 Ga0065715_10014250
404 Ga0065715_10093214
405 Ga0065707_10002337
406 Ga0070676_10117903
407 Ga0070683_100000009
408 Ga0070690_100078114
409 Ga0070670_100026931
410 Ga0070670_100037758
411 Ga0070670_100128760
412 Ga0068869_100217104
413 Ga0068869_100605524
414 Ga0068868_100000010
415 Ga0070689_100526931
416 Ga0070669_100054810
417 Ga0070669_100202664
418 Ga0070669_100234397
419 Ga0070675_100580350
420 Ga0070671_100114483
421 Ga0070674_100130587
422 Ga0070674_100254728
423 Ga0070674_100419512
424 Ga0070674_100482311
425 Ga0070673_100005471
426 Ga0070673_100027007
427 Ga0070673_100479727
428 Ga0070688_100022725
429 Ga0070688_100278906
430 Ga0070659_100079759
431 Ga0070667_100028127
432 Ga0070703_10031465
433 Ga0070701_10016588
434 Ga0070705_100280194
435 Ga0070700_100037608
436 Ga0070694_100037336
437 Ga0070694_100076440
438 Ga0070708_100003635
439 Ga0070708_100086293
440 Ga0070663_100082908
441 Ga0070678_100408537
442 Ga0070678_100448002
443 Ga0068867_100079436
444 Ga0070685_10055578
445 Ga0070685_10235470
446 Ga0070706_100005113
447 Ga0070706_100025905
448 Ga0070706_100829668
449 Ga0070707_100002373
450 Ga0070707_100104029
451 Ga0070707_100396585
452 Ga0070698_100000739
453 Ga0070698_100179785
454 Ga0070684_100001256
455 Ga0070684_100141077
456 Ga0070697_100000424
457 Ga0068853_100463202
458 Ga0070672_100116460
459 Ga0070665_100024117
460 Ga0070665_100610109
461 Ga0070704_100001713
462 Ga0070704_100109186
463 Ga0070664_100001512
464 Ga0070664_100058229
465 Ga0070664_100108516
466 Ga0068857_100243457
467 Ga0068857_100249752
468 Ga0068854_100435229
469 Ga0068859_100035832
470 Ga0068859_100186706
471 Ga0068864_100473417
472 Ga0068861_100211145
473 Ga0068861_100458586
474 Ga0068870_10241656
475 Ga0068863_100531330
476 Ga0068862_100143148
477 Ga0068862_100154600
478 Ga0075363_100012584
479 Ga0075367_10036499
480 Ga0075366_10014247
481 Ga0097621_100136656
482 Ga0068871_100051330
483 Ga0075428_100000750
484 Ga0075428_100000794
485 Ga0075428_100005605
486 Ga0075428_100013812
487 Ga0075428_100546116
488 Ga0075430_100001197
489 Ga0075430_100008017
490 Ga0075430_100019307
491 Ga0075430_100095353
492 Ga0075430_100228575
493 Ga0075431_100001704
494 Ga0075431_100001839
495 Ga0075431_100013298
496 Ga0075431_100023580
497 Ga0075431_100037200
498 Ga0075431_100088558
499 Ga0075431_100196482
500 Ga0075431_100213796
501 Ga0075431_100439520
502 Ga0075433_10004947
503 Ga0075433_10037555
504 Ga0075433_10084759
505 Ga0075433_10160407
506 Ga0075433_10311939
507 Ga0075433_10852855
508 Ga0075434_100054009
509 Ga0075434_100176148
510 Ga0075434_100585884
511 Ga0075434_101044033
512 Ga0075429_100004818
513 Ga0075429_100021343
514 Ga0075429_100059455
515 Ga0075429_100275517
516 Ga0075429_100373114
517 Ga0075436_100117653
518 Ga0097620_100035828
519 Ga0097620_100186721
520 Ga0075435_100168487
521 Ga0111539_10000043
522 Ga0111539_10018139
523 Ga0111539_10045317
524 Ga0111539_10052342
525 Ga0111539_10138138
526 Ga0111539_10746937
527 Ga0111539_11047517
528 Ga0114129_10001842
529 Ga0114129_10002858
530 Ga0114129_10004156
531 Ga0114129_10007131
532 Ga0114129_10009286
533 Ga0114129_10019123
534 Ga0114129_10028044
535 Ga0114129_10036924
536 Ga0114129_10039574
537 Ga0114129_10230090
538 Ga0114129_10258475
539 Ga0114129_10421421
540 Ga0114129_10564237
541 Ga0114129_10799488
542 Ga0105248_10074572
543 Ga0105248_10143325
544 Ga0105249_10092244
545 Ga0105249_10667694
546 Ga0105239_10764212
547 Ga0157374_10217732
548 Ga0157378_11147576
549 Ga0163162_10108523
550 Ga0157375_10116141
551 Ga0157375_10278529
552 Ga0157375_11472604
553 Ga0163163_10090307
554 Ga0163163_10110018
555 Ga0157380_10388965
556 Ga0157380_10761196
557 Ga0157376_10324883
558 Ga0157376_11101765
559 Ga0207697_10000776
560 Ga0207697_10025182
561 Ga0207688_10014199
562 Ga0207645_10077422
563 Ga0207645_10255228
564 Ga0207684_10002446
565 Ga0207684_10006887
566 Ga0207646_10006324
567 Ga0207681_10271690
568 Ga0207650_10008256
569 Ga0207650_10054221
570 Ga0207650_10137879
571 Ga0207706_10045083
572 Ga0207706_10073808
573 Ga0207669_10156630
574 Ga0207691_10069625
575 Ga0207711_10148742
576 Ga0207661_10006957
577 Ga0207679_10002090
578 Ga0207679_10028993
579 Ga0207651_10020714
580 Ga0207658_10223256
581 Ga0207677_10000256
582 Ga0207703_10435007
583 Ga0207678_10107281
584 Ga0207708_10096627
585 Ga0207641_10527041
586 Ga0207648_10107051
587 Ga0207648_10670241
588 Ga0207674_10084642
589 Ga0207674_10141452
590 Ga0207675_100066720
591 Ga0207675_100094421
592 Ga0207675_100377987
593 Ga0207675_100401489
