F432448

General Info

Members Datasets Scaffolds Average Seq Length
392 242 391 65

Family's Representative Sequence

Representative Sequence 3300053140|Ga0500573_0231856|Ga0500573_0231856_131_334
Length 67
Sequence MPKQKTHSGAKKRFKVTGSGKIMKQSAGMRHNLEKKSSEVTRRLNQDQTLAPSDAKGVKKLLGKYGK

Samples

Sample ID Description Type Environment
1 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
69 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
83 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
130 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
133 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
158 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.96
Metatranscriptomes 1.79
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.38
Nodule 0
Rhizoplane 10.2
Rhizosphere 80.1
Stem 0
Stem Tuber 0
Unclassified 3.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10004171 3300002459 Bacteria 2931
2 Ga0070683_100073285 3300005329 Bacteria 3198
3 Ga0070690_100159838 3300005330 Bacteria 1543
4 Ga0070677_10000413 3300005333 Bacteria 14782
5 Ga0070682_100000093 3300005337 Bacteria 81568
6 Ga0070682_100048425 3300005337 Bacteria 2646
7 Ga0068868_100000445 3300005338 Bacteria 27750
8 Ga0068868_100481533 3300005338 Bacteria 1084
9 Ga0068868_102282449 3300005338 Bacteria 516
10 Ga0070660_101399702 3300005339 Bacteria 594
11 Ga0070689_100034705 3300005340 Bacteria 3849
12 Ga0070668_100026874 3300005347 Bacteria 4369
13 Ga0070675_100734939 3300005354 Bacteria 900
14 Ga0070674_100088000 3300005356 Bacteria 2234
15 Ga0070688_100495909 3300005365 Unclassified 920
16 Ga0070667_100001327 3300005367 Bacteria 22217
17 Ga0070667_101166602 3300005367 Bacteria 721
18 Ga0070703_10298454 3300005406 Bacteria 671
19 Ga0070701_10049276 3300005438 Bacteria 2177
20 Ga0070711_100011596 3300005439 Bacteria 5478
21 Ga0070711_100287136 3300005439 Bacteria 1304
22 Ga0070705_100353244 3300005440 Bacteria 1072
23 Ga0070705_101299515 3300005440 Bacteria 603
24 Ga0070694_100820231 3300005444 Bacteria 764
25 Ga0070708_100554338 3300005445 Bacteria 1084
26 Ga0070678_101228648 3300005456 Bacteria 696
27 Ga0070662_100000006 3300005457 Bacteria 169366
28 Ga0070685_10299630 3300005466 Bacteria 1083
29 Ga0070706_100939493 3300005467 Bacteria 798
30 Ga0070698_100639302 3300005471 Bacteria 1005
31 Ga0070698_101101299 3300005471 Bacteria 743
32 Ga0070699_101426029 3300005518 Bacteria 635
33 Ga0070679_100708282 3300005530 Bacteria 950
34 Ga0070684_100446177 3300005535 Bacteria 1196
35 Ga0070684_100563639 3300005535 Bacteria 1058
36 Ga0068853_102042269 3300005539 Bacteria 556
37 Ga0070695_100211738 3300005545 Bacteria 1392
38 Ga0070695_100539396 3300005545 Bacteria 908
39 Ga0070695_101455039 3300005545 Bacteria 569
40 Ga0070696_100685701 3300005546 Bacteria 834
41 Ga0070696_100858215 3300005546 Bacteria 751
42 Ga0070665_100348512 3300005548 Bacteria 1486
43 Ga0070665_100457359 3300005548 Bacteria 1286
44 Ga0070704_100440500 3300005549 Bacteria 1120
45 Ga0070704_102093518 3300005549 Bacteria 526
46 Ga0068854_101138622 3300005578 Bacteria 697
47 Ga0068856_100440358 3300005614 Bacteria 1324
48 Ga0068856_100818650 3300005614 Bacteria 951
49 Ga0070702_100663886 3300005615 Bacteria 790
50 Ga0068866_10993587 3300005718 Bacteria 596
51 Ga0068866_11233676 3300005718 Unclassified 541
52 Ga0068851_10100255 3300005834 Bacteria 1536
53 Ga0068858_102342198 3300005842 Bacteria 528
54 Ga0068862_100004149 3300005844 Bacteria 12276
55 Ga0081455_10009454 3300005937 Bacteria 10028
56 Ga0081455_10025792 3300005937 Bacteria 5419
57 Ga0081455_10336533 3300005937 Bacteria 1070
58 Ga0081538_10000002 3300005981 Bacteria 242010
59 Ga0075365_10016297 3300006038 Bacteria 4517
60 Ga0075365_10079464 3300006038 Bacteria 2219
61 Ga0075365_10085201 3300006038 Bacteria 2146
62 Ga0075365_10451917 3300006038 Bacteria 907
63 Ga0075365_10570310 3300006038 Bacteria 800
64 Ga0075363_100194976 3300006048 Bacteria 1156
65 Ga0075364_10221371 3300006051 Bacteria 1284
66 Ga0075364_10414888 3300006051 Bacteria 919
67 Ga0075364_10804950 3300006051 Unclassified 640
68 Ga0070715_10312433 3300006163 Bacteria 845
69 Ga0070716_100391194 3300006173 Unclassified 997
70 Ga0070712_100646320 3300006175 Unclassified 898
71 Ga0075367_10131342 3300006178 Bacteria 1548
72 Ga0075367_10206416 3300006178 Bacteria 1228
73 Ga0075367_10697535 3300006178 Bacteria 646
74 Ga0097621_101065413 3300006237 Unclassified 758
75 Ga0068871_100309327 3300006358 Bacteria 1389
76 Ga0068871_100946697 3300006358 Bacteria 800
77 Ga0075430_100306266 3300006846 Bacteria 1314
78 Ga0075431_100558182 3300006847 Unclassified 1132
79 Ga0075433_10580051 3300006852 Bacteria 985
80 Ga0075434_100193981 3300006871 Bacteria 2051
81 Ga0075434_100420993 3300006871 Bacteria 1357
82 Ga0075434_101981990 3300006871 Bacteria 588
83 Ga0068865_101026704 3300006881 Bacteria 723
84 Ga0075436_100962535 3300006914 Unclassified 640
85 Ga0075436_101127732 3300006914 Bacteria 591
86 Ga0075436_101489416 3300006914 Bacteria 514
87 Ga0105244_10291418 3300009036 Bacteria 756
88 Ga0111539_10336004 3300009094 Bacteria 1758
89 Ga0111539_12022421 3300009094 Bacteria 668
90 Ga0111539_12157165 3300009094 Bacteria 646
91 Ga0105245_10000143 3300009098 Bacteria 67618
92 Ga0105245_10055949 3300009098 Bacteria 3545
93 Ga0105245_10491819 3300009098 Unclassified 1241
94 Ga0105247_11690529 3300009101 Bacteria 523
95 Ga0114129_10641529 3300009147 Bacteria 1372
96 Ga0114129_10729804 3300009147 Bacteria 1270
97 Ga0105243_10984532 3300009148 Unclassified 845
98 Ga0105243_11069138 3300009148 Bacteria 813
99 Ga0105243_11731823 3300009148 Bacteria 655
100 Ga0105242_10279058 3300009176 Bacteria 1517
101 Ga0105248_10796579 3300009177 Bacteria 1067
102 Ga0105238_10000048 3300009551 Bacteria 146322
103 Ga0105249_10000070 3300009553 Bacteria 147277
104 Ga0105249_10024574 3300009553 Bacteria 5416
105 Ga0105249_10228852 3300009553 Bacteria 1833
106 Ga0105249_11303999 3300009553 Bacteria 798
107 Ga0105033_112647 3300009986 Bacteria 749
108 Ga0105035_104127 3300009988 Bacteria 1145
109 Ga0105239_11246827 3300010375 Bacteria 857
110 Ga0105239_13283960 3300010375 Bacteria 526
111 Ga0157313_1046159 3300012503 Bacteria 552
112 Ga0157374_10002572 3300013296 Bacteria 15292
113 Ga0157374_10789482 3300013296 Unclassified 965
114 Ga0157378_10305656 3300013297 Bacteria 1541
115 Ga0163162_10508945 3300013306 Bacteria 1334
116 Ga0163162_12187712 3300013306 Bacteria 635
117 Ga0157375_10128788 3300013308 Bacteria 2649
118 Ga0157375_11383640 3300013308 Bacteria 829
