F432535

General Info

Members Datasets Scaffolds Average Seq Length
393 207 786 357

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100090612|Ga0070684_1000906122
Length 379
Sequence VEGIWLARPDGALEASAPKPPAPGERHAPPAAARAGAGEPVAVKDLLDTAGLATTYGSALFADHVPAASADSVRLLEEAGYAVAGKTNLHEFAYGISSQNAHYGTVPNPVAPGRLAGGDVELALGSDSAGSIRIPAAWCGNVGFKPTHGLVSVEGCFPLAPSYDVVGPMASSVEGCERLLATLAPGFEPVALESLEEIDVGIAWLARADPLVRERVAEAASLFPRRREIDLPLAPANRADFMREVADVHRVLFTGNEELYGENVRGKIERCLRVTDAEVAVAERERAEYSERFLEAAGGLDLVVTPTVLLVAPPADADELALRLPATDHTYPFSSLGWPALALPCGPAEDGLPASIQLAAPRGEDARVLAAGRLLESLL

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
91 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
92 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
93 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
96 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
106 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
147 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
204 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 1.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 7.89
Rhizosphere 91.86
Stem 0
Stem Tuber 0
Unclassified 5.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100090612 3300005535 Bacteria 2719
2 Ga0070658_10006695 3300005327 Bacteria 9331
3 Ga0070658_10033907 3300005327 Bacteria 4108
4 Ga0070658_10061530 3300005327 Bacteria 3059
5 Ga0070683_100002852 3300005329 Bacteria 13836
6 Ga0070683_100092323 3300005329 Bacteria 2843
7 Ga0068869_100262074 3300005334 Unclassified 1384
8 Ga0070680_100049354 3300005336 Bacteria 3431
9 Ga0070680_100068989 3300005336 Bacteria 2902
10 Ga0070680_100156050 3300005336 Unclassified 1917
11 Ga0070682_100021422 3300005337 Bacteria 3814
12 Ga0070682_100110433 3300005337 Bacteria 1832
13 Ga0070682_100126091 3300005337 Bacteria 1726
14 Ga0068868_100051265 3300005338 Unclassified 3245
15 Ga0068868_100162510 3300005338 Bacteria 1845
16 Ga0070660_100001894 3300005339 Bacteria 14408
17 Ga0070660_100046837 3300005339 Bacteria 3315
18 Ga0070660_100059903 3300005339 Bacteria 2953
19 Ga0070689_100039728 3300005340 Bacteria 3604
20 Ga0070661_100005814 3300005344 Bacteria 8482
21 Ga0070668_100027830 3300005347 Bacteria 4291
22 Ga0070673_100361975 3300005364 Unclassified 1290
23 Ga0070659_100026821 3300005366 Bacteria 4434
24 Ga0070709_10141887 3300005434 Unclassified 1651
25 Ga0070714_100015798 3300005435 Bacteria 6084
26 Ga0070714_100033946 3300005435 Bacteria 4271
27 Ga0070714_100127670 3300005435 Bacteria 2269
28 Ga0070710_10002341 3300005437 Bacteria 8966
29 Ga0070701_10030649 3300005438 Bacteria 2662
30 Ga0070711_100261979 3300005439 Unclassified 1360
31 Ga0070700_100005069 3300005441 Bacteria 6944
32 Ga0070663_100011051 3300005455 Bacteria 5652
33 Ga0070681_10043736 3300005458 Bacteria 4484
34 Ga0070681_10052396 3300005458 Bacteria 4069
35 Ga0070681_10175012 3300005458 Unclassified 2068
36 Ga0068867_100003109 3300005459 Bacteria 11702
37 Ga0070685_10013617 3300005466 Bacteria 4294
38 Ga0070707_100003577 3300005468 Bacteria 14661
39 Ga0070679_100047268 3300005530 Bacteria 4290
40 Ga0070679_100160406 3300005530 Bacteria 2223
41 Ga0070679_100237115 3300005530 Bacteria 1782
42 Ga0070684_100047669 3300005535 Bacteria 3714
43 Ga0068853_100090730 3300005539 Bacteria 2686
44 Ga0070672_100023885 3300005543 Bacteria 4509
45 Ga0070695_100000670 3300005545 Bacteria 18279
46 Ga0070696_100032248 3300005546 Bacteria 3594
47 Ga0070693_100090455 3300005547 Bacteria 1844
48 Ga0070704_100007563 3300005549 Bacteria 6472
49 Ga0068855_100147716 3300005563 Bacteria 2675
50 Ga0068855_100204233 3300005563 Bacteria 2223
51 Ga0068855_100431699 3300005563 Bacteria 1440
52 Ga0068856_100024133 3300005614 Bacteria 5917
53 Ga0070702_100134479 3300005615 Unclassified 1566
54 Ga0068859_100064321 3300005617 Bacteria 3700
55 Ga0068861_100027070 3300005719 Bacteria 4173
56 Ga0070717_10001487 3300006028 Bacteria 16225
57 Ga0070717_10034238 3300006028 Bacteria 4105
58 Ga0070712_100007830 3300006175 Bacteria 6690
59 Ga0075433_10144857 3300006852 Bacteria 2112
60 Ga0075434_100037607 3300006871 Bacteria 4792
61 Ga0068865_100018909 3300006881 Bacteria 4452