594 Ga0207683_10077035
595 Ga0207428_10000163
596 Ga0207428_10102498
597 Ga0268266_10250825
598 Ga0268265_10084586
599 Ga0268265_10300179
600 Ga0268265_11029302
601 Ga0307408_100015393
602 Ga0307408_100023451
603 Ga0316579_10145215
604 Ga0316576_10036292
605 Ga0307405_10089365
606 Ga0307405_10098361
607 Ga0307413_10150203
608 Ga0307413_10151358
609 Ga0307410_10255949
610 Ga0307412_10108725
611 Ga0307409_100117409
612 Ga0307409_100963891
613 Ga0307416_100006461
614 Ga0307416_100080207
615 Ga0307416_100166843
616 Ga0307411_10059770
617 Ga0307411_10266253
618 Ga0307411_10343759
619 Ga0373934_0000420
620 Ga0373953_0007471
621 Ga0373956_0002115
622 Ga0373955_0009637
623 Ga0373933_0002184
624 Ga0373937_0000136
625 Ga0316584_0246985
626 Ga0395901_0895148
627 Ga0400489_88603
628 Ga0439461_0083486
629 Ga0451853_2167201
630 Ga0439435_0000624
631 Ga0439435_0018427
632 Ga0439460_0024718
633 Ga0439440_0074740
634 Ga0451576_0924728
635 Ga0495638_0007891
636 Ga0495653_0082826
637 Ga0495587_0045120
638 Ga0495647_0123636
639 Ga0495672_0019977
640 Ga0496100_0290436
641 Ga0496101_0107176
642 Ga0496104_0036980
643 Ga0496104_0304885
644 Ga0496106_0041389
645 Ga0496107_0343765
646 Ga0496108_0002599
647 Ga0496109_0005585
648 Ga0496109_0074509
649 Ga0496109_0507182
650 Ga0496110_0008889
651 Ga0496110_0043661
652 Ga0496110_0098048
653 Ga0496111_0351361
654 Ga0496112_0003047
655 Ga0496112_0050036
656 Ga0501291_016723
657 Ga0501031_0248932
658 Ga0501034_0001017
659 Ga0501036_0012814
660 Ga0501036_0031479
661 Ga0501036_0110662
662 Ga0501038_0236122
663 Ga0501038_0361417
664 Ga0501038_0445554
665 Ga0501038_0568719
666 Ga0501039_0027647
667 Ga0501039_0053747
668 Ga0501039_0070162
669 Ga0501039_0313713
670 Ga0501040_0047212
671 Ga0501040_0047310
672 Ga0501040_0117118
673 Ga0501041_0080873
674 Ga0501042_0025626
675 Ga0501042_0062538
676 Ga0501042_0137430
677 Ga0501046_0407866
678 Ga0501047_0155291
679 Ga0501048_0104930
680 Ga0501048_0125201
681 Ga0501048_0440635
682 Ga0501068_0001478
683 Ga0501070_0003678
684 Ga0501071_0059210
685 Ga0501071_0069539
686 Ga0501071_0073245
687 Ga0501071_0096285
688 Ga0501071_0251824
689 Ga0501071_0390189
690 Ga0501071_0540931
691 Ga0501072_0026677
692 Ga0501072_0092835
693 Ga0501072_0125881
694 Ga0501072_0169757
695 Ga0501073_0001444
696 Ga0501073_0115003
697 Ga0501074_0029052
698 Ga0501074_0086038
699 Ga0501074_0269384
700 Ga0501074_0331456
701 Ga0501075_0057051
702 Ga0501075_0058565
703 Ga0501075_0081522
704 Ga0501076_0009440
705 Ga0501076_0022194
706 Ga0501076_0053111
707 Ga0501076_0059187
708 Ga0501076_0092554
709 Ga0501076_0298647
710 Ga0501076_0563492
711 Ga0501077_0418053
712 Ga0501079_0079221
713 Ga0501079_0097999
714 Ga0501079_0286094
715 Ga0501079_0330214
716 Ga0501080_0002002
717 Ga0501080_0047558
718 Ga0501080_0459330
719 Ga0501080_0671694
720 Ga0501081_0015505
721 Ga0501081_0534127
722 Ga0501081_0599833
723 Ga0501083_0510196
724 Ga0501035_0378518
725 Ga0501045_0005439
726 Ga0501045_0027644
727 Ga0501045_0038676
728 Ga0501045_0349873
729 Ga0501045_0865528
730 Ga0501204_007472
731 nmdc:mga03n38_36997_c1
732 nmdc:mga0k408_117163_c1
733 nmdc:mga0k408_12765_c1
734 nmdc:mga06z11_84084_c1
735 nmdc:mga05p37_1052_c2
736 nmdc:mga05p37_11667_c1
737 nmdc:mga05p37_170034_c1
738 nmdc:mga05p37_20475_c1
739 nmdc:mga05p37_208369_c1
740 nmdc:mga05p37_221233_c1
741 nmdc:mga05p37_355292_c1
742 nmdc:mga05p37_4552_c1
743 nmdc:mga05p37_517840_c1
744 nmdc:mga05p37_7652_c1
745 nmdc:mga05p37_7947_c1
746 nmdc:mga05p37_844020_c1
747 nmdc:mga09592_14020_c1
748 nmdc:mga09592_33845_c1
749 nmdc:mga09592_403910_c1
750 nmdc:mga0qj67_181626_c1
751 nmdc:mga0qj67_80640_c1
752 nmdc:mga06r32_131912_c1
753 nmdc:mga06r32_195854_c1
754 nmdc:mga06r32_1994_c1
755 nmdc:mga06r32_272468_c1
756 nmdc:mga06r32_35567_c1
757 nmdc:mga06r32_65354_c1
758 nmdc:mga06r32_713505_c1
759 nmdc:mga06r32_743139_c1
760 nmdc:mga08y16_121606_c1
761 nmdc:mga08y16_25_c1
762 nmdc:mga08y16_614971_c1
763 nmdc:mga08y16_748211_c1
764 nmdc:mga0n895_152748_c1
765 nmdc:mga0n895_50772_c1
766 nmdc:mga0n895_524303_c1
767 nmdc:mga0rr50_261836_c1
768 nmdc:mga0rr50_445557_c1
769 nmdc:mga08x19_64955_c1
770 nmdc:mga0a205_174120_c1
771 nmdc:mga0a205_26993_c1
772 nmdc:mga0a205_298789_c1
773 nmdc:mga0a205_31444_c1
774 Ga0501084_0031796
775 Ga0501084_0032985
776 Ga0501084_0468551
777 Ga0590071_034491
778 Ga0590075_000815
779 Ga0590077_000760
780 Ga0501082_0055657
781 Ga0501082_0159495
782 Ga0501082_0267039
783 Ga0501082_0287782
784 Ga0501082_0515543
785 Ga0530510_0084177
786 Ga0530510_0427115