119 Ga0163163_10215435 3300014325 Bacteria 1969
120 Ga0163163_10616273 3300014325 Bacteria 1149
121 Ga0157380_12098361 3300014326 Bacteria 628
122 Ga0157377_10438922 3300014745 Bacteria 898
123 Ga0157379_10053835 3300014968 Bacteria 3596
124 Ga0157379_11302141 3300014968 Unclassified 702
125 Ga0157376_10478249 3300014969 Bacteria 1220
126 Ga0157376_12130436 3300014969 Bacteria 599
127 Ga0163161_10449081 3300017792 Bacteria 1042
128 Ga0206355_1025272 3300020076 Bacteria 1008
129 Ga0206355_1637660 3300020076 Bacteria 507
130 Ga0206354_10089471 3300020081 Bacteria 716
131 Ga0213876_10036671 3300021384 Bacteria 2586
132 Ga0213875_10074736 3300021388 Bacteria 1581
133 Ga0207697_10330388 3300025315 Bacteria 677
134 Ga0207653_10398051 3300025885 Bacteria 540
135 Ga0207682_10000408 3300025893 Bacteria 19761
136 Ga0207685_10852282 3300025905 Unclassified 505
137 Ga0207684_10723456 3300025910 Bacteria 845
138 Ga0207693_10001442 3300025915 Bacteria 21056
139 Ga0207663_10007602 3300025916 Bacteria 5628
140 Ga0207663_10961475 3300025916 Bacteria 684
141 Ga0207646_10848894 3300025922 Bacteria 812
142 Ga0207659_11061035 3300025926 Unclassified 697
143 Ga0207687_10020967 3300025927 Bacteria 4338
144 Ga0207687_10349377 3300025927 Bacteria 1204
145 Ga0207706_10000017 3300025933 Bacteria 169589
146 Ga0207709_10184730 3300025935 Bacteria 1475
147 Ga0207669_11953970 3300025937 Bacteria 501
148 Ga0207704_10420465 3300025938 Bacteria 1059
149 Ga0207704_11817177 3300025938 Bacteria 524
150 Ga0207665_10170470 3300025939 Bacteria 1571
151 Ga0207711_10434043 3300025941 Bacteria 1222
152 Ga0207661_10089580 3300025944 Bacteria 2560
153 Ga0207712_10012661 3300025961 Bacteria 5390
154 Ga0207712_10060307 3300025961 Bacteria 2689
155 Ga0207668_10016787 3300025972 Bacteria 4577
156 Ga0207668_11454067 3300025972 Unclassified 618
157 Ga0207640_11280868 3300025981 Bacteria 654
158 Ga0207658_10005122 3300025986 Bacteria 9026
159 Ga0207677_10000299 3300026023 Bacteria 37042
160 Ga0207677_10314703 3300026023 Bacteria 1298
161 Ga0207703_10241021 3300026035 Bacteria 1625
162 Ga0207639_10721456 3300026041 Bacteria 926
163 Ga0207648_10543159 3300026089 Bacteria 1067
164 Ga0207675_100724998 3300026118 Bacteria 1004
165 Ga0207675_101485085 3300026118 Bacteria 698
166 Ga0207683_10162210 3300026121 Bacteria 2021
167 Ga0207683_12140184 3300026121 Bacteria 508
168 Ga0268266_12097428 3300028379 Unclassified 538
169 Ga0268265_10003909 3300028380 Bacteria 10504
170 Ga0268265_10118604 3300028380 Bacteria 2176
171 Ga0268264_10544202 3300028381 Bacteria 1138
172 Ga0268264_12211540 3300028381 Unclassified 558
173 Ga0265327_10464019 3300031251 Bacteria 547
174 Ga0307406_10828333 3300031901 Bacteria 783
175 Ga0307406_10913219 3300031901 Bacteria 748
176 Ga0307409_100241049 3300031995 Bacteria 1646
177 Ga0307416_100089226 3300032002 Bacteria 2639
178 Ga0307416_101290674 3300032002 Bacteria 836
179 Ga0307414_11288276 3300032004 Bacteria 678
180 Ga0373946_0409452 3300035171 Bacteria 686
181 Ga0373962_0199481 3300035242 Bacteria 677
182 Ga0373933_0179296 3300035724 Bacteria 1351
183 Ga0373947_0232857 3300035725 Bacteria 1214
184 Ga0436364_1029426 3300037853 Bacteria 2926
185 Ga0436365_1413912 3300039437 Bacteria 8761
186 Ga0436365_1482571 3300039437 Bacteria 710
187 Ga0436363_0927148 3300039450 Bacteria 670
188 Ga0436363_1111990 3300039450 Bacteria 1956
189 Ga0436362_0719752 3300039453 Bacteria 5248
190 Ga0436362_1233701 3300039453 Bacteria 504
191 Ga0451791_1375121 3300041451 Bacteria 740
192 Ga0451837_1385598 3300041494 Bacteria 887
193 Ga0451837_1474113 3300041494 Unclassified 537
194 Ga0451853_0893560 3300041512 Bacteria 1048
195 Ga0451853_1742991 3300041512 Bacteria 857
196 Ga0439459_0122774 3300042438 Bacteria 657
197 Ga0466969_0086879 3300044656 Bacteria 1485
198 Ga0466970_0159822 3300044765 Bacteria 1246
199 Ga0466960_0333373 3300044901 Bacteria 862
200 Ga0466960_0552301 3300044901 Bacteria 679
201 Ga0466959_0007719 3300045049 Bacteria 7559
202 Ga0466958_1079494 3300045836 Bacteria 524
203 Ga0466967_0273616 3300045976 Bacteria 1619
204 Ga0495592_0027224 3300046454 Bacteria 4335
205 Ga0495603_0502359 3300046455 Bacteria 694
206 Ga0495629_0315841 3300046459 Bacteria 1068
207 Ga0495629_0686643 3300046459 Bacteria 680
208 Ga0495641_0094927 3300046461 Bacteria 1332
209 Ga0495651_0307021 3300046462 Bacteria 1062
210 Ga0495651_0320283 3300046462 Bacteria 1034
211 Ga0495653_0016152 3300046463 Bacteria 6083
212 Ga0495580_0988621 3300046472 Bacteria 537
213 Ga0495582_0121598 3300046473 Bacteria 1471
214 Ga0495639_0052899 3300046475 Bacteria 1849
215 Ga0495594_0142797 3300046499 Bacteria 1358
216 Ga0495610_0039553 3300046512 Bacteria 2384
217 Ga0495618_0137830 3300046514 Bacteria 1561
218 Ga0495628_0044680 3300046516 Bacteria 3523
219 Ga0495644_0001780 3300046523 Bacteria 8694
220 Ga0495644_0415966 3300046523 Bacteria 533
221 Ga0495666_0398057 3300046526 Bacteria 619
222 Ga0495652_0015700 3300046529 Bacteria 6778
223 Ga0495586_0001338 3300046535 Bacteria 13685
224 Ga0495587_0780811 3300046536 Bacteria 522
225 Ga0495598_0014741 3300046537 Bacteria 1959
226 Ga0495621_0065989 3300046539 Bacteria 1323
227 Ga0495645_0139797 3300046543 Bacteria 1690
228 Ga0495633_0169466 3300046558 Bacteria 1006
229 Ga0495625_0000453 3300046660 Bacteria 61379
230 Ga0495599_0648619 3300046678 Bacteria 612
231 Ga0495623_0170750 3300046679 Bacteria 1270
232 Ga0495623_0245959 3300046679 Bacteria 1008
233 Ga0495623_0325566 3300046679 Bacteria 843
234 Ga0495623_0530716 3300046679 Bacteria 618
235 Ga0495646_0555032 3300046680 Bacteria 586
236 Ga0495646_0672748 3300046680 Bacteria 522
237 Ga0495647_0000009 3300046681 Bacteria 94874
238 Ga0495647_0129553 3300046681 Bacteria 1068
239 Ga0495624_0000414 3300046690 Bacteria 33832
240 Ga0495624_0658316 3300046690 Bacteria 623
241 Ga0495670_0150708 3300046691 Bacteria 1219
242 Ga0495581_0127178 3300047315 Bacteria 1484
243 Ga0495676_0115388 3300047321 Bacteria 1964
244 Ga0495676_0147618 3300047321 Bacteria 1678
245 Ga0495676_0291430 3300047321 Bacteria 1103
246 Ga0495602_0036869 3300048088 Bacteria 4545
247 Ga0495602_0214527 3300048088 Bacteria 1458
248 Ga0495614_0094438 3300048089 Bacteria 1303
249 Ga0496100_0260508 3300048903 Bacteria 1286
250 Ga0496100_0361604 3300048903 Bacteria 1098
251 Ga0496100_0480845 3300048903 Bacteria 955
252 Ga0496101_0116686 3300048904 Bacteria 2014
253 Ga0496101_0677209 3300048904 Bacteria 815
254 Ga0496102_0031580 3300048905 Bacteria 4752
255 Ga0496102_0235348 3300048905 Bacteria 1727
