F432492

General Info

Members Datasets Scaffolds Average Seq Length
393 189 784 363

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10133022|rootH2_101330222
Length 408
Sequence MYLVKRITESISVRRNESQIHVLVPGSKKIIHLFIFLASCLSLKKHCCFMFTDKCFITIACYFLFSVSYAQTINDLKLKDYKPVSIYNIPETKIEKAKYPVIDFHSHDYPETDADVDAWVKTMDEVGIAKTIILSYATGAKFDSVYDKYARYTNRFEVWCGFDYTGYEKPGWEEHAVAELERCYKKGATGVGELGDKGLGEFYSTPTPGYGLHIDDPRMKPLLQKCAELHMPISIHVAEDAWMYEAADSLNDGLMNAATWRVDTSKPGILNHDQLVKSLENAVRENPGTIFIACHLANCCANLSMLAVMFDKYPNLYAEMAARYGEIAPIPRFAKAFMEKYSDRLLYGTDMGTAKTMYRITFRILETADEHFYEHDLLDYHWALYGLSLSDNTLEKIYNGNSKKILHK

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
150 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
151 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
174 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
175 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
176 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
177 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
178 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
179 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
183 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
184 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
185 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
186 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
187 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
188 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
189 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 0
Isolates 1.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.05
Nodule 0
Rhizoplane 1.27
Rhizosphere 94.4
Stem 0
Stem Tuber 0
Unclassified 12.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10133022 3300003320 Bacteria 2155
2 MRS1b_contig_2010402 2162886011 Bacteria 1888
3 JGI24740J21852_10000312 3300001979 Bacteria 20702
4 JGI24743J22301_10007663 3300001991 Unclassified 1878
5 JGI25406J46586_10000891 3300003203 Bacteria 14043
6 JGI25160J50197_1002337 3300003354 Bacteria 8876
7 Ga0055528_1000229 3300003790 Bacteria 46944
8 Ga0055530_10001596 3300003791 Bacteria 16235
9 Ga0065165_1000172 3300005262 Bacteria 114850
10 Ga0065712_10150886 3300005290 Bacteria 1271
11 Ga0065707_10092956 3300005295 Bacteria 3693
12 Ga0070658_10000011 3300005327 Bacteria 294396
13 Ga0070658_10003851 3300005327 Bacteria 12297
14 Ga0070658_10037265 3300005327 Bacteria 3919
15 Ga0070658_10109335 3300005327 Bacteria 2289
16 Ga0070676_10001451 3300005328 Bacteria 11989
17 Ga0070676_10030566 3300005328 Bacteria 3072
18 Ga0070683_100005257 3300005329 Bacteria 10777
19 Ga0070683_100088941 3300005329 Bacteria 2898
20 Ga0070683_100099467 3300005329 Bacteria 2737
21 Ga0070690_100023900 3300005330 Bacteria 3754
22 Ga0070690_100040195 3300005330 Bacteria 2957
23 Ga0070670_100063130 3300005331 Bacteria 3179
24 Ga0070670_100147160 3300005331 Bacteria 2038
25 Ga0070670_100264448 3300005331 Unclassified 1500
26 Ga0068869_100008557 3300005334 Bacteria 6606
27 Ga0068869_100097154 3300005334 Bacteria 2224
28 Ga0070666_10000719 3300005335 Bacteria 20079
29 Ga0070666_10040867 3300005335 Bacteria 3097
30 Ga0070680_100001175 3300005336 Bacteria 18835
31 Ga0070682_100000703 3300005337 Bacteria 20114
32 Ga0070682_100030153 3300005337 Unclassified 3271
33 Ga0068868_100001748 3300005338 Bacteria 14893
34 Ga0068868_100003085 3300005338 Bacteria 11598
35 Ga0068868_100010636 3300005338 Bacteria 6668
36 Ga0068868_100157231 3300005338 Bacteria 1875
37 Ga0070660_100006442 3300005339 Bacteria 8138
38 Ga0070660_100008685 3300005339 Bacteria 7114
39 Ga0070660_100079002 3300005339 Bacteria 2581
40 Ga0070689_100018563 3300005340 Bacteria 5127
41 Ga0070689_100021943 3300005340 Bacteria 4761
42 Ga0070689_100049427 3300005340 Bacteria 3247
43 Ga0070689_100191434 3300005340 Bacteria 1665
44 Ga0070689_100209739 3300005340 Unclassified 1594
45 Ga0070691_10002407 3300005341 Bacteria 8299
46 Ga0070687_100091464 3300005343 Bacteria 1684