62 Ga0097620_100064321 3300006931 Bacteria 3700
63 Ga0105240_10019070 3300009093 Bacteria 9173
64 Ga0105240_10142841 3300009093 Bacteria 2860
65 Ga0105243_10005851 3300009148 Bacteria 9531
66 Ga0105241_10024360 3300009174 Bacteria 4494
67 Ga0105242_10008680 3300009176 Bacteria 7799
68 Ga0105248_10035897 3300009177 Bacteria 5545
69 Ga0105248_10068402 3300009177 Bacteria 3987
70 Ga0105248_10162033 3300009177 Bacteria 2522
71 Ga0105237_10188624 3300009545 Bacteria 2062
72 Ga0105238_10066015 3300009551 Bacteria 3619
73 Ga0105238_10290448 3300009551 Bacteria 1617
74 Ga0105239_10436552 3300010375 Bacteria 1484
75 Ga0157370_10268373 3300013104 Bacteria 1577
76 Ga0157369_10036406 3300013105 Bacteria 5392
77 Ga0157369_10054037 3300013105 Bacteria 4337
78 Ga0157369_10168057 3300013105 Bacteria 2312
79 Ga0157369_10215434 3300013105 Bacteria 2011
80 Ga0157374_10010954 3300013296 Bacteria 7829
81 Ga0157378_10037017 3300013297 Bacteria 4320
82 Ga0163162_10048355 3300013306 Bacteria 4261
83 Ga0157372_10067628 3300013307 Bacteria 4015
84 Ga0157372_10070515 3300013307 Bacteria 3932
85 Ga0157372_10142418 3300013307 Bacteria 2763
86 Ga0157375_10123455 3300013308 Bacteria 2702
87 Ga0157375_10202136 3300013308 Bacteria 2143
88 Ga0157377_10037492 3300014745 Unclassified 2671
89 Ga0206354_10140309 3300020081 Bacteria 1686
90 Ga0206354_10478494 3300020081 Bacteria 2183
91 Ga0206353_10137406 3300020082 Bacteria 2994
92 Ga0206353_10287559 3300020082 Bacteria 5781
93 Ga0206353_10445075 3300020082 Bacteria 2131
94 Ga0207647_10053866 3300025904 Bacteria 2477
95 Ga0207685_10002067 3300025905 Bacteria 4485
96 Ga0207685_10029484 3300025905 Unclassified 1943
97 Ga0207707_10021660 3300025912 Bacteria 5617
98 Ga0207695_10234581 3300025913 Bacteria 1738
99 Ga0207693_10000745 3300025915 Bacteria 29290
100 Ga0207693_10004746 3300025915 Bacteria 11432
101 Ga0207663_10006037 3300025916 Bacteria 6156
102 Ga0207660_10072807 3300025917 Bacteria 2503
103 Ga0207660_10241427 3300025917 Bacteria 1423
104 Ga0207657_10007302 3300025919 Bacteria 11331
105 Ga0207657_10010074 3300025919 Bacteria 9449
106 Ga0207657_10153475 3300025919 Bacteria 1874
107 Ga0207649_10045824 3300025920 Bacteria 2683
108 Ga0207652_10028008 3300025921 Bacteria 4698
109 Ga0207652_10031648 3300025921 Bacteria 4445
110 Ga0207652_10251379 3300025921 Bacteria 1594
111 Ga0207687_10107096 3300025927 Bacteria 2068
112 Ga0207700_10109462 3300025928 Bacteria 2220
113 Ga0207664_10113853 3300025929 Bacteria 2253
114 Ga0207664_10145301 3300025929 Bacteria 2010
115 Ga0207706_10044072 3300025933 Bacteria 3954
116 Ga0207686_10022035 3300025934 Bacteria 3664
117 Ga0207670_10038159 3300025936 Bacteria 3135
118 Ga0207669_10001097 3300025937 Bacteria 11569
119 Ga0207704_10031384 3300025938 Bacteria 2992
120 Ga0207691_10001540 3300025940 Bacteria 22940
121 Ga0207661_10002586 3300025944 Bacteria 12449
122 Ga0207667_10358405 3300025949 Bacteria 1487
123 Ga0207677_10050912 3300026023 Unclassified 2804
124 Ga0207678_10007860 3300026067 Bacteria 9412
125 Ga0207708_10000757 3300026075 Bacteria 24232
126 Ga0207702_10068409 3300026078 Bacteria 3051
127 Ga0207702_10119456 3300026078 Bacteria 2357
128 Ga0207648_10002049 3300026089 Bacteria 21957
129 Ga0207675_100028212 3300026118 Bacteria 5227
130 Ga0207683_10004507 3300026121 Bacteria 12018
131 Ga0268266_10085856 3300028379 Unclassified 2751
132 Ga0265319_1010619 3300028563 Bacteria 3830
133 Ga0265319_1023739 3300028563 Bacteria 2218
134 Ga0265334_10002601 3300028573 Bacteria 8412
135 Ga0265334_10007828 3300028573 Bacteria 4573
136 Ga0265318_10000755 3300028577 Bacteria 21562
137 Ga0265336_10000871 3300028666 Bacteria 15518
138 Ga0265338_10003335 3300028800 Bacteria 22696
139 Ga0265338_10013525 3300028800 Bacteria 9202
140 Ga0265338_10020909 3300028800 Bacteria 6851
141 Ga0265338_10045020 3300028800 Bacteria 4064
142 Ga0265328_10076865 3300031239 Bacteria 1229
143 Ga0265320_10017649 3300031240 Bacteria 3955
144 Ga0265325_10003090 3300031241 Bacteria 10993
145 Ga0265329_10028759 3300031242 Bacteria 1820
146 Ga0265339_10030379 3300031249 Bacteria 3059
147 Ga0265327_10004844 3300031251 Bacteria 11664