256 Ga0496102_0735560 3300048905 Bacteria 909
257 Ga0496103_0040565 3300048906 Bacteria 2860
258 Ga0496103_0166597 3300048906 Bacteria 1414
259 Ga0496103_0483639 3300048906 Bacteria 793
260 Ga0496104_0001134 3300048907 Bacteria 22797
261 Ga0496104_0008804 3300048907 Bacteria 8971
262 Ga0496105_0000101 3300048908 Bacteria 58062
263 Ga0496105_0117514 3300048908 Bacteria 2193
264 Ga0496106_0185112 3300048909 Bacteria 1654
265 Ga0496106_0239190 3300048909 Bacteria 1451
266 Ga0496107_0114331 3300048910 Bacteria 1985
267 Ga0496107_0485237 3300048910 Bacteria 917
268 Ga0496107_1292198 3300048910 Bacteria 522
269 Ga0496108_0042143 3300048911 Bacteria 3811
270 Ga0496108_1236792 3300048911 Bacteria 630
271 Ga0496109_0022799 3300048912 Bacteria 5548
272 Ga0496109_0205899 3300048912 Bacteria 1850
273 Ga0496109_0885819 3300048912 Bacteria 830
274 Ga0496109_1404873 3300048912 Bacteria 633
275 Ga0496110_0007496 3300048913 Bacteria 8721
276 Ga0496110_0474419 3300048913 Bacteria 1140
277 Ga0496110_0826126 3300048913 Bacteria 831
278 Ga0496111_0071699 3300048914 Bacteria 2521
279 Ga0496111_0510248 3300048914 Bacteria 884
280 Ga0496112_0000013 3300048915 Bacteria 237194
281 Ga0496112_0118335 3300048915 Bacteria 2619
282 Ga0496113_0014073 3300048916 Bacteria 5445
283 Ga0496113_0081431 3300048916 Bacteria 2481
284 Ga0496113_0896793 3300048916 Bacteria 701
285 Ga0496114_0002456 3300048917 Bacteria 14155
286 Ga0496114_0006057 3300048917 Bacteria 9518
287 Ga0496115_0144299 3300048918 Bacteria 1964
288 Ga0496116_0245039 3300048919 Bacteria 897
289 Ga0501308_065303 3300049128 Bacteria 557
290 Ga0501317_068429 3300049533 Bacteria 595
291 Ga0501321_038365 3300049537 Bacteria 665
292 Ga0501031_0747362 3300049568 Bacteria 627
293 Ga0501031_0885532 3300049568 Bacteria 572
294 Ga0501032_0019590 3300049569 Bacteria 4730
295 Ga0501033_0542022 3300049570 Bacteria 802
296 Ga0501034_0380356 3300049571 Bacteria 1337
297 Ga0501034_0617636 3300049571 Bacteria 988
298 Ga0501036_0031131 3300049572 Bacteria 4508
299 Ga0501037_0081561 3300049573 Bacteria 2345
300 Ga0501038_0216088 3300049574 Bacteria 1532
301 Ga0501039_0038828 3300049575 Bacteria 3676
302 Ga0501039_1576911 3300049575 Bacteria 504
303 Ga0501040_0172758 3300049576 Bacteria 1530
304 Ga0501040_0415280 3300049576 Bacteria 967
305 Ga0501041_0006142 3300049577 Bacteria 7019
306 Ga0501041_0578901 3300049577 Bacteria 716
307 Ga0501042_0013998 3300049578 Bacteria 5467
308 Ga0501042_0547030 3300049578 Bacteria 841
309 Ga0501043_0969656 3300049579 Bacteria 606
310 Ga0501043_1009065 3300049579 Bacteria 592
311 Ga0501046_0044029 3300049580 Bacteria 3551
312 Ga0501047_0235110 3300049581 Bacteria 1684
313 Ga0501048_0073533 3300049582 Bacteria 2412
314 Ga0501067_0461267 3300049583 Bacteria 710
315 Ga0501068_0029383 3300049584 Bacteria 3254
316 Ga0501068_0089781 3300049584 Bacteria 1895
317 Ga0501068_0426258 3300049584 Bacteria 857
318 Ga0501068_0565192 3300049584 Bacteria 740
319 Ga0501068_0597075 3300049584 Bacteria 719
320 Ga0501069_0045471 3300049585 Bacteria 2433
321 Ga0501069_0265867 3300049585 Bacteria 1002
322 Ga0501069_0601305 3300049585 Bacteria 660
323 Ga0501070_0074002 3300049586 Bacteria 2819
324 Ga0501070_0775056 3300049586 Bacteria 754
325 Ga0501070_1129829 3300049586 Bacteria 603
326 Ga0501071_0115672 3300049587 Bacteria 1985
327 Ga0501071_0221326 3300049587 Bacteria 1424
328 Ga0501072_0016304 3300049588 Bacteria 5700
329 Ga0501072_0101631 3300049588 Bacteria 2285
330 Ga0501072_0700351 3300049588 Bacteria 796
331 Ga0501073_0077894 3300049589 Bacteria 2307
332 Ga0501073_1083411 3300049589 Bacteria 551
333 Ga0501074_0018198 3300049590 Bacteria 5104
334 Ga0501074_0092513 3300049590 Bacteria 2165
335 Ga0501074_0406618 3300049590 Bacteria 965
336 Ga0501074_0584060 3300049590 Bacteria 790
337 Ga0501075_0134484 3300049591 Bacteria 1883
338 Ga0501076_0075230 3300049592 Bacteria 2706
339 Ga0501076_0704176 3300049592 Bacteria 834
340 Ga0501077_0121813 3300049593 Bacteria 1653
341 Ga0501253_087254 3300049683 Bacteria 713
342 Ga0501079_0007641 3300049741 Bacteria 8189
343 Ga0501079_0423853 3300049741 Bacteria 1045
344 Ga0501080_0103813 3300049742 Bacteria 2636
345 Ga0501080_0357942 3300049742 Bacteria 1317
346 Ga0501080_1182299 3300049742 Bacteria 658
347 Ga0501081_0018878 3300049743 Bacteria 4582
348 Ga0501081_0395703 3300049743 Bacteria 1022
349 Ga0501083_0177702 3300049744 Bacteria 1390
350 Ga0501083_0215829 3300049744 Bacteria 1250
351 Ga0501035_0308195 3300049822 Bacteria 1332
352 Ga0501045_0460140 3300049824 Bacteria 945
353 Ga0501045_0869897 3300049824 Bacteria 663
354 nmdc:mga03n38_170378_c1 3300050490 Unclassified 1108
355 nmdc:mga00v17_122625_c1 3300050491 Bacteria 1656
356 nmdc:mga00v17_362173_c1 3300050491 Bacteria 943
357 nmdc:mga00v17_690362_c1 3300050491 Bacteria 655
358 nmdc:mga00v17_872791_c1 3300050491 Bacteria 571
359 nmdc:mga0yw44_140518_c1 3300050492 Bacteria 1569
360 nmdc:mga0yw44_199041_c1 3300050492 Bacteria 1323
361 nmdc:mga0yw44_54178_c1 3300050492 Bacteria 2437
362 nmdc:mga06z11_169323_c1 3300050494 Bacteria 1253
363 nmdc:mga06z11_812535_c1 3300050494 Bacteria 570
364 nmdc:mga07m45_553266_c1 3300050496 Bacteria 665
365 nmdc:mga05p37_1831332_c1 3300050507 Bacteria 584
366 nmdc:mga05p37_2247293_c1 3300050507 Bacteria 504
367 nmdc:mga05p37_303467_c1 3300050507 Bacteria 1896
368 nmdc:mga0qj67_155893_c1 3300050509 Bacteria 1853
369 nmdc:mga08y16_1835795_c1 3300050511 Bacteria 558
370 nmdc:mga08y16_556608_c1 3300050511 Bacteria 1160
371 nmdc:mga0n895_281191_c1 3300050512 Bacteria 1687
372 nmdc:mga0n895_465470_c1 3300050512 Bacteria 1276
373 nmdc:mga08x19_1297623_c1 3300050514 Bacteria 516
374 nmdc:mga08x19_767007_c1 3300050514 Unclassified 685
375 nmdc:mga0a205_1382231_c1 3300050515 Bacteria 552
376 nmdc:mga0a205_802018_c1 3300050515 Bacteria 789
377 Ga0495601_0005548 3300053077 Bacteria 7359
378 Ga0495601_0039148 3300053077 Bacteria 2968
379 Ga0495612_0335290 3300053078 Bacteria 681
380 Ga0500573_0085904 3300053140 Bacteria 1783
381 Ga0500573_0231856 3300053140 Bacteria 962
382 Ga0501084_0104034 3300054114 Bacteria 2384
383 Ga0501084_0359647 3300054114 Bacteria 1230
384 Ga0501084_1653586 3300054114 Bacteria 535
385 Ga0587111_0244801 3300060346 Bacteria 528
386 Ga0501082_0034430 3300060353 Bacteria 4367
387 Ga0501082_0393701 3300060353 Bacteria 1209
388 Ga0501082_0659342 3300060353 Bacteria 916
389 Ga0501082_1683439 3300060353 Bacteria 554
390 Ga0530510_0022147 3300061734 Bacteria 4525
391 Ga0530510_0684721 3300061734 Bacteria 781

