F432448
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 392 | 242 | 391 | 65 |
Family's Representative Sequence
| Representative Sequence | 3300053140|Ga0500573_0231856|Ga0500573_0231856_131_334 |
| Length | 67 |
| Sequence | MPKQKTHSGAKKRFKVTGSGKIMKQSAGMRHNLEKKSSEVTRRLNQDQTLAPSDAKGVKKLLGKYGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 42 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 43 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 44 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 45 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 46 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 69 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 83 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 85 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 86 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 117 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 118 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 119 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 120 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 121 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 122 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 123 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 124 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 125 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 126 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 127 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 128 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 129 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 130 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 131 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 132 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 133 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 134 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 135 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 136 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 137 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 138 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 139 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 174 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 175 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 176 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 177 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 178 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 179 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 180 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 183 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 184 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 185 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 186 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 187 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 188 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 189 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 219 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 226 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 227 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 228 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 229 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 230 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 239 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.96 |
| Metatranscriptomes | 1.79 |
| Isolates | 0.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.38 |
| Nodule | 0 |
| Rhizoplane | 10.2 |
| Rhizosphere | 80.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10004171 | 3300002459 | Bacteria | 2931 |
| 2 | Ga0070683_100073285 | 3300005329 | Bacteria | 3198 |
| 3 | Ga0070690_100159838 | 3300005330 | Bacteria | 1543 |
| 4 | Ga0070677_10000413 | 3300005333 | Bacteria | 14782 |
| 5 | Ga0070682_100000093 | 3300005337 | Bacteria | 81568 |
| 6 | Ga0070682_100048425 | 3300005337 | Bacteria | 2646 |
| 7 | Ga0068868_100000445 | 3300005338 | Bacteria | 27750 |
| 8 | Ga0068868_100481533 | 3300005338 | Bacteria | 1084 |
| 9 | Ga0068868_102282449 | 3300005338 | Bacteria | 516 |
| 10 | Ga0070660_101399702 | 3300005339 | Bacteria | 594 |
| 11 | Ga0070689_100034705 | 3300005340 | Bacteria | 3849 |
| 12 | Ga0070668_100026874 | 3300005347 | Bacteria | 4369 |
| 13 | Ga0070675_100734939 | 3300005354 | Bacteria | 900 |
| 14 | Ga0070674_100088000 | 3300005356 | Bacteria | 2234 |
| 15 | Ga0070688_100495909 | 3300005365 | Unclassified | 920 |
| 16 | Ga0070667_100001327 | 3300005367 | Bacteria | 22217 |
| 17 | Ga0070667_101166602 | 3300005367 | Bacteria | 721 |
| 18 | Ga0070703_10298454 | 3300005406 | Bacteria | 671 |
| 19 | Ga0070701_10049276 | 3300005438 | Bacteria | 2177 |
| 20 | Ga0070711_100011596 | 3300005439 | Bacteria | 5478 |
| 21 | Ga0070711_100287136 | 3300005439 | Bacteria | 1304 |
| 22 | Ga0070705_100353244 | 3300005440 | Bacteria | 1072 |
| 23 | Ga0070705_101299515 | 3300005440 | Bacteria | 603 |
| 24 | Ga0070694_100820231 | 3300005444 | Bacteria | 764 |
| 25 | Ga0070708_100554338 | 3300005445 | Bacteria | 1084 |
| 26 | Ga0070678_101228648 | 3300005456 | Bacteria | 696 |
| 27 | Ga0070662_100000006 | 3300005457 | Bacteria | 169366 |
| 28 | Ga0070685_10299630 | 3300005466 | Bacteria | 1083 |
| 29 | Ga0070706_100939493 | 3300005467 | Bacteria | 798 |
| 30 | Ga0070698_100639302 | 3300005471 | Bacteria | 1005 |
| 31 | Ga0070698_101101299 | 3300005471 | Bacteria | 743 |
| 32 | Ga0070699_101426029 | 3300005518 | Bacteria | 635 |
| 33 | Ga0070679_100708282 | 3300005530 | Bacteria | 950 |
| 34 | Ga0070684_100446177 | 3300005535 | Bacteria | 1196 |
| 35 | Ga0070684_100563639 | 3300005535 | Bacteria | 1058 |
| 36 | Ga0068853_102042269 | 3300005539 | Bacteria | 556 |
| 37 | Ga0070695_100211738 | 3300005545 | Bacteria | 1392 |
| 38 | Ga0070695_100539396 | 3300005545 | Bacteria | 908 |
| 39 | Ga0070695_101455039 | 3300005545 | Bacteria | 569 |
| 40 | Ga0070696_100685701 | 3300005546 | Bacteria | 834 |
| 41 | Ga0070696_100858215 | 3300005546 | Bacteria | 751 |
| 42 | Ga0070665_100348512 | 3300005548 | Bacteria | 1486 |
| 43 | Ga0070665_100457359 | 3300005548 | Bacteria | 1286 |
| 44 | Ga0070704_100440500 | 3300005549 | Bacteria | 1120 |
| 45 | Ga0070704_102093518 | 3300005549 | Bacteria | 526 |
| 46 | Ga0068854_101138622 | 3300005578 | Bacteria | 697 |
| 47 | Ga0068856_100440358 | 3300005614 | Bacteria | 1324 |
| 48 | Ga0068856_100818650 | 3300005614 | Bacteria | 951 |
| 49 | Ga0070702_100663886 | 3300005615 | Bacteria | 790 |
| 50 | Ga0068866_10993587 | 3300005718 | Bacteria | 596 |
| 51 | Ga0068866_11233676 | 3300005718 | Unclassified | 541 |
| 52 | Ga0068851_10100255 | 3300005834 | Bacteria | 1536 |
| 53 | Ga0068858_102342198 | 3300005842 | Bacteria | 528 |
| 54 | Ga0068862_100004149 | 3300005844 | Bacteria | 12276 |
| 55 | Ga0081455_10009454 | 3300005937 | Bacteria | 10028 |
| 56 | Ga0081455_10025792 | 3300005937 | Bacteria | 5419 |
| 57 | Ga0081455_10336533 | 3300005937 | Bacteria | 1070 |
| 58 | Ga0081538_10000002 | 3300005981 | Bacteria | 242010 |
| 59 | Ga0075365_10016297 | 3300006038 | Bacteria | 4517 |
| 60 | Ga0075365_10079464 | 3300006038 | Bacteria | 2219 |