148 Ga0265316_10018065 3300031344 Bacteria 6074
149 Ga0265313_10015970 3300031595 Bacteria 4341
150 Ga0265313_10035570 3300031595 Bacteria 2507
151 Ga0265342_10015434 3300031712 Bacteria 5022
152 Ga0307415_100092499 3300032126 Bacteria 2193
153 Ga0373926_0003588 3300035083 Bacteria 5033
154 Ga0373945_0009299 3300035116 Bacteria 3218
155 Ga0373945_0021070 3300035116 Bacteria 2237
156 Ga0373943_0013282 3300035170 Bacteria 3718
157 Ga0373931_0143181 3300035691 Bacteria 1387
158 Ga0373935_0019743 3300035692 Bacteria 4110
159 Ga0373935_0037735 3300035692 Bacteria 3024
160 Ga0373947_0000941 3300035725 Bacteria 17705
161 Ga0373937_0002033 3300036401 Bacteria 16891
162 Ga0373925_0015770 3300037068 Bacteria 5467
163 Ga0395899_0007553 3300037312 Bacteria 8396
164 Ga0395899_0047446 3300037312 Bacteria 3198
165 Ga0395900_0001712 3300037418 Bacteria 25354
166 Ga0395900_0030345 3300037418 Bacteria 5551
167 Ga0395898_0001935 3300037466 Bacteria 26310
168 Ga0395898_0020962 3300037466 Bacteria 6631
169 Ga0395898_0084361 3300037466 Bacteria 3062
170 Ga0395905_0082207 3300037471 Bacteria 3018
171 Ga0395901_0009177 3300038443 Bacteria 10021
172 Ga0395901_0017820 3300038443 Bacteria 7248
173 Ga0395901_0020849 3300038443 Bacteria 6710
174 Ga0466969_0001344 3300044656 Bacteria 13262
175 Ga0466969_0061412 3300044656 Bacteria 1825
176 Ga0466965_0049260 3300044683 Unclassified 2088
177 Ga0466965_0091325 3300044683 Bacteria 1549
178 Ga0466966_0002635 3300044684 Bacteria 11745
179 Ga0466961_0001489 3300044693 Bacteria 14537
180 Ga0466961_0003353 3300044693 Bacteria 9994
181 Ga0466961_0004912 3300044693 Bacteria 8407
182 Ga0466961_0022211 3300044693 Bacteria 4082
183 Ga0466963_0000049 3300044694 Bacteria 39571
184 Ga0466963_0006191 3300044694 Bacteria 7066
185 Ga0466963_0006435 3300044694 Bacteria 6948
186 Ga0466963_0006856 3300044694 Bacteria 6778
187 Ga0466963_0014752 3300044694 Bacteria 4823
188 Ga0466963_0026461 3300044694 Bacteria 3710
189 Ga0466963_0032990 3300044694 Bacteria 3357
190 Ga0466963_0056345 3300044694 Bacteria 2615
191 Ga0466963_0079348 3300044694 Bacteria 2221
192 Ga0466963_0201497 3300044694 Bacteria 1392
193 Ga0466963_0286192 3300044694 Bacteria 1158
194 Ga0466964_0006319 3300044706 Bacteria 4411
195 Ga0466964_0011005 3300044706 Bacteria 3417
196 Ga0466964_0012993 3300044706 Bacteria 3154
197 Ga0466964_0015458 3300044706 Bacteria 2905
198 Ga0466964_0026335 3300044706 Bacteria 2276
199 Ga0466971_0002587 3300044719 Bacteria 7649
200 Ga0466971_0004215 3300044719 Bacteria 6194
201 Ga0466971_0013651 3300044719 Bacteria 3570
202 Ga0466971_0049426 3300044719 Bacteria 1892
203 Ga0466968_0003546 3300044735 Bacteria 5773
204 Ga0466968_0011935 3300044735 Bacteria 3392
205 Ga0466968_0051975 3300044735 Bacteria 1752
206 Ga0466970_0026021 3300044765 Bacteria 3066
207 Ga0466970_0115295 3300044765 Bacteria 1469
208 Ga0466957_0001599 3300044842 Bacteria 11892
209 Ga0466957_0002669 3300044842 Bacteria 9634
210 Ga0466957_0010319 3300044842 Bacteria 5356
211 Ga0466957_0010897 3300044842 Bacteria 5230
212 Ga0466957_0012961 3300044842 Bacteria 4830
213 Ga0466957_0012966 3300044842 Bacteria 4829
214 Ga0466957_0014939 3300044842 Bacteria 4530
215 Ga0466957_0024600 3300044842 Bacteria 3564
216 Ga0466957_0045615 3300044842 Bacteria 2659
217 Ga0466957_0053930 3300044842 Bacteria 2452
218 Ga0466960_0002510 3300044901 Bacteria 6901
219 Ga0466959_0001570 3300045049 Bacteria 14073
220 Ga0466959_0009471 3300045049 Bacteria 6930
221 Ga0466959_0010896 3300045049 Bacteria 6518
222 Ga0466959_0080504 3300045049 Bacteria 2348
223 Ga0466958_0000746 3300045836 Bacteria 14259
224 Ga0466958_0002299 3300045836 Bacteria 9531
225 Ga0466958_0032097 3300045836 Bacteria 3122
226 Ga0466958_0083762 3300045836 Bacteria 1966
227 Ga0466958_0144162 3300045836 Bacteria 1500
228 Ga0466967_0002790 3300045976 Bacteria 11065
229 Ga0466967_0003030 3300045976 Bacteria 10780
230 Ga0466967_0004223 3300045976 Bacteria 9637
231 Ga0466967_0004786 3300045976 Bacteria 9219
232 Ga0466967_0007103 3300045976 Bacteria 8033
233 Ga0466967_0010565 3300045976 Bacteria 6933
234 Ga0466967_0025778 3300045976 Bacteria 4853