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2857737099 2857738630 60
2 3300005330 Ga0070690_100159838 Ga0070690_1001598383 63
3 3300005337 Ga0070682_100000093 Ga0070682_10000009316 63
4 3300005337 Ga0070682_100048425 Ga0070682_1000484253 63
5 3300005338 Ga0068868_100481533 Ga0068868_1004815333 63
6 3300005339 Ga0070660_101399702 Ga0070660_1013997021 63
7 3300005340 Ga0070689_100034705 Ga0070689_1000347054 63
8 3300005354 Ga0070675_100734939 Ga0070675_1007349391 63
9 3300005356 Ga0070674_100088000 Ga0070674_1000880003 63
10 3300005365 Ga0070688_100495909 Ga0070688_1004959091 63
11 3300005367 Ga0070667_101166602 Ga0070667_1011666022 63
12 3300005406 Ga0070703_10298454 Ga0070703_102984542 63
13 3300005438 Ga0070701_10049276 Ga0070701_100492763 63
14 3300005439 Ga0070711_100287136 Ga0070711_1002871362 63
15 3300005440 Ga0070705_101299515 Ga0070705_1012995151 63
16 3300005445 Ga0070708_100554338 Ga0070708_1005543382 63
17 3300005456 Ga0070678_101228648 Ga0070678_1012286482 63
18 3300005466 Ga0070685_10299630 Ga0070685_102996302 63
19 3300005467 Ga0070706_100939493 Ga0070706_1009394932 63
20 3300005530 Ga0070679_100708282 Ga0070679_1007082822 63
21 3300005535 Ga0070684_100563639 Ga0070684_1005636391 63
22 3300005545 Ga0070695_100211738 Ga0070695_1002117382 63
23 3300005548 Ga0070665_100348512 Ga0070665_1003485122 63
24 3300005549 Ga0070704_100440500 Ga0070704_1004405002 63
25 3300005578 Ga0068854_101138622 Ga0068854_1011386222 63
26 3300005614 Ga0068856_100440358 Ga0068856_1004403582 63
27 3300005614 Ga0068856_100818650 Ga0068856_1008186502 63
28 3300005718 Ga0068866_11233676 Ga0068866_112336761 63
29 3300005842 Ga0068858_102342198 Ga0068858_1023421982 63
30 3300006038 Ga0075365_10016297 Ga0075365_100162973 63
31 3300006038 Ga0075365_10570310 Ga0075365_105703102 63
32 3300006051 Ga0075364_10414888 Ga0075364_104148882 63
33 3300006163 Ga0070715_10312433 Ga0070715_103124332 63
34 3300006173 Ga0070716_100391194 Ga0070716_1003911943 63
35 3300006175 Ga0070712_100646320 Ga0070712_1006463202 63
36 3300006178 Ga0075367_10206416 Ga0075367_102064162 63
37 3300006237 Ga0097621_101065413 Ga0097621_1010654132 63
38 3300006358 Ga0068871_100946697 Ga0068871_1009466971 63
39 3300006847 Ga0075431_100558182 Ga0075431_1005581822 63
40 3300006871 Ga0075434_101981990 Ga0075434_1019819902 63
41 3300006914 Ga0075436_100962535 Ga0075436_1009625352 63
42 3300009098 Ga0105245_10000143 Ga0105245_1000014358 63
43 3300009098 Ga0105245_10055949 Ga0105245_100559495 63
44 3300009177 Ga0105248_10796579 Ga0105248_107965793 63
45 3300009551 Ga0105238_10000048 Ga0105238_1000004867 63
46 3300009553 Ga0105249_10000070 Ga0105249_1000007083 63
47 3300013296 Ga0157374_10789482 Ga0157374_107894822 63
48 3300013297 Ga0157378_10305656 Ga0157378_103056562 63
49 3300013308 Ga0157375_10128788 Ga0157375_101287882 63
50 3300014325 Ga0163163_10616273 Ga0163163_106162733 63
51 3300014745 Ga0157377_10438922 Ga0157377_104389223 63
52 3300014968 Ga0157379_11302141 Ga0157379_113021412 63
53 3300014969 Ga0157376_10478249 Ga0157376_104782493 63
54 3300025885 Ga0207653_10398051 Ga0207653_103980512 63
55 3300025905 Ga0207685_10852282 Ga0207685_108522822 63
56 3300025910 Ga0207684_10723456 Ga0207684_107234562 63
57 3300025915 Ga0207693_10001442 Ga0207693_1000144220 63
58 3300025916 Ga0207663_10961475 Ga0207663_109614752 63
59 3300025926 Ga0207659_11061035 Ga0207659_110610352 63
60 3300025927 Ga0207687_10020967 Ga0207687_100209673 63
61 3300025939 Ga0207665_10170470 Ga0207665_101704703 63
62 3300025941 Ga0207711_10434043 Ga0207711_104340433 63
63 3300025972 Ga0207668_11454067 Ga0207668_114540672 63
64 3300025981 Ga0207640_11280868 Ga0207640_112808681 63
65 3300026023 Ga0207677_10314703 Ga0207677_103147032 63
66 3300026041 Ga0207639_10721456 Ga0207639_107214563 63
67 3300026118 Ga0207675_100724998 Ga0207675_1007249982 63
68 3300026121 Ga0207683_10162210 Ga0207683_101622102 63
69 3300028379 Ga0268266_12097428 Ga0268266_120974281 63
70 3300032002 Ga0307416_101290674 Ga0307416_1012906742 63
71 3300035171 Ga0373946_0409452 Ga0373946_0409452_272_466 63
72 3300035725 Ga0373947_0232857 Ga0373947_0232857_232_426 63
73 3300039437 Ga0436365_1482571 Ga0436365_1482571_213_410 63
74 3300041512 Ga0451853_0893560 Ga0451853_0893560_761_955 63
75 3300045976 Ga0466967_0273616 Ga0466967_0273616_656_856 63
76 3300046455 Ga0495603_0502359 Ga0495603_0502359_157_351 63
77 3300046472 Ga0495580_0988621 Ga0495580_0988621_78_272 63
78 3300046473 Ga0495582_0121598 Ga0495582_0121598_967_1161 63
79 3300046499 Ga0495594_0142797 Ga0495594_0142797_218_412 63
80 3300046523 Ga0495644_0415966 Ga0495644_0415966_327_521 63
81 3300046526 Ga0495666_0398057 Ga0495666_0398057_323_517 63
82 3300046681 Ga0495647_0129553 Ga0495647_0129553_741_935 63
83 3300046690 Ga0495624_0658316 Ga0495624_0658316_390_584 63
84 3300047315 Ga0495581_0127178 Ga0495581_0127178_513_707 63
85 3300047321 Ga0495676_0147618 Ga0495676_0147618_1213_1407 63
86 3300048089 Ga0495614_0094438 Ga0495614_0094438_359_553 63
87 3300048903 Ga0496100_0361604 Ga0496100_0361604_568_762 63
88 3300048904 Ga0496101_0116686 Ga0496101_0116686_1658_1852 63
89 3300048905 Ga0496102_0031580 Ga0496102_0031580_2257_2451 63
90 3300048906 Ga0496103_0040565 Ga0496103_0040565_2205_2399 63
91 3300048907 Ga0496104_0008804 Ga0496104_0008804_4782_4976 63
92 3300048908 Ga0496105_0117514 Ga0496105_0117514_1592_1786 63
93 3300048909 Ga0496106_0185112 Ga0496106_0185112_43_237 63
94 3300048910 Ga0496107_0114331 Ga0496107_0114331_566_760 63
95 3300048911 Ga0496108_0042143 Ga0496108_0042143_917_1111 63
96 3300048912 Ga0496109_0022799 Ga0496109_0022799_4788_4982 63
97 3300048912 Ga0496109_0885819 Ga0496109_0885819_351_545 63
98 3300048913 Ga0496110_0007496 Ga0496110_0007496_2594_2788 63
99 3300048913 Ga0496110_0826126 Ga0496110_0826126_310_504 63
100 3300048914 Ga0496111_0071699 Ga0496111_0071699_2017_2211 63
101 3300048914 Ga0496111_0510248 Ga0496111_0510248_311_505 63
102 3300048915 Ga0496112_0118335 Ga0496112_0118335_1284_1478 63