47 Ga0070661_100024947 3300005344 Bacteria 4292
48 Ga0070661_100064597 3300005344 Bacteria 2689
49 Ga0070661_100077997 3300005344 Bacteria 2443
50 Ga0070668_100000669 3300005347 Bacteria 23229
51 Ga0070669_100001088 3300005353 Bacteria 19883
52 Ga0070675_100010821 3300005354 Bacteria 7134
53 Ga0070675_100036954 3300005354 Bacteria 3976
54 Ga0070675_100149251 3300005354 Bacteria 2003
55 Ga0070671_100025688 3300005355 Bacteria 4834
56 Ga0070671_100026628 3300005355 Bacteria 4754
57 Ga0070671_100075177 3300005355 Bacteria 2822
58 Ga0070671_100202987 3300005355 Bacteria 1681
59 Ga0070674_100202638 3300005356 Bacteria 1533
60 Ga0070673_100001852 3300005364 Bacteria 12648
61 Ga0070673_100008333 3300005364 Bacteria 6886
62 Ga0070673_100226469 3300005364 Bacteria 1620
63 Ga0070688_100001871 3300005365 Bacteria 10542
64 Ga0070659_100064912 3300005366 Bacteria 2890
65 Ga0070659_100129400 3300005366 Bacteria 2049
66 Ga0070667_100010999 3300005367 Bacteria 7483
67 Ga0070667_100101638 3300005367 Bacteria 2484
68 Ga0070667_100189777 3300005367 Bacteria 1820
69 Ga0070663_100148386 3300005455 Bacteria 1796
70 Ga0070678_100003373 3300005456 Bacteria 8903
71 Ga0070678_100117896 3300005456 Bacteria 2088
72 Ga0070678_100186363 3300005456 Bacteria 1703
73 Ga0070662_100001982 3300005457 Bacteria 12555
74 Ga0070662_100018813 3300005457 Bacteria 4679
75 Ga0070662_100028063 3300005457 Bacteria 3914
76 Ga0070681_10093567 3300005458 Bacteria 2954
77 Ga0070679_100016786 3300005530 Bacteria 7076
78 Ga0070679_100065166 3300005530 Bacteria 3631
79 Ga0070679_100327148 3300005530 Bacteria 1481
80 Ga0070684_100004276 3300005535 Bacteria 10832
81 Ga0070684_100004313 3300005535 Bacteria 10803
82 Ga0070684_100021937 3300005535 Bacteria 5319
83 Ga0068853_100002260 3300005539 Bacteria 14395
84 Ga0068853_100018397 3300005539 Bacteria 5783
85 Ga0068853_100021158 3300005539 Bacteria 5417
86 Ga0068853_100129173 3300005539 Bacteria 2260
87 Ga0068853_100158634 3300005539 Bacteria 2040
88 Ga0070672_100004140 3300005543 Bacteria 9469
89 Ga0070672_100025270 3300005543 Bacteria 4403
90 Ga0070672_100171304 3300005543 Bacteria 1806
91 Ga0070672_100330928 3300005543 Unclassified 1296
92 Ga0070686_100074750 3300005544 Bacteria 2228
93 Ga0070686_100076165 3300005544 Unclassified 2209
94 Ga0070665_100005135 3300005548 Bacteria 13562
95 Ga0070665_100175646 3300005548 Bacteria 2143
96 Ga0068855_100000121 3300005563 Bacteria 98009
97 Ga0068855_100014975 3300005563 Bacteria 9341
98 Ga0068855_100019919 3300005563 Bacteria 8057
99 Ga0068855_100070024 3300005563 Bacteria 4082
100 Ga0068855_100167076 3300005563 Bacteria 2493
101 Ga0070664_100018651 3300005564 Bacteria 5705
102 Ga0070664_100052102 3300005564 Unclassified 3466
103 Ga0070664_100058291 3300005564 Bacteria 3285
104 Ga0070664_100065119 3300005564 Bacteria 3109
105 Ga0068857_100063438 3300005577 Bacteria 3284
106 Ga0068857_100073058 3300005577 Bacteria 3056
107 Ga0068854_100091189 3300005578 Bacteria 2267
108 Ga0068854_100135278 3300005578 Bacteria 1886
109 Ga0068856_100002816 3300005614 Bacteria 17807
110 Ga0068856_100023989 3300005614 Bacteria 5933
111 Ga0068852_100019568 3300005616 Bacteria 5361
112 Ga0068852_100024981 3300005616 Bacteria 4835
113 Ga0068852_100240471 3300005616 Unclassified 1730
114 Ga0068859_100052646 3300005617 Unclassified 4093
115 Ga0068859_100062976 3300005617 Bacteria 3739
116 Ga0068859_100066270 3300005617 Bacteria 3646
117 Ga0068859_100268766 3300005617 Bacteria 1797
118 Ga0068864_100000176 3300005618 Bacteria 59064
119 Ga0068864_100005255 3300005618 Bacteria 10613
120 Ga0068864_100016350 3300005618 Bacteria 6176
121 Ga0068864_100143557 3300005618 Unclassified 2155
122 Ga0068864_100207017 3300005618 Unclassified 1805
123 Ga0068866_10077038 3300005718 Bacteria 1780
124 Ga0068861_100002646 3300005719 Bacteria 11712
125 Ga0068861_100039739 3300005719 Unclassified 3514
126 Ga0068851_10065597 3300005834 Bacteria 1869
127 Ga0068870_10009688 3300005840 Bacteria 4392