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07722

Peptidase_C26

Peptidase C26

22

229

0.9

PF00117

GATase

Glutamine amidotransferase class-I

40

247

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fij-assembly1.cif.gz_F crystal structure of a uncharacterized protein lin1909 0.9308 2 226
3fij-assembly1.cif.gz_G crystal structure of a uncharacterized protein lin1909 0.9224 2 225
3fij-assembly1.cif.gz_F crystal structure of a uncharacterized protein lin1909 0.9147 2 226
3fij-assembly1.cif.gz_G crystal structure of a uncharacterized protein lin1909 0.9064 2 225
6vtv-assembly1.cif.gz_A crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. coli 0.8936 2 226
ID Description Score Start End Superfamily
af_Q9HDV0_3_233_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9335 1 225 3.40.50.880
3fijG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9265 2 225 3.40.50.880
3fijG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9103 2 225 3.40.50.880
af_Q9HDV0_3_233_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8944 1 225 3.40.50.880
af_P76038_5_253_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8843 2 226 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2V8C5N2-F1-model_v4 Uncharacterized protein 0.9752 1 191 GO:0005829
GO:0006598
GO:0033969
AF-A0A2V8DWA9-F1-model_v4 Uncharacterized protein 0.973 23 228 GO:0005829
GO:0006541
GO:0006598
GO:0033969
AF-A0A7V8WGY2-F1-model_v4 Gamma-glutamyl-gamma-aminobutyrate hydrolase family protein 0.9697 2 226 GO:0005829
GO:0006541
GO:0006598
GO:0033969
AF-A0A7V8ZSN3-F1-model_v4 Gamma-glutamyl-gamma-aminobutyrate hydrolase family protein 0.968 1 177 GO:0005829
GO:0006598
GO:0033969
AF-A0A3N5GEI3-F1-model_v4 Gamma-glutamyl-gamma-aminobutyrate hydrolase family protein 0.9666 2 224 GO:0005829
GO:0006541
GO:0006598
GO:0033969

Map