103 3300048916 Ga0496113_0081431 Ga0496113_0081431_306_500 63
104 3300048917 Ga0496114_0002456 Ga0496114_0002456_11678_11872 63
105 3300048918 Ga0496115_0144299 Ga0496115_0144299_422_616 63
106 3300050491 nmdc:mga00v17_362173_c1 nmdc:mga00v17_362173_c1_310_504 63
107 3300050492 nmdc:mga0yw44_54178_c1 nmdc:mga0yw44_54178_c1_1182_1376 63
108 3300050494 nmdc:mga06z11_812535_c1 nmdc:mga06z11_812535_c1_323_517 63
109 3300050514 nmdc:mga08x19_767007_c1 nmdc:mga08x19_767007_c1_122_316 63
110 3300009986 Ga0105033_112647 Ga0105033_1126471 64
111 3300009988 Ga0105035_104127 Ga0105035_1041272 64
112 3300012503 Ga0157313_1046159 Ga0157313_10461591 64
113 3300014326 Ga0157380_12098361 Ga0157380_120983612 64
114 3300020076 Ga0206355_1025272 Ga0206355_10252721 64
115 3300020076 Ga0206355_1637660 Ga0206355_16376601 64
116 3300020081 Ga0206354_10089471 Ga0206354_100894712 64
117 3300031251 Ga0265327_10464019 Ga0265327_104640192 64
118 3300041494 Ga0451837_1385598 Ga0451837_1385598_257_451 64
119 3300042438 Ga0439459_0122774 Ga0439459_0122774_348_542 64
120 3300048917 Ga0496114_0006057 Ga0496114_0006057_7189_7383 64
121 3300049128 Ga0501308_065303 Ga0501308_065303_64_258 64
122 3300049533 Ga0501317_068429 Ga0501317_068429_109_303 64
123 3300049537 Ga0501321_038365 Ga0501321_038365_337_531 64
124 3300049568 Ga0501031_0885532 Ga0501031_0885532_52_246 64
125 3300049569 Ga0501032_0019590 Ga0501032_0019590_3301_3495 64
126 3300049570 Ga0501033_0542022 Ga0501033_0542022_421_615 64
127 3300049571 Ga0501034_0380356 Ga0501034_0380356_289_483 64
128 3300049572 Ga0501036_0031131 Ga0501036_0031131_866_1060 64
129 3300049573 Ga0501037_0081561 Ga0501037_0081561_1319_1513 64
130 3300049574 Ga0501038_0216088 Ga0501038_0216088_401_595 64
131 3300049575 Ga0501039_0038828 Ga0501039_0038828_2159_2353 64
132 3300049576 Ga0501040_0172758 Ga0501040_0172758_1013_1207 64
133 3300049577 Ga0501041_0006142 Ga0501041_0006142_1782_1976 64
134 3300049578 Ga0501042_0013998 Ga0501042_0013998_3088_3282 64
135 3300049579 Ga0501043_0969656 Ga0501043_0969656_202_396 64
136 3300049580 Ga0501046_0044029 Ga0501046_0044029_1082_1276 64
137 3300049582 Ga0501048_0073533 Ga0501048_0073533_1810_2004 64
138 3300049584 Ga0501068_0029383 Ga0501068_0029383_587_781 64
139 3300049585 Ga0501069_0265867 Ga0501069_0265867_423_617 64
140 3300049586 Ga0501070_0775056 Ga0501070_0775056_305_499 64
141 3300049587 Ga0501071_0221326 Ga0501071_0221326_714_908 64
142 3300049588 Ga0501072_0016304 Ga0501072_0016304_5004_5198 64
143 3300049590 Ga0501074_0018198 Ga0501074_0018198_3347_3541 64
144 3300049591 Ga0501075_0134484 Ga0501075_0134484_859_1053 64
145 3300049592 Ga0501076_0075230 Ga0501076_0075230_1929_2123 64
146 3300049593 Ga0501077_0121813 Ga0501077_0121813_1058_1252 64
147 3300049741 Ga0501079_0007641 Ga0501079_0007641_4674_4868 64
148 3300049742 Ga0501080_0357942 Ga0501080_0357942_278_472 64
149 3300049743 Ga0501081_0018878 Ga0501081_0018878_4176_4370 64
150 3300049744 Ga0501083_0215829 Ga0501083_0215829_356_550 64
151 3300049822 Ga0501035_0308195 Ga0501035_0308195_417_611 64
152 3300049824 Ga0501045_0460140 Ga0501045_0460140_305_499 64
153 3300054114 Ga0501084_0104034 Ga0501084_0104034_1651_1845 64
154 3300060346 Ga0587111_0244801 Ga0587111_0244801_46_240 64
155 3300060353 Ga0501082_0034430 Ga0501082_0034430_884_1078 64
156 3300061734 Ga0530510_0022147 Ga0530510_0022147_3318_3512 64
157 3300005347 Ga0070668_100026874 Ga0070668_1000268745 65
158 3300005367 Ga0070667_100001327 Ga0070667_10000132710 65
159 3300005548 Ga0070665_100457359 Ga0070665_1004573592 65
160 3300005844 Ga0068862_100004149 Ga0068862_1000041498 65
161 3300006038 Ga0075365_10085201 Ga0075365_100852011 65
162 3300006038 Ga0075365_10451917 Ga0075365_104519172 65
163 3300006051 Ga0075364_10221371 Ga0075364_102213712 65
164 3300006051 Ga0075364_10804950 Ga0075364_108049502 65
165 3300006178 Ga0075367_10697535 Ga0075367_106975352 65
166 3300009553 Ga0105249_10024574 Ga0105249_100245742 65
167 3300014968 Ga0157379_10053835 Ga0157379_100538354 65
168 3300017792 Ga0163161_10449081 Ga0163161_104490812 65
169 3300025922 Ga0207646_10848894 Ga0207646_108488942 65
170 3300025961 Ga0207712_10012661 Ga0207712_100126612 65
171 3300025972 Ga0207668_10016787 Ga0207668_100167872 65
172 3300025986 Ga0207658_10005122 Ga0207658_100051224 65
173 3300026035 Ga0207703_10241021 Ga0207703_102410213 65
174 3300028380 Ga0268265_10003909 Ga0268265_100039098 65
175 3300041451 Ga0451791_1375121 Ga0451791_1375121_256_453 65
176 3300041494 Ga0451837_1474113 Ga0451837_1474113_219_416 65
177 3300041512 Ga0451853_1742991 Ga0451853_1742991_414_611 65
178 3300044901 Ga0466960_0333373 Ga0466960_0333373_313_510 65
179 3300046660 Ga0495625_0000453 Ga0495625_0000453_38667_38864 65
180 3300048913 Ga0496110_0474419 Ga0496110_0474419_642_839 65
181 3300048919 Ga0496116_0245039 Ga0496116_0245039_666_863 65
182 3300049589 Ga0501073_1083411 Ga0501073_1083411_236_433 65
183 3300049742 Ga0501080_1182299 Ga0501080_1182299_251_448 65
184 3300050490 nmdc:mga03n38_170378_c1 nmdc:mga03n38_170378_c1_701_910 65
185 3300050491 nmdc:mga00v17_122625_c1 nmdc:mga00v17_122625_c1_1197_1394 65
186 3300050492 nmdc:mga0yw44_199041_c1 nmdc:mga0yw44_199041_c1_1054_1251 65
187 3300050496 nmdc:mga07m45_553266_c1 nmdc:mga07m45_553266_c1_112_309 65
188 3300060353 Ga0501082_1683439 Ga0501082_1683439_181_378 65
189 3300002459 JGI24751J29686_10004171 JGI24751J29686_100041714 66
190 3300005329 Ga0070683_100073285 Ga0070683_1000732853 66
191 3300005333 Ga0070677_10000413 Ga0070677_1000041317 66
192 3300005338 Ga0068868_100000445 Ga0068868_1000004456 66
193 3300005338 Ga0068868_102282449 Ga0068868_1022824492 66
194 3300005439 Ga0070711_100011596 Ga0070711_1000115962 66
195 3300005440 Ga0070705_100353244 Ga0070705_1003532442 66
196 3300005444 Ga0070694_100820231 Ga0070694_1008202312 66
197 3300005457 Ga0070662_100000006 Ga0070662_10000000699 66
198 3300005471 Ga0070698_100639302 Ga0070698_1006393022 66