128 Ga0068863_100005795 3300005841 Bacteria 12111
129 Ga0068858_100004328 3300005842 Bacteria 13943
130 Ga0068858_100109022 3300005842 Bacteria 2585
131 Ga0068858_100170381 3300005842 Unclassified 2053
132 Ga0068858_100246619 3300005842 Bacteria 1696
133 Ga0068858_100374797 3300005842 Bacteria 1365
134 Ga0068860_100003756 3300005843 Bacteria 15613
135 Ga0068860_100004115 3300005843 Bacteria 14902
136 Ga0068860_100004932 3300005843 Bacteria 13601
137 Ga0068860_100006898 3300005843 Bacteria 11390
138 Ga0068860_100011396 3300005843 Bacteria 8761
139 Ga0068860_100020351 3300005843 Bacteria 6427
140 Ga0068862_100003796 3300005844 Bacteria 12872
141 Ga0068862_100005073 3300005844 Bacteria 11083
142 Ga0068862_100026442 3300005844 Unclassified 4877
143 Ga0068862_100062274 3300005844 Bacteria 3208
144 Ga0081539_10001586 3300005985 Bacteria 37565
145 Ga0081539_10018196 3300005985 Bacteria 4890
146 Ga0097621_100004344 3300006237 Bacteria 9853
147 Ga0097621_100006083 3300006237 Bacteria 8540
148 Ga0097621_100007645 3300006237 Bacteria 7746
149 Ga0097621_100056050 3300006237 Bacteria 3219
150 Ga0068871_100001313 3300006358 Bacteria 16615
151 Ga0068871_100003743 3300006358 Bacteria 10469
152 Ga0068871_100312604 3300006358 Unclassified 1381
153 Ga0068865_100062011 3300006881 Unclassified 2623
154 Ga0097620_100052647 3300006931 Unclassified 4093
155 Ga0097620_100062979 3300006931 Bacteria 3739
156 Ga0097620_100066273 3300006931 Bacteria 3646
157 Ga0097620_100268765 3300006931 Bacteria 1797
158 Ga0105240_10002682 3300009093 Bacteria 28339
159 Ga0111539_10002054 3300009094 Bacteria 26919
160 Ga0111539_10692951 3300009094 Unclassified 1186
161 Ga0105247_10092763 3300009101 Bacteria 1919
162 Ga0105241_10000299 3300009174 Bacteria 37072
163 Ga0105241_10014350 3300009174 Bacteria 5801
164 Ga0105241_10069614 3300009174 Unclassified 2728
165 Ga0105241_10073694 3300009174 Unclassified 2657
166 Ga0105241_10172445 3300009174 Unclassified 1788
167 Ga0105242_10017191 3300009176 Bacteria 5631
168 Ga0105242_10035633 3300009176 Unclassified 3990
169 Ga0105248_10020834 3300009177 Bacteria 7264
170 Ga0105237_10056237 3300009545 Bacteria 3939
171 Ga0105237_10063629 3300009545 Bacteria 3687
172 Ga0105249_10006690 3300009553 Bacteria 10040
173 Ga0105249_10040707 3300009553 Unclassified 4221
174 Ga0105239_10002508 3300010375 Bacteria 23344
175 Ga0105239_10067038 3300010375 Bacteria 3942
176 Ga0105239_10284403 3300010375 Bacteria 1862
177 Ga0105239_10429912 3300010375 Unclassified 1497
178 Ga0157373_10003359 3300013100 Bacteria 12095
179 Ga0157373_10020785 3300013100 Bacteria 4766
180 Ga0157371_10010982 3300013102 Bacteria 7018
181 Ga0157370_10015823 3300013104 Bacteria 7654
182 Ga0157370_10243068 3300013104 Bacteria 1665
183 Ga0157369_10002893 3300013105 Bacteria 20510
184 Ga0157374_10005898 3300013296 Bacteria 10348
185 Ga0157374_10012926 3300013296 Bacteria 7274
186 Ga0157374_10064625 3300013296 Unclassified 3434
187 Ga0157374_10108488 3300013296 Unclassified 2668
188 Ga0157374_10515283 3300013296 Bacteria 1201
189 Ga0157378_10008286 3300013297 Bacteria 9059
190 Ga0157378_10024305 3300013297 Bacteria 5329
191 Ga0157378_10100874 3300013297 Unclassified 2636
192 Ga0157378_10150044 3300013297 Bacteria 2171
193 Ga0157378_10183289 3300013297 Bacteria 1971
194 Ga0163162_10002155 3300013306 Bacteria 18467
195 Ga0163162_10016689 3300013306 Bacteria 7178
196 Ga0163162_10023987 3300013306 Bacteria 6020
197 Ga0163162_10026373 3300013306 Bacteria 5743
198 Ga0163162_10113615 3300013306 Unclassified 2807
199 Ga0163162_10163424 3300013306 Bacteria 2349
200 Ga0163162_10165544 3300013306 Bacteria 2334
201 Ga0163162_10251820 3300013306 Bacteria 1898
202 Ga0163162_10374809 3300013306 Bacteria 1556
203 Ga0157372_10101616 3300013307 Bacteria 3283
204 Ga0157372_10103712 3300013307 Bacteria 3250
205 Ga0157372_10123552 3300013307 Bacteria 2975
206 Ga0157372_10293118 3300013307 Bacteria 1892
207 Ga0157375_10001259 3300013308 Bacteria 21928