235 Ga0466967_0030338 3300045976 Bacteria 4536
236 Ga0466967_0061830 3300045976 Bacteria 3323
237 Ga0466967_0080101 3300045976 Bacteria 2946
238 Ga0466967_0118309 3300045976 Bacteria 2444
239 Ga0466967_0129164 3300045976 Bacteria 2344
240 Ga0466967_0137635 3300045976 Bacteria 2272
241 Ga0466967_0157865 3300045976 Bacteria 2127
242 Ga0466967_0158017 3300045976 Bacteria 2126
243 Ga0466967_0244552 3300045976 Bacteria 1712
244 Ga0495592_0001046 3300046454 Bacteria 19192
245 Ga0495592_0008205 3300046454 Bacteria 7842
246 Ga0495592_0174674 3300046454 Bacteria 1468
247 Ga0495629_0002124 3300046459 Bacteria 15362
248 Ga0495629_0068732 3300046459 Bacteria 2472
249 Ga0495641_0000259 3300046461 Bacteria 41682
250 Ga0495641_0009576 3300046461 Bacteria 5742
251 Ga0495641_0053228 3300046461 Bacteria 1842
252 Ga0495651_0000004 3300046462 Bacteria 177080
253 Ga0495653_0001654 3300046463 Bacteria 17517
254 Ga0495653_0034810 3300046463 Bacteria 3978
255 Ga0495653_0054325 3300046463 Bacteria 3061
256 Ga0495653_0143066 3300046463 Bacteria 1680
257 Ga0495580_0017042 3300046472 Bacteria 5444
258 Ga0495582_0000869 3300046473 Bacteria 16760
259 Ga0495582_0030903 3300046473 Unclassified 2942
260 Ga0495639_0000656 3300046475 Bacteria 15981
261 Ga0495662_0007743 3300046476 Bacteria 5290
262 Ga0495662_0054037 3300046476 Bacteria 1940
263 Ga0495664_0040962 3300046477 Bacteria 2739
264 Ga0495608_0000706 3300046511 Bacteria 23235
265 Ga0495608_0010721 3300046511 Bacteria 6394
266 Ga0495608_0048719 3300046511 Bacteria 2814
267 Ga0495618_0004348 3300046514 Bacteria 8714
268 Ga0495618_0053834 3300046514 Bacteria 2545
269 Ga0495628_0002866 3300046516 Bacteria 15457
270 Ga0495628_0051574 3300046516 Bacteria 3252
271 Ga0495628_0284010 3300046516 Bacteria 1228
272 Ga0495630_0000638 3300046517 Bacteria 25397
273 Ga0495630_0021049 3300046517 Bacteria 4815
274 Ga0495630_0071822 3300046517 Bacteria 2605
275 Ga0495644_0015647 3300046523 Bacteria 2908
276 Ga0495666_0000257 3300046526 Bacteria 22867
277 Ga0495652_0000047 3300046529 Bacteria 121525
278 Ga0495652_0013160 3300046529 Bacteria 7449
279 Ga0495652_0019141 3300046529 Bacteria 6099
280 Ga0495652_0069035 3300046529 Bacteria 2959
281 Ga0495665_0000649 3300046531 Bacteria 17795
282 Ga0495640_0009269 3300046533 Bacteria 7673
283 Ga0495640_0011565 3300046533 Bacteria 6784
284 Ga0495640_0116920 3300046533 Bacteria 1736
285 Ga0495586_0002911 3300046535 Bacteria 9234
286 Ga0495586_0088921 3300046535 Bacteria 1704
287 Ga0495587_0000103 3300046536 Bacteria 64471
288 Ga0495645_0000028 3300046543 Bacteria 113461
289 Ga0495667_0076410 3300046559 Bacteria 2179
290 Ga0495667_0080928 3300046559 Bacteria 2111
291 Ga0495667_0208868 3300046559 Bacteria 1248
292 Ga0495656_0045856 3300046615 Bacteria 1847
293 Ga0495634_0049770 3300046642 Bacteria 2816
294 Ga0495634_0108429 3300046642 Unclassified 1787
295 Ga0495611_0015105 3300046648 Bacteria 3300
296 Ga0495635_0016144 3300046663 Bacteria 5213
297 Ga0495635_0135638 3300046663 Bacteria 1678
298 Ga0495657_0005251 3300046675 Bacteria 10253
299 Ga0495599_0000073 3300046678 Bacteria 70685
300 Ga0495599_0004413 3300046678 Bacteria 8322
301 Ga0495623_0000105 3300046679 Bacteria 51809
302 Ga0495623_0027100 3300046679 Bacteria 3686
303 Ga0495646_0001581 3300046680 Bacteria 13581
304 Ga0495646_0117182 3300046680 Unclassified 1510
305 Ga0495647_0000055 3300046681 Bacteria 28891
306 Ga0495658_0025210 3300046683 Bacteria 3176
307 Ga0495613_0008298 3300046689 Bacteria 7711
308 Ga0495613_0016414 3300046689 Bacteria 5515
309 Ga0495613_0113744 3300046689 Bacteria 1948
310 Ga0495613_0115101 3300046689 Bacteria 1935
311 Ga0495624_0001536 3300046690 Bacteria 17832
312 Ga0495624_0008700 3300046690 Bacteria 7069
313 Ga0495600_0013086 3300046809 Bacteria 5206
314 Ga0495600_0056204 3300046809 Bacteria 2571
315 Ga0495600_0075320 3300046809 Bacteria 2204
316 Ga0495581_0004015 3300047315 Bacteria 8472
317 Ga0495581_0096943 3300047315 Unclassified 1712
318 Ga0495604_0000027 3300047317 Bacteria 143025
319 Ga0495604_0095420 3300047317 Bacteria 2197
320 Ga0495674_0005471 3300047319 Bacteria 12201