199 3300005471 Ga0070698_101101299 Ga0070698_1011012992 66
200 3300005518 Ga0070699_101426029 Ga0070699_1014260292 66
201 3300005535 Ga0070684_100446177 Ga0070684_1004461772 66
202 3300005539 Ga0068853_102042269 Ga0068853_1020422691 66
203 3300005545 Ga0070695_100539396 Ga0070695_1005393961 66
204 3300005545 Ga0070695_101455039 Ga0070695_1014550392 66
205 3300005546 Ga0070696_100685701 Ga0070696_1006857013 66
206 3300005546 Ga0070696_100858215 Ga0070696_1008582152 66
207 3300005549 Ga0070704_102093518 Ga0070704_1020935182 66
208 3300005615 Ga0070702_100663886 Ga0070702_1006638861 66
209 3300005718 Ga0068866_10993587 Ga0068866_109935871 66
210 3300005834 Ga0068851_10100255 Ga0068851_101002553 66
211 3300005937 Ga0081455_10009454 Ga0081455_1000945414 66
212 3300005937 Ga0081455_10025792 Ga0081455_100257925 66
213 3300005937 Ga0081455_10336533 Ga0081455_103365333 66
214 3300005981 Ga0081538_10000002 Ga0081538_10000002169 66
215 3300006038 Ga0075365_10079464 Ga0075365_100794642 66
216 3300006048 Ga0075363_100194976 Ga0075363_1001949762 66
217 3300006178 Ga0075367_10131342 Ga0075367_101313423 66
218 3300006358 Ga0068871_100309327 Ga0068871_1003093272 66
219 3300006846 Ga0075430_100306266 Ga0075430_1003062662 66
220 3300006852 Ga0075433_10580051 Ga0075433_105800512 66
221 3300006871 Ga0075434_100193981 Ga0075434_1001939813 66
222 3300006871 Ga0075434_100420993 Ga0075434_1004209932 66
223 3300006881 Ga0068865_101026704 Ga0068865_1010267042 66
224 3300006914 Ga0075436_101127732 Ga0075436_1011277322 66
225 3300006914 Ga0075436_101489416 Ga0075436_1014894161 66
226 3300009036 Ga0105244_10291418 Ga0105244_102914183 66
227 3300009094 Ga0111539_10336004 Ga0111539_103360043 66
228 3300009094 Ga0111539_12022421 Ga0111539_120224211 66
229 3300009094 Ga0111539_12157165 Ga0111539_121571652 66
230 3300009098 Ga0105245_10491819 Ga0105245_104918191 66
231 3300009101 Ga0105247_11690529 Ga0105247_116905292 66
232 3300009147 Ga0114129_10641529 Ga0114129_106415293 66
233 3300009147 Ga0114129_10729804 Ga0114129_107298043 66
234 3300009148 Ga0105243_10984532 Ga0105243_109845322 66
235 3300009148 Ga0105243_11069138 Ga0105243_110691382 66
236 3300009148 Ga0105243_11731823 Ga0105243_117318232 66
237 3300009176 Ga0105242_10279058 Ga0105242_102790583 66
238 3300009553 Ga0105249_10228852 Ga0105249_102288521 66
239 3300009553 Ga0105249_11303999 Ga0105249_113039992 66
240 3300010375 Ga0105239_11246827 Ga0105239_112468272 66
241 3300010375 Ga0105239_13283960 Ga0105239_132839601 66
242 3300013296 Ga0157374_10002572 Ga0157374_100025723 66
243 3300013306 Ga0163162_10508945 Ga0163162_105089452 66
244 3300013306 Ga0163162_12187712 Ga0163162_121877122 66
245 3300013308 Ga0157375_11383640 Ga0157375_113836402 66
246 3300014325 Ga0163163_10215435 Ga0163163_102154353 66
247 3300014969 Ga0157376_12130436 Ga0157376_121304362 66
248 3300021384 Ga0213876_10036671 Ga0213876_100366712 66
249 3300021388 Ga0213875_10074736 Ga0213875_100747362 66
250 3300025315 Ga0207697_10330388 Ga0207697_103303882 66
251 3300025893 Ga0207682_10000408 Ga0207682_100004084 66
252 3300025916 Ga0207663_10007602 Ga0207663_100076025 66
253 3300025927 Ga0207687_10349377 Ga0207687_103493772 66
254 3300025933 Ga0207706_10000017 Ga0207706_1000001799 66
255 3300025935 Ga0207709_10184730 Ga0207709_101847302 66
256 3300025937 Ga0207669_11953970 Ga0207669_119539702 66
257 3300025938 Ga0207704_10420465 Ga0207704_104204652 66
258 3300025938 Ga0207704_11817177 Ga0207704_118171772 66
259 3300025944 Ga0207661_10089580 Ga0207661_100895803 66
260 3300025961 Ga0207712_10060307 Ga0207712_100603073 66
261 3300026023 Ga0207677_10000299 Ga0207677_1000029917 66
262 3300026089 Ga0207648_10543159 Ga0207648_105431593 66
263 3300026118 Ga0207675_101485085 Ga0207675_1014850852 66
264 3300026121 Ga0207683_12140184 Ga0207683_121401842 66
265 3300028380 Ga0268265_10118604 Ga0268265_101186043 66
266 3300028381 Ga0268264_10544202 Ga0268264_105442023 66
267 3300028381 Ga0268264_12211540 Ga0268264_122115402 66
268 3300031901 Ga0307406_10828333 Ga0307406_108283332 66
269 3300031901 Ga0307406_10913219 Ga0307406_109132192 66
270 3300031995 Ga0307409_100241049 Ga0307409_1002410492 66
271 3300032002 Ga0307416_100089226 Ga0307416_1000892264 66
272 3300032004 Ga0307414_11288276 Ga0307414_112882762 66
273 3300035242 Ga0373962_0199481 Ga0373962_0199481_417_626 66
274 3300035724 Ga0373933_0179296 Ga0373933_0179296_319_519 66
275 3300037853 Ga0436364_1029426 Ga0436364_1029426_1619_1819 66
276 3300039437 Ga0436365_1413912 Ga0436365_1413912_5239_5439 66
277 3300039450 Ga0436363_0927148 Ga0436363_0927148_403_612 66
278 3300039450 Ga0436363_1111990 Ga0436363_1111990_853_1056 66
279 3300039453 Ga0436362_0719752 Ga0436362_0719752_1996_2196 66
280 3300039453 Ga0436362_1233701 Ga0436362_1233701_201_404 66
281 3300044656 Ga0466969_0086879 Ga0466969_0086879_294_497 66
282 3300044765 Ga0466970_0159822 Ga0466970_0159822_485_688 66
283 3300044901 Ga0466960_0552301 Ga0466960_0552301_330_530 66
284 3300045049 Ga0466959_0007719 Ga0466959_0007719_4168_4371 66
285 3300045836 Ga0466958_1079494 Ga0466958_1079494_141_344 66
286 3300046454 Ga0495592_0027224 Ga0495592_0027224_3908_4108 66
287 3300046459 Ga0495629_0315841 Ga0495629_0315841_567_767 66
288 3300046459 Ga0495629_0686643 Ga0495629_0686643_322_522 66
289 3300046461 Ga0495641_0094927 Ga0495641_0094927_961_1170 66
290 3300046462 Ga0495651_0307021 Ga0495651_0307021_476_676 66
291 3300046462 Ga0495651_0320283 Ga0495651_0320283_531_731 66
292 3300046463 Ga0495653_0016152 Ga0495653_0016152_2099_2299 66
293 3300046475 Ga0495639_0052899 Ga0495639_0052899_1533_1733 66
294 3300046512 Ga0495610_0039553 Ga0495610_0039553_678_878 66
295 3300046514 Ga0495618_0137830 Ga0495618_0137830_707_907 66
296 3300046516 Ga0495628_0044680 Ga0495628_0044680_1795_1995 66
297 3300046523 Ga0495644_0001780 Ga0495644_0001780_1178_1378 66
298 3300046529 Ga0495652_0015700 Ga0495652_0015700_1455_1655 66
299 3300046535 Ga0495586_0001338 Ga0495586_0001338_1363_1563 66