208 Ga0157375_10001857 3300013308 Bacteria 18174
209 Ga0157375_10003488 3300013308 Bacteria 13634
210 Ga0157375_10003884 3300013308 Viruses 12968
211 Ga0157375_10004091 3300013308 Bacteria 12645
212 Ga0157375_10024534 3300013308 Bacteria 5583
213 Ga0157375_10027578 3300013308 Bacteria 5310
214 Ga0157375_10062918 3300013308 Bacteria 3689
215 Ga0163163_10000057 3300014325 Bacteria 124939
216 Ga0163163_10002802 3300014325 Bacteria 14739
217 Ga0157380_10394486 3300014326 Bacteria 1311
218 Ga0157377_10000352 3300014745 Bacteria 20440
219 Ga0157377_10011392 3300014745 Bacteria 4437
220 Ga0157379_10002270 3300014968 Bacteria 16018
221 Ga0157379_10058309 3300014968 Bacteria 3452
222 Ga0157379_10090699 3300014968 Bacteria 2742
223 Ga0157379_10093991 3300014968 Bacteria 2690
224 Ga0157379_10195112 3300014968 Unclassified 1830
225 Ga0157376_10002490 3300014969 Bacteria 12466
226 Ga0157376_10013118 3300014969 Bacteria 6172
227 Ga0157376_10058516 3300014969 Bacteria 3228
228 Ga0157376_10203026 3300014969 Bacteria 1825
229 Ga0163161_10008346 3300017792 Bacteria 7169
230 Ga0163161_10011052 3300017792 Bacteria 6252
231 Ga0209673_1000081 3300025273 Bacteria 220762
232 Ga0209564_1008595 3300025295 Bacteria 5011
233 Ga0209758_1019664 3300025297 Bacteria 3242
234 Ga0209050_1000453 3300025298 Bacteria 73731
235 Ga0207426_1000945 3300025302 Bacteria 28723
236 Ga0209257_1016737 3300025304 Bacteria 2943
237 Ga0207656_10053339 3300025321 Bacteria 1754
238 Ga0207642_10012595 3300025899 Bacteria 3059
239 Ga0207710_10148935 3300025900 Bacteria 1134
240 Ga0207680_10014007 3300025903 Unclassified 4135
241 Ga0207680_10050480 3300025903 Unclassified 2482
242 Ga0207647_10011301 3300025904 Bacteria 6268
243 Ga0207645_10001693 3300025907 Bacteria 17908
244 Ga0207645_10030626 3300025907 Bacteria 3467
245 Ga0207705_10000015 3300025909 Bacteria 382901
246 Ga0207705_10007316 3300025909 Bacteria 8118
247 Ga0207654_10002006 3300025911 Bacteria 10470
248 Ga0207707_10000467 3300025912 Bacteria 41919
249 Ga0207707_10166969 3300025912 Bacteria 1923
250 Ga0207695_10008701 3300025913 Bacteria 12661
251 Ga0207660_10003739 3300025917 Bacteria 9912
252 Ga0207660_10136274 3300025917 Unclassified 1873
253 Ga0207662_10147176 3300025918 Bacteria 1496
254 Ga0207657_10002499 3300025919 Bacteria 19882
255 Ga0207657_10013990 3300025919 Bacteria 7851
256 Ga0207657_10074392 3300025919 Bacteria 2869
257 Ga0207649_10031428 3300025920 Bacteria 3155
258 Ga0207649_10060436 3300025920 Bacteria 2381
259 Ga0207649_10142977 3300025920 Bacteria 1639
260 Ga0207652_10004566 3300025921 Bacteria 11227
261 Ga0207652_10062094 3300025921 Bacteria 3228
262 Ga0207681_10014751 3300025923 Bacteria 4864
263 Ga0207650_10118160 3300025925 Bacteria 2061
264 Ga0207650_10170977 3300025925 Unclassified 1727
265 Ga0207659_10018509 3300025926 Unclassified 4567
266 Ga0207659_10109895 3300025926 Bacteria 2094
267 Ga0207659_10349107 3300025926 Bacteria 1227
268 Ga0207644_10016517 3300025931 Bacteria 4966
269 Ga0207644_10019690 3300025931 Bacteria 4582
270 Ga0207644_10104635 3300025931 Bacteria 2131
271 Ga0207706_10001406 3300025933 Bacteria 24080
272 Ga0207706_10005694 3300025933 Bacteria 11607
273 Ga0207706_10007780 3300025933 Bacteria 9893
274 Ga0207706_10066769 3300025933 Unclassified 3165
275 Ga0207670_10004871 3300025936 Bacteria 7298
276 Ga0207670_10008766 3300025936 Bacteria 5728
277 Ga0207670_10132121 3300025936 Bacteria 1830
278 Ga0207704_10053289 3300025938 Unclassified 2458
279 Ga0207691_10000060 3300025940 Bacteria 86844
280 Ga0207691_10049411 3300025940 Bacteria 3854
281 Ga0207691_10067063 3300025940 Bacteria 3245
282 Ga0207691_10250059 3300025940 Unclassified 1530
283 Ga0207689_10000997 3300025942 Bacteria 27157
284 Ga0207689_10021425 3300025942 Bacteria 5433
285 Ga0207689_10033719 3300025942 Bacteria 4253
286 Ga0207689_10038242 3300025942 Unclassified 3976
287 Ga0207689_10096531 3300025942 Bacteria 2427
288 Ga0207661_10023636 3300025944 Bacteria 4646