321 Ga0495674_0143541 3300047319 Bacteria 2005
322 Ga0495674_0268088 3300047319 Unclassified 1402
323 Ga0495676_0003155 3300047321 Bacteria 14909
324 Ga0495676_0089241 3300047321 Bacteria 2310
325 Ga0495680_0002920 3300047322 Bacteria 17172
326 Ga0495680_0003487 3300047322 Bacteria 15443
327 Ga0495680_0011938 3300047322 Bacteria 7665
328 Ga0495680_0064102 3300047322 Bacteria 2819
329 Ga0495680_0078811 3300047322 Bacteria 2492
330 Ga0495675_0000273 3300047444 Bacteria 37403
331 Ga0495684_0003752 3300047471 Bacteria 11850
332 Ga0495684_0092884 3300047471 Bacteria 2285
333 Ga0495684_0111076 3300047471 Bacteria 2068
334 Ga0495593_0000453 3300047673 Bacteria 23030
335 Ga0495602_0000096 3300048088 Bacteria 82587
336 Ga0495602_0067863 3300048088 Bacteria 3066
337 Ga0495614_0000607 3300048089 Bacteria 15036
338 Ga0496100_0022538 3300048903 Bacteria 3811
339 Ga0496100_0094681 3300048903 Bacteria 2046
340 Ga0496101_0092700 3300048904 Bacteria 2249
341 Ga0496102_0012598 3300048905 Bacteria 7325
342 Ga0496102_0174231 3300048905 Bacteria 2025
343 Ga0496102_0194869 3300048905 Unclassified 1909
344 Ga0496103_0024142 3300048906 Bacteria 3667
345 Ga0496104_0002863 3300048907 Bacteria 14870
346 Ga0496104_0091308 3300048907 Bacteria 2911
347 Ga0496105_0001941 3300048908 Bacteria 14854
348 Ga0496105_0262049 3300048908 Bacteria 1398
349 Ga0496106_0069711 3300048909 Bacteria 2684
350 Ga0496106_0110408 3300048909 Bacteria 2141
351 Ga0496107_0004011 3300048910 Bacteria 9912
352 Ga0496107_0065732 3300048910 Bacteria 2630
353 Ga0496108_0004672 3300048911 Bacteria 11040
354 Ga0496108_0005299 3300048911 Bacteria 10411
355 Ga0496108_0024280 3300048911 Bacteria 4991
356 Ga0496108_0065521 3300048911 Bacteria 3062
357 Ga0496108_0131396 3300048911 Bacteria 2152
358 Ga0496109_0017047 3300048912 Bacteria 6357
359 Ga0496109_0074357 3300048912 Bacteria 3123
360 Ga0496109_0122543 3300048912 Bacteria 2422
361 Ga0496110_0059592 3300048913 Bacteria 3366
362 Ga0496112_0106911 3300048915 Bacteria 2768
363 Ga0496112_0378593 3300048915 Unclassified 1356
364 Ga0496113_0110494 3300048916 Unclassified 2139
365 Ga0496114_0118952 3300048917 Bacteria 2270
366 Ga0496115_0039348 3300048918 Bacteria 3755
367 Ga0496115_0043642 3300048918 Bacteria 3576
368 Ga0496115_0046166 3300048918 Bacteria 3480
369 Ga0501067_0017348 3300049583 Bacteria 3979
370 Ga0501070_0001820 3300049586 Bacteria 18782
371 Ga0501074_0007159 3300049590 Bacteria 8056
372 Ga0501074_0031976 3300049590 Bacteria 3814
373 Ga0501079_0052256 3300049741 Bacteria 3154
374 Ga0501080_0000309 3300049742 Bacteria 37361
375 Ga0501083_0000241 3300049744 Bacteria 35214
376 nmdc:mga0n895_28075_c1 3300050512 Bacteria 5351
377 nmdc:mga08x19_140235_c1 3300050514 Bacteria 1632
378 nmdc:mga0a205_169928_c1 3300050515 Bacteria 2076
379 Ga0495601_0007536 3300053077 Bacteria 6385
380 Ga0495601_0028771 3300053077 Bacteria 3443
381 Ga0495612_0003213 3300053078 Bacteria 6778
382 Ga0495612_0024814 3300053078 Bacteria 2407
383 Ga0495612_0030133 3300053078 Bacteria 2186
384 Ga0495595_0002579 3300053084 Bacteria 7107
385 Ga0495595_0006279 3300053084 Bacteria 4839
386 Ga0495619_0003601 3300053085 Bacteria 9980
387 Ga0495619_0017049 3300053085 Bacteria 4604
388 Ga0500566_0027100 3300053094 Bacteria 3354
389 Ga0466962_0002364 3300061719 Bacteria 8937
390 Ga0466962_0002404 3300061719 Bacteria 8878
391 Ga0466962_0003493 3300061719 Bacteria 7490
392 Ga0466962_0008841 3300061719 Bacteria 4827
393 Ga0466962_0023108 3300061719 Bacteria 2989
394 Ga0070684_100090612
395 Ga0070658_10006695
396 Ga0070658_10033907
397 Ga0070658_10061530
398 Ga0070683_100002852
399 Ga0070683_100092323
400 Ga0068869_100262074
401 Ga0070680_100049354
402 Ga0070680_100068989
403 Ga0070680_100156050
404 Ga0070682_100021422
405 Ga0070682_100110433
406 Ga0070682_100126091
407 Ga0068868_100051265
408 Ga0068868_100162510
409 Ga0070660_100001894
410 Ga0070660_100046837
411 Ga0070660_100059903
412 Ga0070689_100039728
413 Ga0070661_100005814
414 Ga0070668_100027830
415 Ga0070673_100361975
416 Ga0070659_100026821
417 Ga0070709_10141887
418 Ga0070714_100015798
419 Ga0070714_100033946
420 Ga0070714_100127670