300 3300046536 Ga0495587_0780811 Ga0495587_0780811_211_411 66
301 3300046537 Ga0495598_0014741 Ga0495598_0014741_836_1036 66
302 3300046539 Ga0495621_0065989 Ga0495621_0065989_953_1153 66
303 3300046543 Ga0495645_0139797 Ga0495645_0139797_566_766 66
304 3300046558 Ga0495633_0169466 Ga0495633_0169466_51_251 66
305 3300046678 Ga0495599_0648619 Ga0495599_0648619_246_446 66
306 3300046679 Ga0495623_0170750 Ga0495623_0170750_403_603 66
307 3300046679 Ga0495623_0245959 Ga0495623_0245959_297_497 66
308 3300046679 Ga0495623_0325566 Ga0495623_0325566_437_637 66
309 3300046679 Ga0495623_0530716 Ga0495623_0530716_211_411 66
310 3300046680 Ga0495646_0555032 Ga0495646_0555032_297_497 66
311 3300046680 Ga0495646_0672748 Ga0495646_0672748_194_394 66
312 3300046681 Ga0495647_0000009 Ga0495647_0000009_46676_46876 66
313 3300046690 Ga0495624_0000414 Ga0495624_0000414_5156_5356 66
314 3300046691 Ga0495670_0150708 Ga0495670_0150708_978_1178 66
315 3300047321 Ga0495676_0115388 Ga0495676_0115388_1245_1445 66
316 3300047321 Ga0495676_0291430 Ga0495676_0291430_547_747 66
317 3300048088 Ga0495602_0036869 Ga0495602_0036869_2215_2415 66
318 3300048088 Ga0495602_0214527 Ga0495602_0214527_471_671 66
319 3300048903 Ga0496100_0260508 Ga0496100_0260508_1023_1223 66
320 3300048903 Ga0496100_0480845 Ga0496100_0480845_634_837 66
321 3300048904 Ga0496101_0677209 Ga0496101_0677209_478_681 66
322 3300048905 Ga0496102_0235348 Ga0496102_0235348_466_669 66
323 3300048905 Ga0496102_0735560 Ga0496102_0735560_38_241 66
324 3300048906 Ga0496103_0166597 Ga0496103_0166597_347_550 66
325 3300048906 Ga0496103_0483639 Ga0496103_0483639_425_625 66
326 3300048907 Ga0496104_0001134 Ga0496104_0001134_18825_19025 66
327 3300048908 Ga0496105_0000101 Ga0496105_0000101_44002_44202 66
328 3300048909 Ga0496106_0239190 Ga0496106_0239190_536_739 66
329 3300048910 Ga0496107_0485237 Ga0496107_0485237_452_655 66
330 3300048910 Ga0496107_1292198 Ga0496107_1292198_269_472 66
331 3300048911 Ga0496108_1236792 Ga0496108_1236792_288_491 66
332 3300048912 Ga0496109_0205899 Ga0496109_0205899_379_582 66
333 3300048912 Ga0496109_1404873 Ga0496109_1404873_11_211 66
334 3300048915 Ga0496112_0000013 Ga0496112_0000013_17995_18222 66
335 3300048916 Ga0496113_0014073 Ga0496113_0014073_5002_5202 66
336 3300048916 Ga0496113_0896793 Ga0496113_0896793_66_266 66
337 3300049568 Ga0501031_0747362 Ga0501031_0747362_184_384 66
338 3300049571 Ga0501034_0617636 Ga0501034_0617636_657_857 66
339 3300049575 Ga0501039_1576911 Ga0501039_1576911_271_474 66
340 3300049576 Ga0501040_0415280 Ga0501040_0415280_435_638 66
341 3300049577 Ga0501041_0578901 Ga0501041_0578901_486_689 66
342 3300049578 Ga0501042_0547030 Ga0501042_0547030_195_398 66
343 3300049579 Ga0501043_1009065 Ga0501043_1009065_48_251 66
344 3300049581 Ga0501047_0235110 Ga0501047_0235110_723_923 66
345 3300049583 Ga0501067_0461267 Ga0501067_0461267_421_621 66
346 3300049584 Ga0501068_0089781 Ga0501068_0089781_373_573 66
347 3300049584 Ga0501068_0426258 Ga0501068_0426258_473_676 66
348 3300049584 Ga0501068_0565192 Ga0501068_0565192_480_683 66
349 3300049584 Ga0501068_0597075 Ga0501068_0597075_423_623 66
350 3300049585 Ga0501069_0045471 Ga0501069_0045471_424_624 66
351 3300049585 Ga0501069_0601305 Ga0501069_0601305_362_565 66
352 3300049586 Ga0501070_0074002 Ga0501070_0074002_1246_1446 66
353 3300049586 Ga0501070_1129829 Ga0501070_1129829_184_384 66
354 3300049587 Ga0501071_0115672 Ga0501071_0115672_1733_1933 66
355 3300049588 Ga0501072_0101631 Ga0501072_0101631_1802_2002 66
356 3300049588 Ga0501072_0700351 Ga0501072_0700351_216_416 66
357 3300049589 Ga0501073_0077894 Ga0501073_0077894_1312_1512 66
358 3300049590 Ga0501074_0092513 Ga0501074_0092513_152_352 66
359 3300049590 Ga0501074_0406618 Ga0501074_0406618_148_348 66
360 3300049590 Ga0501074_0584060 Ga0501074_0584060_543_746 66
361 3300049592 Ga0501076_0704176 Ga0501076_0704176_141_347 66
362 3300049683 Ga0501253_087254 Ga0501253_087254_429_632 66
363 3300049741 Ga0501079_0423853 Ga0501079_0423853_474_674 66
364 3300049742 Ga0501080_0103813 Ga0501080_0103813_843_1043 66
365 3300049743 Ga0501081_0395703 Ga0501081_0395703_243_449 66
366 3300049744 Ga0501083_0177702 Ga0501083_0177702_763_963 66
367 3300049824 Ga0501045_0869897 Ga0501045_0869897_267_470 66
368 3300050491 nmdc:mga00v17_690362_c1 nmdc:mga00v17_690362_c1_306_512 66
369 3300050491 nmdc:mga00v17_872791_c1 nmdc:mga00v17_872791_c1_255_458 66
370 3300050492 nmdc:mga0yw44_140518_c1 nmdc:mga0yw44_140518_c1_602_805 66
371 3300050494 nmdc:mga06z11_169323_c1 nmdc:mga06z11_169323_c1_882_1085 66
372 3300050507 nmdc:mga05p37_1831332_c1 nmdc:mga05p37_1831332_c1_190_393 66
373 3300050507 nmdc:mga05p37_2247293_c1 nmdc:mga05p37_2247293_c1_33_236 66
374 3300050507 nmdc:mga05p37_303467_c1 nmdc:mga05p37_303467_c1_1080_1283 66
375 3300050509 nmdc:mga0qj67_155893_c1 nmdc:mga0qj67_155893_c1_544_747 66
376 3300050511 nmdc:mga08y16_1835795_c1 nmdc:mga08y16_1835795_c1_302_505 66
377 3300050511 nmdc:mga08y16_556608_c1 nmdc:mga08y16_556608_c1_202_405 66
378 3300050512 nmdc:mga0n895_281191_c1 nmdc:mga0n895_281191_c1_277_477 66
379 3300050512 nmdc:mga0n895_465470_c1 nmdc:mga0n895_465470_c1_202_405 66
380 3300050514 nmdc:mga08x19_1297623_c1 nmdc:mga08x19_1297623_c1_68_271 66
381 3300050515 nmdc:mga0a205_1382231_c1 nmdc:mga0a205_1382231_c1_144_347 66
382 3300050515 nmdc:mga0a205_802018_c1 nmdc:mga0a205_802018_c1_321_524 66
383 3300053077 Ga0495601_0005548 Ga0495601_0005548_6975_7175 66
384 3300053077 Ga0495601_0039148 Ga0495601_0039148_1165_1365 66
385 3300053078 Ga0495612_0335290 Ga0495612_0335290_197_397 66
386 3300053140 Ga0500573_0085904 Ga0500573_0085904_532_735 66
387 3300053140 Ga0500573_0231856 Ga0500573_0231856_131_334 66
388 3300054114 Ga0501084_0359647 Ga0501084_0359647_633_839 66
389 3300054114 Ga0501084_1653586 Ga0501084_1653586_167_370 66
390 3300060353 Ga0501082_0393701 Ga0501082_0393701_414_617 66
391 3300060353 Ga0501082_0659342 Ga0501082_0659342_493_693 66
392 3300061734 Ga0530510_0684721 Ga0530510_0684721_185_388 66