| 61 | Ga0075365_10085201 | 3300006038 | Bacteria | 2146 |
| 62 | Ga0075365_10451917 | 3300006038 | Bacteria | 907 |
| 63 | Ga0075365_10570310 | 3300006038 | Bacteria | 800 |
| 64 | Ga0075363_100194976 | 3300006048 | Bacteria | 1156 |
| 65 | Ga0075364_10221371 | 3300006051 | Bacteria | 1284 |
| 66 | Ga0075364_10414888 | 3300006051 | Bacteria | 919 |
| 67 | Ga0075364_10804950 | 3300006051 | Unclassified | 640 |
| 68 | Ga0070715_10312433 | 3300006163 | Bacteria | 845 |
| 69 | Ga0070716_100391194 | 3300006173 | Unclassified | 997 |
| 70 | Ga0070712_100646320 | 3300006175 | Unclassified | 898 |
| 71 | Ga0075367_10131342 | 3300006178 | Bacteria | 1548 |
| 72 | Ga0075367_10206416 | 3300006178 | Bacteria | 1228 |
| 73 | Ga0075367_10697535 | 3300006178 | Bacteria | 646 |
| 74 | Ga0097621_101065413 | 3300006237 | Unclassified | 758 |
| 75 | Ga0068871_100309327 | 3300006358 | Bacteria | 1389 |
| 76 | Ga0068871_100946697 | 3300006358 | Bacteria | 800 |
| 77 | Ga0075430_100306266 | 3300006846 | Bacteria | 1314 |
| 78 | Ga0075431_100558182 | 3300006847 | Unclassified | 1132 |
| 79 | Ga0075433_10580051 | 3300006852 | Bacteria | 985 |
| 80 | Ga0075434_100193981 | 3300006871 | Bacteria | 2051 |
| 81 | Ga0075434_100420993 | 3300006871 | Bacteria | 1357 |
| 82 | Ga0075434_101981990 | 3300006871 | Bacteria | 588 |
| 83 | Ga0068865_101026704 | 3300006881 | Bacteria | 723 |
| 84 | Ga0075436_100962535 | 3300006914 | Unclassified | 640 |
| 85 | Ga0075436_101127732 | 3300006914 | Bacteria | 591 |
| 86 | Ga0075436_101489416 | 3300006914 | Bacteria | 514 |
| 87 | Ga0105244_10291418 | 3300009036 | Bacteria | 756 |
| 88 | Ga0111539_10336004 | 3300009094 | Bacteria | 1758 |
| 89 | Ga0111539_12022421 | 3300009094 | Bacteria | 668 |
| 90 | Ga0111539_12157165 | 3300009094 | Bacteria | 646 |
| 91 | Ga0105245_10000143 | 3300009098 | Bacteria | 67618 |
| 92 | Ga0105245_10055949 | 3300009098 | Bacteria | 3545 |
| 93 | Ga0105245_10491819 | 3300009098 | Unclassified | 1241 |
| 94 | Ga0105247_11690529 | 3300009101 | Bacteria | 523 |
| 95 | Ga0114129_10641529 | 3300009147 | Bacteria | 1372 |
| 96 | Ga0114129_10729804 | 3300009147 | Bacteria | 1270 |
| 97 | Ga0105243_10984532 | 3300009148 | Unclassified | 845 |
| 98 | Ga0105243_11069138 | 3300009148 | Bacteria | 813 |
| 99 | Ga0105243_11731823 | 3300009148 | Bacteria | 655 |
| 100 | Ga0105242_10279058 | 3300009176 | Bacteria | 1517 |
| 101 | Ga0105248_10796579 | 3300009177 | Bacteria | 1067 |
| 102 | Ga0105238_10000048 | 3300009551 | Bacteria | 146322 |
| 103 | Ga0105249_10000070 | 3300009553 | Bacteria | 147277 |
| 104 | Ga0105249_10024574 | 3300009553 | Bacteria | 5416 |
| 105 | Ga0105249_10228852 | 3300009553 | Bacteria | 1833 |
| 106 | Ga0105249_11303999 | 3300009553 | Bacteria | 798 |
| 107 | Ga0105033_112647 | 3300009986 | Bacteria | 749 |
| 108 | Ga0105035_104127 | 3300009988 | Bacteria | 1145 |
| 109 | Ga0105239_11246827 | 3300010375 | Bacteria | 857 |
| 110 | Ga0105239_13283960 | 3300010375 | Bacteria | 526 |
| 111 | Ga0157313_1046159 | 3300012503 | Bacteria | 552 |
| 112 | Ga0157374_10002572 | 3300013296 | Bacteria | 15292 |
| 113 | Ga0157374_10789482 | 3300013296 | Unclassified | 965 |
| 114 | Ga0157378_10305656 | 3300013297 | Bacteria | 1541 |
| 115 | Ga0163162_10508945 | 3300013306 | Bacteria | 1334 |
| 116 | Ga0163162_12187712 | 3300013306 | Bacteria | 635 |
| 117 | Ga0157375_10128788 | 3300013308 | Bacteria | 2649 |
| 118 | Ga0157375_11383640 | 3300013308 | Bacteria | 829 |
| 119 | Ga0163163_10215435 | 3300014325 | Bacteria | 1969 |
| 120 | Ga0163163_10616273 | 3300014325 | Bacteria | 1149 |