421 Ga0070710_10002341
422 Ga0070701_10030649
423 Ga0070711_100261979
424 Ga0070700_100005069
425 Ga0070663_100011051
426 Ga0070681_10043736
427 Ga0070681_10052396
428 Ga0070681_10175012
429 Ga0068867_100003109
430 Ga0070685_10013617
431 Ga0070707_100003577
432 Ga0070679_100047268
433 Ga0070679_100160406
434 Ga0070679_100237115
435 Ga0070684_100047669
436 Ga0068853_100090730
437 Ga0070672_100023885
438 Ga0070695_100000670
439 Ga0070696_100032248
440 Ga0070693_100090455
441 Ga0070704_100007563
442 Ga0068855_100147716
443 Ga0068855_100204233
444 Ga0068855_100431699
445 Ga0068856_100024133
446 Ga0070702_100134479
447 Ga0068859_100064321
448 Ga0068861_100027070
449 Ga0070717_10001487
450 Ga0070717_10034238
451 Ga0070712_100007830
452 Ga0075433_10144857
453 Ga0075434_100037607
454 Ga0068865_100018909
455 Ga0097620_100064321
456 Ga0105240_10019070
457 Ga0105240_10142841
458 Ga0105243_10005851
459 Ga0105241_10024360
460 Ga0105242_10008680
461 Ga0105248_10035897
462 Ga0105248_10068402
463 Ga0105248_10162033
464 Ga0105237_10188624
465 Ga0105238_10066015
466 Ga0105238_10290448
467 Ga0105239_10436552
468 Ga0157370_10268373
469 Ga0157369_10036406
470 Ga0157369_10054037
471 Ga0157369_10168057
472 Ga0157369_10215434
473 Ga0157374_10010954
474 Ga0157378_10037017
475 Ga0163162_10048355
476 Ga0157372_10067628
477 Ga0157372_10070515
478 Ga0157372_10142418
479 Ga0157375_10123455
480 Ga0157375_10202136
481 Ga0157377_10037492
482 Ga0206354_10140309
483 Ga0206354_10478494
484 Ga0206353_10137406
485 Ga0206353_10287559
486 Ga0206353_10445075
487 Ga0207647_10053866
488 Ga0207685_10002067
489 Ga0207685_10029484
490 Ga0207707_10021660
491 Ga0207695_10234581
492 Ga0207693_10000745
493 Ga0207693_10004746
494 Ga0207663_10006037
495 Ga0207660_10072807
496 Ga0207660_10241427
497 Ga0207657_10007302
498 Ga0207657_10010074
499 Ga0207657_10153475
500 Ga0207649_10045824
501 Ga0207652_10028008
502 Ga0207652_10031648
503 Ga0207652_10251379
504 Ga0207687_10107096
505 Ga0207700_10109462
506 Ga0207664_10113853
507 Ga0207664_10145301
508 Ga0207706_10044072
509 Ga0207686_10022035
510 Ga0207670_10038159
511 Ga0207669_10001097
512 Ga0207704_10031384
513 Ga0207691_10001540
514 Ga0207661_10002586
515 Ga0207667_10358405
516 Ga0207677_10050912
517 Ga0207678_10007860
518 Ga0207708_10000757
519 Ga0207702_10068409
520 Ga0207702_10119456
521 Ga0207648_10002049
522 Ga0207675_100028212
523 Ga0207683_10004507
524 Ga0268266_10085856
525 Ga0265319_1010619
526 Ga0265319_1023739
527 Ga0265334_10002601
528 Ga0265334_10007828
529 Ga0265318_10000755
530 Ga0265336_10000871
531 Ga0265338_10003335
532 Ga0265338_10013525
533 Ga0265338_10020909
534 Ga0265338_10045020
535 Ga0265328_10076865
536 Ga0265320_10017649
537 Ga0265325_10003090
538 Ga0265329_10028759
539 Ga0265339_10030379
540 Ga0265327_10004844
541 Ga0265316_10018065
542 Ga0265313_10015970
543 Ga0265313_10035570
544 Ga0265342_10015434
545 Ga0307415_100092499
546 Ga0373926_0003588
547 Ga0373945_0009299
548 Ga0373945_0021070
549 Ga0373943_0013282
550 Ga0373931_0143181
551 Ga0373935_0019743
552 Ga0373935_0037735
553 Ga0373947_0000941
554 Ga0373937_0002033
555 Ga0373925_0015770
556 Ga0395899_0007553
557 Ga0395899_0047446
558 Ga0395900_0001712
559 Ga0395900_0030345
560 Ga0395898_0001935
561 Ga0395898_0020962
562 Ga0395898_0084361
563 Ga0395905_0082207
564 Ga0395901_0009177
565 Ga0395901_0017820
566 Ga0395901_0020849
567 Ga0466969_0001344
568 Ga0466969_0061412
569 Ga0466965_0049260
570 Ga0466965_0091325
571 Ga0466966_0002635
572 Ga0466961_0001489
573 Ga0466961_0003353
574 Ga0466961_0004912
575 Ga0466961_0022211
576 Ga0466963_0000049
577 Ga0466963_0006191
578 Ga0466963_0006435
579 Ga0466963_0006856
580 Ga0466963_0014752
581 Ga0466963_0026461
582 Ga0466963_0032990
583 Ga0466963_0056345
584 Ga0466963_0079348
585 Ga0466963_0201497
586 Ga0466963_0286192
587 Ga0466964_0006319
588 Ga0466964_0011005
589 Ga0466964_0012993
590 Ga0466964_0015458
591 Ga0466964_0026335
592 Ga0466971_0002587
593 Ga0466971_0004215
594 Ga0466971_0013651
595 Ga0466971_0049426
596 Ga0466968_0003546
597 Ga0466968_0011935
598 Ga0466968_0051975
599 Ga0466970_0026021
600 Ga0466970_0115295