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01632

Ribosomal_L35p

Ribosomal protein L35

2

62

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xqe-assembly1.cif.gz_18 crystal structure of the thermus thermophilus 70s ribosome in complex with sarecycline, uaa-mrna, and deacylated p-site trna at 3.00a resolution 0.7265 2 62
4wqu-assembly1.cif.gz_A8 crystal structure of the thermus thermophilus 70s ribosome in complex with elongation factor g trapped by the antibiotic dityromycin 0.7207 2 63
6cae-assembly1.cif.gz_18 crystal structure of the thermus thermophilus 70s ribosome in complex with noso-95179 antibiotic and bound to mrna and a-, p- and e-site trnas at 2.6a resolution 0.7205 2 61
1vy7-assembly2.cif.gz_D8 crystal structure of the thermus thermophilus 70s ribosome in the pre-attack state of peptide bond formation containing short substrate-mimic cytidine-cytidine-puromycin in the a site and acylated trna in the p site. 0.7203 2 61
6ndk-assembly1.cif.gz_R8 structure of aslsufa6 a37.5 bound to the 70s a site 0.7156 2 62
ID Description Score Start End Superfamily
1vw4Z00 Few Secondary Structures;Irregular;Factor Xa Inhibitor; 0.692 4 61 4.10.410.60
4qs1800 Few Secondary Structures;Irregular;Factor Xa Inhibitor; 0.6459 2 62 4.10.410.60
1vw4Z00 Few Secondary Structures;Irregular;Factor Xa Inhibitor; 0.6403 4 61 4.10.410.60
3d5b800 Few Secondary Structures;Irregular;Factor Xa Inhibitor; 0.6394 2 63 4.10.410.60
4wfn300 Few Secondary Structures;Irregular;Factor Xa Inhibitor; 0.632 6 62 4.10.410.60
ID Description Score Start End GO Terms
AF-A0A2G2WAH3-F1-model_v4 50S ribosomal protein L35 0.8267 10 63 GO:0003735
GO:0005840
GO:0006412
GO:0031080
GO:1990904
AF-A0A136MXF5-F1-model_v4 Multifunctional fusion protein [Includes: Translation initiation factor IF-3; Large ribosomal subunit protein bL35] 0.8235 1 63 GO:0003735
GO:0003743
GO:0005829
GO:0005840
GO:0016020
GO:0032790
GO:0043022
GO:1990904
AF-A0A6L7Y510-F1-model_v4 50S ribosomal protein L35 0.7996 4 61 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7R9AID9-F1-model_v4 Large ribosomal subunit protein bL20c 0.788 1 63 GO:0003735
GO:0003743
GO:0005829
GO:0005840
GO:0016020
GO:0019843
GO:0032790
GO:0043022
GO:1990904
AF-A0A1R3HF44-F1-model_v4 50S ribosomal protein L35 0.7873 3 59 GO:0003735
GO:0005840
GO:0006412
GO:0031080
GO:1990904

Feature Viewer

pLDDT pTM Quality
86.06 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map