289 Ga0207679_10004646 3300025945 Bacteria 8547
290 Ga0207679_10036987 3300025945 Unclassified 3467
291 Ga0207679_10068133 3300025945 Bacteria 2672
292 Ga0207667_10000030 3300025949 Bacteria 327226
293 Ga0207667_10030756 3300025949 Bacteria 5802
294 Ga0207667_10042574 3300025949 Bacteria 4826
295 Ga0207667_10332981 3300025949 Unclassified 1550
296 Ga0207651_10001029 3300025960 Bacteria 12322
297 Ga0207651_10020836 3300025960 Bacteria 3968
298 Ga0207651_10096397 3300025960 Bacteria 2181
299 Ga0207712_10049878 3300025961 Bacteria 2920
300 Ga0207712_10135361 3300025961 Bacteria 1883
301 Ga0207668_10000268 3300025972 Bacteria 34571
302 Ga0207640_10047665 3300025981 Bacteria 2765
303 Ga0207640_10077857 3300025981 Bacteria 2255
304 Ga0207658_10003441 3300025986 Bacteria 11197
305 Ga0207677_10005314 3300026023 Bacteria 6981
306 Ga0207677_10022168 3300026023 Bacteria 3898
307 Ga0207677_10152794 3300026023 Bacteria 1783
308 Ga0207703_10011677 3300026035 Bacteria 6830
309 Ga0207703_10057572 3300026035 Bacteria 3170
310 Ga0207639_10011218 3300026041 Bacteria 6216
311 Ga0207678_10167233 3300026067 Bacteria 1878
312 Ga0207702_10042758 3300026078 Bacteria 3802
313 Ga0207641_10057638 3300026088 Bacteria 3304
314 Ga0207641_10081125 3300026088 Unclassified 2816
315 Ga0207641_10099078 3300026088 Unclassified 2564
316 Ga0207641_10170962 3300026088 Bacteria 1984
317 Ga0207648_10006023 3300026089 Bacteria 12095
318 Ga0207648_10021491 3300026089 Bacteria 5800
319 Ga0207648_10033706 3300026089 Bacteria 4516
320 Ga0207648_10235022 3300026089 Bacteria 1631
321 Ga0207676_10003485 3300026095 Bacteria 11138
322 Ga0207676_10063243 3300026095 Bacteria 2939
323 Ga0207674_10002401 3300026116 Bacteria 23635
324 Ga0207674_10004911 3300026116 Bacteria 15991
325 Ga0207674_10014802 3300026116 Bacteria 8603
326 Ga0207674_10169322 3300026116 Bacteria 2138
327 Ga0207674_10205429 3300026116 Bacteria 1919
328 Ga0207675_100000208 3300026118 Bacteria 54772
329 Ga0207675_100065143 3300026118 Bacteria 3406
330 Ga0207683_10019775 3300026121 Bacteria 5752
331 Ga0207683_10039429 3300026121 Bacteria 4121
332 Ga0207698_10168708 3300026142 Bacteria 1925
333 Ga0207428_10038646 3300027907 Bacteria 3879
334 Ga0268266_10004562 3300028379 Bacteria 13235
335 Ga0268266_10046424 3300028379 Bacteria 3719
336 Ga0268265_10018087 3300028380 Bacteria 4880
337 Ga0268265_10038478 3300028380 Bacteria 3519
338 Ga0268265_10086947 3300028380 Bacteria 2486
339 Ga0268265_10206066 3300028380 Bacteria 1710
340 Ga0268264_10002154 3300028381 Bacteria 17553
341 Ga0268264_10017470 3300028381 Bacteria 5874
342 Ga0268264_10035722 3300028381 Bacteria 4092
343 Ga0268264_10053532 3300028381 Unclassified 3367
344 Ga0268264_10212470 3300028381 Bacteria 1777
345 Ga0307416_100524219 3300032002 Bacteria 1254
346 Ga0307414_10132899 3300032004 Bacteria 1935
347 Ga0373934_0085676 3300035086 Bacteria 1268
348 Ga0373955_0079078 3300035172 Bacteria 1854
349 Ga0373924_0035565 3300035410 Bacteria 2021
350 Ga0400489_59839 3300039093 Bacteria 1552
351 Ga0439434_0031699 3300042435 Bacteria 1608
352 Ga0451577_0000686 3300042876 Bacteria 53267
353 Ga0453684_0064821 3300044712 Unclassified 4663
354 Ga0451576_0388866 3300045051 Unclassified 1462
355 Ga0495653_0126461 3300046463 Bacteria 1815
356 Ga0495580_0176292 3300046472 Bacteria 1477
357 Ga0495630_0144898 3300046517 Bacteria 1806
358 Ga0495586_0084227 3300046535 Bacteria 1750
359 Ga0495634_0055881 3300046642 Bacteria 2639
360 Ga0495657_0064241 3300046675 Bacteria 2419
361 Ga0495604_0124946 3300047317 Bacteria 1857
362 Ga0495674_0287997 3300047319 Bacteria 1344
363 Ga0496104_0168573 3300048907 Unclassified 2100
364 Ga0496108_0061907 3300048911 Unclassified 3151
365 Ga0496110_0146404 3300048913 Bacteria 2137
366 Ga0496110_0378650 3300048913 Unclassified 1290
367 Ga0496114_0158807 3300048917 Bacteria 1964
368 Ga0501034_0028359 3300049571 Bacteria 5696
369 Ga0501034_0154596 3300049571 Bacteria 2268