601 Ga0466957_0001599
602 Ga0466957_0002669
603 Ga0466957_0010319
604 Ga0466957_0010897
605 Ga0466957_0012961
606 Ga0466957_0012966
607 Ga0466957_0014939
608 Ga0466957_0024600
609 Ga0466957_0045615
610 Ga0466957_0053930
611 Ga0466960_0002510
612 Ga0466959_0001570
613 Ga0466959_0009471
614 Ga0466959_0010896
615 Ga0466959_0080504
616 Ga0466958_0000746
617 Ga0466958_0002299
618 Ga0466958_0032097
619 Ga0466958_0083762
620 Ga0466958_0144162
621 Ga0466967_0002790
622 Ga0466967_0003030
623 Ga0466967_0004223
624 Ga0466967_0004786
625 Ga0466967_0007103
626 Ga0466967_0010565
627 Ga0466967_0025778
628 Ga0466967_0030338
629 Ga0466967_0061830
630 Ga0466967_0080101
631 Ga0466967_0118309
632 Ga0466967_0129164
633 Ga0466967_0137635
634 Ga0466967_0157865
635 Ga0466967_0158017
636 Ga0466967_0244552
637 Ga0495592_0001046
638 Ga0495592_0008205
639 Ga0495592_0174674
640 Ga0495629_0002124
641 Ga0495629_0068732
642 Ga0495641_0000259
643 Ga0495641_0009576
644 Ga0495641_0053228
645 Ga0495651_0000004
646 Ga0495653_0001654
647 Ga0495653_0034810
648 Ga0495653_0054325
649 Ga0495653_0143066
650 Ga0495580_0017042
651 Ga0495582_0000869
652 Ga0495582_0030903
653 Ga0495639_0000656
654 Ga0495662_0007743
655 Ga0495662_0054037
656 Ga0495664_0040962
657 Ga0495608_0000706
658 Ga0495608_0010721
659 Ga0495608_0048719
660 Ga0495618_0004348
661 Ga0495618_0053834
662 Ga0495628_0002866
663 Ga0495628_0051574
664 Ga0495628_0284010
665 Ga0495630_0000638
666 Ga0495630_0021049
667 Ga0495630_0071822
668 Ga0495644_0015647
669 Ga0495666_0000257
670 Ga0495652_0000047
671 Ga0495652_0013160
672 Ga0495652_0019141
673 Ga0495652_0069035
674 Ga0495665_0000649
675 Ga0495640_0009269
676 Ga0495640_0011565
677 Ga0495640_0116920
678 Ga0495586_0002911
679 Ga0495586_0088921
680 Ga0495587_0000103
681 Ga0495645_0000028
682 Ga0495667_0076410
683 Ga0495667_0080928
684 Ga0495667_0208868
685 Ga0495656_0045856
686 Ga0495634_0049770
687 Ga0495634_0108429
688 Ga0495611_0015105
689 Ga0495635_0016144
690 Ga0495635_0135638
691 Ga0495657_0005251
692 Ga0495599_0000073
693 Ga0495599_0004413
694 Ga0495623_0000105
695 Ga0495623_0027100
696 Ga0495646_0001581
697 Ga0495646_0117182
698 Ga0495647_0000055
699 Ga0495658_0025210
700 Ga0495613_0008298
701 Ga0495613_0016414
702 Ga0495613_0113744
703 Ga0495613_0115101
704 Ga0495624_0001536
705 Ga0495624_0008700
706 Ga0495600_0013086
707 Ga0495600_0056204
708 Ga0495600_0075320
709 Ga0495581_0004015
710 Ga0495581_0096943
711 Ga0495604_0000027
712 Ga0495604_0095420
713 Ga0495674_0005471
714 Ga0495674_0143541
715 Ga0495674_0268088
716 Ga0495676_0003155
717 Ga0495676_0089241
718 Ga0495680_0002920
719 Ga0495680_0003487
720 Ga0495680_0011938
721 Ga0495680_0064102
722 Ga0495680_0078811
723 Ga0495675_0000273
724 Ga0495684_0003752
725 Ga0495684_0092884
726 Ga0495684_0111076
727 Ga0495593_0000453
728 Ga0495602_0000096
729 Ga0495602_0067863
730 Ga0495614_0000607
731 Ga0496100_0022538
732 Ga0496100_0094681
733 Ga0496101_0092700
734 Ga0496102_0012598
735 Ga0496102_0174231
736 Ga0496102_0194869
737 Ga0496103_0024142
738 Ga0496104_0002863
739 Ga0496104_0091308
740 Ga0496105_0001941
741 Ga0496105_0262049
742 Ga0496106_0069711
743 Ga0496106_0110408
744 Ga0496107_0004011
745 Ga0496107_0065732
746 Ga0496108_0004672
747 Ga0496108_0005299
748 Ga0496108_0024280
749 Ga0496108_0065521
750 Ga0496108_0131396
751 Ga0496109_0017047
752 Ga0496109_0074357
753 Ga0496109_0122543
754 Ga0496110_0059592
755 Ga0496112_0106911
756 Ga0496112_0378593
757 Ga0496113_0110494
758 Ga0496114_0118952
759 Ga0496115_0039348
760 Ga0496115_0043642
761 Ga0496115_0046166
762 Ga0501067_0017348
763 Ga0501070_0001820
764 Ga0501074_0007159
765 Ga0501074_0031976
766 Ga0501079_0052256
767 Ga0501080_0000309
768 Ga0501083_0000241
769 nmdc:mga0n895_28075_c1
770 nmdc:mga08x19_140235_c1
771 nmdc:mga0a205_169928_c1
772 Ga0495601_0007536
773 Ga0495601_0028771
774 Ga0495612_0003213
775 Ga0495612_0024814
776 Ga0495612_0030133
777 Ga0495595_0002579
778 Ga0495595_0006279
779 Ga0495619_0003601
780 Ga0495619_0017049
781 Ga0500566_0027100
782 Ga0466962_0002364
783 Ga0466962_0002404
784 Ga0466962_0003493
785 Ga0466962_0008841
786 Ga0466962_0023108