| 121 | Ga0157380_12098361 | 3300014326 | Bacteria | 628 |
| 122 | Ga0157377_10438922 | 3300014745 | Bacteria | 898 |
| 123 | Ga0157379_10053835 | 3300014968 | Bacteria | 3596 |
| 124 | Ga0157379_11302141 | 3300014968 | Unclassified | 702 |
| 125 | Ga0157376_10478249 | 3300014969 | Bacteria | 1220 |
| 126 | Ga0157376_12130436 | 3300014969 | Bacteria | 599 |
| 127 | Ga0163161_10449081 | 3300017792 | Bacteria | 1042 |
| 128 | Ga0206355_1025272 | 3300020076 | Bacteria | 1008 |
| 129 | Ga0206355_1637660 | 3300020076 | Bacteria | 507 |
| 130 | Ga0206354_10089471 | 3300020081 | Bacteria | 716 |
| 131 | Ga0213876_10036671 | 3300021384 | Bacteria | 2586 |
| 132 | Ga0213875_10074736 | 3300021388 | Bacteria | 1581 |
| 133 | Ga0207697_10330388 | 3300025315 | Bacteria | 677 |
| 134 | Ga0207653_10398051 | 3300025885 | Bacteria | 540 |
| 135 | Ga0207682_10000408 | 3300025893 | Bacteria | 19761 |
| 136 | Ga0207685_10852282 | 3300025905 | Unclassified | 505 |
| 137 | Ga0207684_10723456 | 3300025910 | Bacteria | 845 |
| 138 | Ga0207693_10001442 | 3300025915 | Bacteria | 21056 |
| 139 | Ga0207663_10007602 | 3300025916 | Bacteria | 5628 |
| 140 | Ga0207663_10961475 | 3300025916 | Bacteria | 684 |
| 141 | Ga0207646_10848894 | 3300025922 | Bacteria | 812 |
| 142 | Ga0207659_11061035 | 3300025926 | Unclassified | 697 |
| 143 | Ga0207687_10020967 | 3300025927 | Bacteria | 4338 |
| 144 | Ga0207687_10349377 | 3300025927 | Bacteria | 1204 |
| 145 | Ga0207706_10000017 | 3300025933 | Bacteria | 169589 |
| 146 | Ga0207709_10184730 | 3300025935 | Bacteria | 1475 |
| 147 | Ga0207669_11953970 | 3300025937 | Bacteria | 501 |
| 148 | Ga0207704_10420465 | 3300025938 | Bacteria | 1059 |
| 149 | Ga0207704_11817177 | 3300025938 | Bacteria | 524 |
| 150 | Ga0207665_10170470 | 3300025939 | Bacteria | 1571 |
| 151 | Ga0207711_10434043 | 3300025941 | Bacteria | 1222 |
| 152 | Ga0207661_10089580 | 3300025944 | Bacteria | 2560 |
| 153 | Ga0207712_10012661 | 3300025961 | Bacteria | 5390 |
| 154 | Ga0207712_10060307 | 3300025961 | Bacteria | 2689 |
| 155 | Ga0207668_10016787 | 3300025972 | Bacteria | 4577 |
| 156 | Ga0207668_11454067 | 3300025972 | Unclassified | 618 |
| 157 | Ga0207640_11280868 | 3300025981 | Bacteria | 654 |
| 158 | Ga0207658_10005122 | 3300025986 | Bacteria | 9026 |
| 159 | Ga0207677_10000299 | 3300026023 | Bacteria | 37042 |
| 160 | Ga0207677_10314703 | 3300026023 | Bacteria | 1298 |
| 161 | Ga0207703_10241021 | 3300026035 | Bacteria | 1625 |
| 162 | Ga0207639_10721456 | 3300026041 | Bacteria | 926 |
| 163 | Ga0207648_10543159 | 3300026089 | Bacteria | 1067 |
| 164 | Ga0207675_100724998 | 3300026118 | Bacteria | 1004 |
| 165 | Ga0207675_101485085 | 3300026118 | Bacteria | 698 |
| 166 | Ga0207683_10162210 | 3300026121 | Bacteria | 2021 |
| 167 | Ga0207683_12140184 | 3300026121 | Bacteria | 508 |
| 168 | Ga0268266_12097428 | 3300028379 | Unclassified | 538 |
| 169 | Ga0268265_10003909 | 3300028380 | Bacteria | 10504 |
| 170 | Ga0268265_10118604 | 3300028380 | Bacteria | 2176 |
| 171 | Ga0268264_10544202 | 3300028381 | Bacteria | 1138 |
| 172 | Ga0268264_12211540 | 3300028381 | Unclassified | 558 |
| 173 | Ga0265327_10464019 | 3300031251 | Bacteria | 547 |
| 174 | Ga0307406_10828333 | 3300031901 | Bacteria | 783 |
| 175 | Ga0307406_10913219 | 3300031901 | Bacteria | 748 |
| 176 | Ga0307409_100241049 | 3300031995 | Bacteria | 1646 |
| 177 | Ga0307416_100089226 | 3300032002 | Bacteria | 2639 |
| 178 | Ga0307416_101290674 | 3300032002 | Bacteria | 836 |
| 179 | Ga0307414_11288276 | 3300032004 | Bacteria | 678 |
| 180 | Ga0373946_0409452 | 3300035171 | Bacteria | 686 |