370 Ga0501036_0248238 3300049572 Bacteria 1492
371 Ga0501037_0016463 3300049573 Bacteria 5442
372 Ga0501038_0043686 3300049574 Bacteria 3896
373 Ga0501043_0036372 3300049579 Bacteria 3873
374 Ga0501043_0458348 3300049579 Bacteria 957
375 Ga0501047_0020810 3300049581 Bacteria 6302
376 Ga0501198_000803 3300049649 Unclassified 3896
377 Ga0501217_000901 3300049661 Bacteria 5305
378 Ga0501224_000201 3300049664 Bacteria 6820
379 Ga0501235_000314 3300049669 Bacteria 9198
380 Ga0501242_000630 3300049674 Bacteria 3205
381 Ga0501221_000593 3300049704 Bacteria 5771
382 Ga0501245_000366 3300049708 Bacteria 5410
383 Ga0501035_0041102 3300049822 Bacteria 4176
384 Ga0501044_0035922 3300049823 Bacteria 5186
385 Ga0500604_0059499 3300053151 Unclassified 1197
386 Ga0500622_0005060 3300053156 Bacteria 8027
387 2910247258 2910245624 Bacteria 6935613
388 2929181641 2929177148 Bacteria 7883697
389 2929926365 2929921140 Bacteria 8649150
390 2945984058 2945977869 Bacteria 7777518
391 2946016550 2946013367 Bacteria 7766675
392 8003151758 8003151029 Bacteria 8187759
393 rootH2_10133022
394 MRS1b_contig_2010402
395 JGI24740J21852_10000312
396 JGI24743J22301_10007663
397 JGI25406J46586_10000891
398 JGI25160J50197_1002337
399 Ga0055528_1000229
400 Ga0055530_10001596
401 Ga0065165_1000172
402 Ga0065712_10150886
403 Ga0065707_10092956
404 Ga0070658_10000011
405 Ga0070658_10003851
406 Ga0070658_10037265
407 Ga0070658_10109335
408 Ga0070676_10001451
409 Ga0070676_10030566
410 Ga0070683_100005257
411 Ga0070683_100088941
412 Ga0070683_100099467
413 Ga0070690_100023900
414 Ga0070690_100040195
415 Ga0070670_100063130
416 Ga0070670_100147160
417 Ga0070670_100264448
418 Ga0068869_100008557
419 Ga0068869_100097154
420 Ga0070666_10000719
421 Ga0070666_10040867
422 Ga0070680_100001175
423 Ga0070682_100000703
424 Ga0070682_100030153
425 Ga0068868_100001748
426 Ga0068868_100003085
427 Ga0068868_100010636
428 Ga0068868_100157231
429 Ga0070660_100006442
430 Ga0070660_100008685
431 Ga0070660_100079002
432 Ga0070689_100018563
433 Ga0070689_100021943
434 Ga0070689_100049427
435 Ga0070689_100191434
436 Ga0070689_100209739
437 Ga0070691_10002407
438 Ga0070687_100091464
439 Ga0070661_100024947
440 Ga0070661_100064597
441 Ga0070661_100077997
442 Ga0070668_100000669
443 Ga0070669_100001088
444 Ga0070675_100010821
445 Ga0070675_100036954
446 Ga0070675_100149251
447 Ga0070671_100025688
448 Ga0070671_100026628
449 Ga0070671_100075177
450 Ga0070671_100202987
451 Ga0070674_100202638
452 Ga0070673_100001852
453 Ga0070673_100008333
454 Ga0070673_100226469
455 Ga0070688_100001871
456 Ga0070659_100064912
457 Ga0070659_100129400
458 Ga0070667_100010999
459 Ga0070667_100101638
460 Ga0070667_100189777
461 Ga0070663_100148386
462 Ga0070678_100003373
463 Ga0070678_100117896
464 Ga0070678_100186363
465 Ga0070662_100001982
466 Ga0070662_100018813
467 Ga0070662_100028063
468 Ga0070681_10093567
469 Ga0070679_100016786
470 Ga0070679_100065166
471 Ga0070679_100327148
472 Ga0070684_100004276
473 Ga0070684_100004313
474 Ga0070684_100021937
475 Ga0068853_100002260
476 Ga0068853_100018397
477 Ga0068853_100021158
478 Ga0068853_100129173
479 Ga0068853_100158634
480 Ga0070672_100004140
481 Ga0070672_100025270
482 Ga0070672_100171304
483 Ga0070672_100330928
484 Ga0070686_100074750
485 Ga0070686_100076165
486 Ga0070665_100005135
487 Ga0070665_100175646
488 Ga0068855_100000121
489 Ga0068855_100014975
490 Ga0068855_100019919
491 Ga0068855_100070024
492 Ga0068855_100167076
493 Ga0070664_100018651
494 Ga0070664_100052102
495 Ga0070664_100058291
496 Ga0070664_100065119
497 Ga0068857_100063438
498 Ga0068857_100073058
499 Ga0068854_100091189
500 Ga0068854_100135278
501 Ga0068856_100002816
502 Ga0068856_100023989
503 Ga0068852_100019568
504 Ga0068852_100024981
505 Ga0068852_100240471
506 Ga0068859_100052646
507 Ga0068859_100062976
508 Ga0068859_100066270
509 Ga0068859_100268766
510 Ga0068864_100000176
511 Ga0068864_100005255
512 Ga0068864_100016350
513 Ga0068864_100143557