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01425

Amidase

Amidase

31

189

0.97

PF01425

Amidase

Amidase

191

369

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ip4-assembly1.cif.gz_A the high resolution structure of gatcab 0.8995 16 360
4cp8-assembly2.cif.gz_D structure of the amidase domain of allophanate hydrolase from pseudomonas sp strain adp 0.8979 16 357
2dc0-assembly1.cif.gz_B crystal structure of amidase 0.8883 16 360
4wj3-assembly2.cif.gz_D crystal structure of the asparagine transamidosome from pseudomonas aeruginosa 0.8854 16 360
6c6g-assembly1.cif.gz_B-2 an unexpected vestigial protein complex reveals the evolutionary origins of an s-triazine catabolic enzyme. inhibitor bound complex. 0.8816 16 359
ID Description Score Start End Superfamily
af_A0A1D6J2V0_231_678_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9049 16 359 3.90.1300.10
4cp8A00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8976 16 357 3.90.1300.10
af_U4PC78_3_453_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8921 3 360 3.90.1300.10
af_Q58560_2_434_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8903 10 358 3.90.1300.10
4wj3D00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8854 16 360 3.90.1300.10
ID Description Score Start End GO Terms
AF-A0A538A887-F1-model_v4 Amidase 0.974 113 356 GO:0003824
AF-A0A7W0PZ81-F1-model_v4 Amidase 0.9713 83 356 GO:0003824
AF-A0A538A887-F1-model_v4 Amidase 0.9547 113 356 GO:0003824
AF-A0A7W0P721-F1-model_v4 Amidase 0.9434 25 359 GO:0003824
AF-A0A538IH65-F1-model_v4 Amidase 0.9399 246 359 GO:0003824

Map