514 Ga0068864_100207017
515 Ga0068866_10077038
516 Ga0068861_100002646
517 Ga0068861_100039739
518 Ga0068851_10065597
519 Ga0068870_10009688
520 Ga0068863_100005795
521 Ga0068858_100004328
522 Ga0068858_100109022
523 Ga0068858_100170381
524 Ga0068858_100246619
525 Ga0068858_100374797
526 Ga0068860_100003756
527 Ga0068860_100004115
528 Ga0068860_100004932
529 Ga0068860_100006898
530 Ga0068860_100011396
531 Ga0068860_100020351
532 Ga0068862_100003796
533 Ga0068862_100005073
534 Ga0068862_100026442
535 Ga0068862_100062274
536 Ga0081539_10001586
537 Ga0081539_10018196
538 Ga0097621_100004344
539 Ga0097621_100006083
540 Ga0097621_100007645
541 Ga0097621_100056050
542 Ga0068871_100001313
543 Ga0068871_100003743
544 Ga0068871_100312604
545 Ga0068865_100062011
546 Ga0097620_100052647
547 Ga0097620_100062979
548 Ga0097620_100066273
549 Ga0097620_100268765
550 Ga0105240_10002682
551 Ga0111539_10002054
552 Ga0111539_10692951
553 Ga0105247_10092763
554 Ga0105241_10000299
555 Ga0105241_10014350
556 Ga0105241_10069614
557 Ga0105241_10073694
558 Ga0105241_10172445
559 Ga0105242_10017191
560 Ga0105242_10035633
561 Ga0105248_10020834
562 Ga0105237_10056237
563 Ga0105237_10063629
564 Ga0105249_10006690
565 Ga0105249_10040707
566 Ga0105239_10002508
567 Ga0105239_10067038
568 Ga0105239_10284403
569 Ga0105239_10429912
570 Ga0157373_10003359
571 Ga0157373_10020785
572 Ga0157371_10010982
573 Ga0157370_10015823
574 Ga0157370_10243068
575 Ga0157369_10002893
576 Ga0157374_10005898
577 Ga0157374_10012926
578 Ga0157374_10064625
579 Ga0157374_10108488
580 Ga0157374_10515283
581 Ga0157378_10008286
582 Ga0157378_10024305
583 Ga0157378_10100874
584 Ga0157378_10150044
585 Ga0157378_10183289
586 Ga0163162_10002155
587 Ga0163162_10016689
588 Ga0163162_10023987
589 Ga0163162_10026373
590 Ga0163162_10113615
591 Ga0163162_10163424
592 Ga0163162_10165544
593 Ga0163162_10251820
594 Ga0163162_10374809
595 Ga0157372_10101616
596 Ga0157372_10103712
597 Ga0157372_10123552
598 Ga0157372_10293118
599 Ga0157375_10001259
600 Ga0157375_10001857
601 Ga0157375_10003488
602 Ga0157375_10003884
603 Ga0157375_10004091
604 Ga0157375_10024534
605 Ga0157375_10027578
606 Ga0157375_10062918
607 Ga0163163_10000057
608 Ga0163163_10002802
609 Ga0157380_10394486
610 Ga0157377_10000352
611 Ga0157377_10011392
612 Ga0157379_10002270
613 Ga0157379_10058309
614 Ga0157379_10090699
615 Ga0157379_10093991
616 Ga0157379_10195112
617 Ga0157376_10002490
618 Ga0157376_10013118
619 Ga0157376_10058516
620 Ga0157376_10203026
621 Ga0163161_10008346
622 Ga0163161_10011052
623 Ga0209673_1000081
624 Ga0209564_1008595
625 Ga0209758_1019664
626 Ga0209050_1000453
627 Ga0207426_1000945
628 Ga0209257_1016737
629 Ga0207656_10053339
630 Ga0207642_10012595
631 Ga0207710_10148935
632 Ga0207680_10014007
633 Ga0207680_10050480
634 Ga0207647_10011301
635 Ga0207645_10001693
636 Ga0207645_10030626
637 Ga0207705_10000015
638 Ga0207705_10007316
639 Ga0207654_10002006
640 Ga0207707_10000467
641 Ga0207707_10166969
642 Ga0207695_10008701
643 Ga0207660_10003739
644 Ga0207660_10136274
645 Ga0207662_10147176
646 Ga0207657_10002499
647 Ga0207657_10013990
648 Ga0207657_10074392
649 Ga0207649_10031428
650 Ga0207649_10060436
651 Ga0207649_10142977
652 Ga0207652_10004566
653 Ga0207652_10062094
654 Ga0207681_10014751
655 Ga0207650_10118160
656 Ga0207650_10170977
657 Ga0207659_10018509
658 Ga0207659_10109895
659 Ga0207659_10349107
660 Ga0207644_10016517
661 Ga0207644_10019690
662 Ga0207644_10104635
663 Ga0207706_10001406
664 Ga0207706_10005694
665 Ga0207706_10007780
666 Ga0207706_10066769
667 Ga0207670_10004871
668 Ga0207670_10008766
669 Ga0207670_10132121
670 Ga0207704_10053289
671 Ga0207691_10000060
672 Ga0207691_10049411
673 Ga0207691_10067063
674 Ga0207691_10250059
675 Ga0207689_10000997
676 Ga0207689_10021425
677 Ga0207689_10033719
678 Ga0207689_10038242
679 Ga0207689_10096531
680 Ga0207661_10023636
681 Ga0207679_10004646
682 Ga0207679_10036987
683 Ga0207679_10068133
684 Ga0207667_10000030
685 Ga0207667_10030756
686 Ga0207667_10042574
687 Ga0207667_10332981
688 Ga0207651_10001029
689 Ga0207651_10020836
690 Ga0207651_10096397
691 Ga0207712_10049878
692 Ga0207712_10135361
693 Ga0207668_10000268
694 Ga0207640_10047665
695 Ga0207640_10077857
696 Ga0207658_10003441
697 Ga0207677_10005314
698 Ga0207677_10022168
699 Ga0207677_10152794
700 Ga0207703_10011677
701 Ga0207703_10057572
702 Ga0207639_10011218
703 Ga0207678_10167233
704 Ga0207702_10042758
705 Ga0207641_10057638
706 Ga0207641_10081125
707 Ga0207641_10099078
708 Ga0207641_10170962
709 Ga0207648_10006023
710 Ga0207648_10021491
711 Ga0207648_10033706
712 Ga0207648_10235022
713 Ga0207676_10003485
714 Ga0207676_10063243
715 Ga0207674_10002401
716 Ga0207674_10004911
717 Ga0207674_10014802
718 Ga0207674_10169322
719 Ga0207674_10205429
720 Ga0207675_100000208
721 Ga0207675_100065143
722 Ga0207683_10019775
723 Ga0207683_10039429
724 Ga0207698_10168708
725 Ga0207428_10038646
726 Ga0268266_10004562
727 Ga0268266_10046424
728 Ga0268265_10018087
729 Ga0268265_10038478
730 Ga0268265_10086947
731 Ga0268265_10206066
732 Ga0268264_10002154
733 Ga0268264_10017470
734 Ga0268264_10035722
735 Ga0268264_10053532
736 Ga0268264_10212470
737 Ga0307416_100524219
738 Ga0307414_10132899
739 Ga0373934_0085676
740 Ga0373955_0079078
741 Ga0373924_0035565
742 Ga0400489_59839
743 Ga0439434_0031699
744 Ga0451577_0000686
745 Ga0453684_0064821
746 Ga0451576_0388866
747 Ga0495653_0126461
748 Ga0495580_0176292
749 Ga0495630_0144898
750 Ga0495586_0084227
751 Ga0495634_0055881
752 Ga0495657_0064241
753 Ga0495604_0124946
754 Ga0495674_0287997
755 Ga0496104_0168573
756 Ga0496108_0061907
757 Ga0496110_0146404
758 Ga0496110_0378650
759 Ga0496114_0158807
760 Ga0501034_0028359
761 Ga0501034_0154596
762 Ga0501036_0248238
763 Ga0501037_0016463
764 Ga0501038_0043686
765 Ga0501043_0036372
766 Ga0501043_0458348
767 Ga0501047_0020810
768 Ga0501198_000803
769 Ga0501217_000901
770 Ga0501224_000201
771 Ga0501235_000314
772 Ga0501242_000630
773 Ga0501221_000593
774 Ga0501245_000366
775 Ga0501035_0041102
776 Ga0501044_0035922
777 Ga0500604_0059499
778 Ga0500622_0005060
779 2910247258
780 2929181641
781 2929926365
782 2945984058
783 2946016550
784 8003151758

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

95

408

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3irs-assembly1.cif.gz_B crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica 0.6717 54 363
3irs-assembly1.cif.gz_B crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica 0.6563 54 363
8hkr-assembly1.cif.gz_A crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis 0.6459 228 271
6cu3-assembly3.cif.gz_C crystal structure of a protein arginine n-methyltransferase from naegleria fowleri 0.6141 52 113
3khj-assembly1.cif.gz_B c. parvum inosine monophosphate dehydrogenase bound by inhibitor c64 0.6071 58 248
ID Description Score Start End Superfamily
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7701 63 364 3.20.20.140
af_A0A0R0KUU2_4_202_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7099 92 300 3.20.20.140
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7096 63 364 3.20.20.140
3cjpA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7083 54 364 3.20.20.140
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7032 55 364 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A848ZVM6-F1-model_v4 Amidohydrolase family protein 0.9769 78 362 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A848ZVM6-F1-model_v4 Amidohydrolase family protein 0.9701 78 362 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A512B6E7-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9575 27 364 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-X1KDI9-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9529 29 280 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A512B6E7-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9519 27 364 GO:0005737
GO:0016787
GO:0016831
GO:0019748

Map