| 181 | Ga0373962_0199481 | 3300035242 | Bacteria | 677 |
| 182 | Ga0373933_0179296 | 3300035724 | Bacteria | 1351 |
| 183 | Ga0373947_0232857 | 3300035725 | Bacteria | 1214 |
| 184 | Ga0436364_1029426 | 3300037853 | Bacteria | 2926 |
| 185 | Ga0436365_1413912 | 3300039437 | Bacteria | 8761 |
| 186 | Ga0436365_1482571 | 3300039437 | Bacteria | 710 |
| 187 | Ga0436363_0927148 | 3300039450 | Bacteria | 670 |
| 188 | Ga0436363_1111990 | 3300039450 | Bacteria | 1956 |
| 189 | Ga0436362_0719752 | 3300039453 | Bacteria | 5248 |
| 190 | Ga0436362_1233701 | 3300039453 | Bacteria | 504 |
| 191 | Ga0451791_1375121 | 3300041451 | Bacteria | 740 |
| 192 | Ga0451837_1385598 | 3300041494 | Bacteria | 887 |
| 193 | Ga0451837_1474113 | 3300041494 | Unclassified | 537 |
| 194 | Ga0451853_0893560 | 3300041512 | Bacteria | 1048 |
| 195 | Ga0451853_1742991 | 3300041512 | Bacteria | 857 |
| 196 | Ga0439459_0122774 | 3300042438 | Bacteria | 657 |
| 197 | Ga0466969_0086879 | 3300044656 | Bacteria | 1485 |
| 198 | Ga0466970_0159822 | 3300044765 | Bacteria | 1246 |
| 199 | Ga0466960_0333373 | 3300044901 | Bacteria | 862 |
| 200 | Ga0466960_0552301 | 3300044901 | Bacteria | 679 |
| 201 | Ga0466959_0007719 | 3300045049 | Bacteria | 7559 |
| 202 | Ga0466958_1079494 | 3300045836 | Bacteria | 524 |
| 203 | Ga0466967_0273616 | 3300045976 | Bacteria | 1619 |
| 204 | Ga0495592_0027224 | 3300046454 | Bacteria | 4335 |
| 205 | Ga0495603_0502359 | 3300046455 | Bacteria | 694 |
| 206 | Ga0495629_0315841 | 3300046459 | Bacteria | 1068 |
| 207 | Ga0495629_0686643 | 3300046459 | Bacteria | 680 |
| 208 | Ga0495641_0094927 | 3300046461 | Bacteria | 1332 |
| 209 | Ga0495651_0307021 | 3300046462 | Bacteria | 1062 |
| 210 | Ga0495651_0320283 | 3300046462 | Bacteria | 1034 |
| 211 | Ga0495653_0016152 | 3300046463 | Bacteria | 6083 |
| 212 | Ga0495580_0988621 | 3300046472 | Bacteria | 537 |
| 213 | Ga0495582_0121598 | 3300046473 | Bacteria | 1471 |
| 214 | Ga0495639_0052899 | 3300046475 | Bacteria | 1849 |
| 215 | Ga0495594_0142797 | 3300046499 | Bacteria | 1358 |
| 216 | Ga0495610_0039553 | 3300046512 | Bacteria | 2384 |
| 217 | Ga0495618_0137830 | 3300046514 | Bacteria | 1561 |
| 218 | Ga0495628_0044680 | 3300046516 | Bacteria | 3523 |
| 219 | Ga0495644_0001780 | 3300046523 | Bacteria | 8694 |
| 220 | Ga0495644_0415966 | 3300046523 | Bacteria | 533 |
| 221 | Ga0495666_0398057 | 3300046526 | Bacteria | 619 |
| 222 | Ga0495652_0015700 | 3300046529 | Bacteria | 6778 |
| 223 | Ga0495586_0001338 | 3300046535 | Bacteria | 13685 |
| 224 | Ga0495587_0780811 | 3300046536 | Bacteria | 522 |
| 225 | Ga0495598_0014741 | 3300046537 | Bacteria | 1959 |
| 226 | Ga0495621_0065989 | 3300046539 | Bacteria | 1323 |
| 227 | Ga0495645_0139797 | 3300046543 | Bacteria | 1690 |
| 228 | Ga0495633_0169466 | 3300046558 | Bacteria | 1006 |
| 229 | Ga0495625_0000453 | 3300046660 | Bacteria | 61379 |
| 230 | Ga0495599_0648619 | 3300046678 | Bacteria | 612 |
| 231 | Ga0495623_0170750 | 3300046679 | Bacteria | 1270 |
| 232 | Ga0495623_0245959 | 3300046679 | Bacteria | 1008 |
| 233 | Ga0495623_0325566 | 3300046679 | Bacteria | 843 |
| 234 | Ga0495623_0530716 | 3300046679 | Bacteria | 618 |
| 235 | Ga0495646_0555032 | 3300046680 | Bacteria | 586 |
| 236 | Ga0495646_0672748 | 3300046680 | Bacteria | 522 |
| 237 | Ga0495647_0000009 | 3300046681 | Bacteria | 94874 |
| 238 | Ga0495647_0129553 | 3300046681 | Bacteria | 1068 |
| 239 | Ga0495624_0000414 | 3300046690 | Bacteria | 33832 |
| 240 | Ga0495624_0658316 | 3300046690 | Bacteria | 623 |
| 241 | Ga0495670_0150708 | 3300046691 | Bacteria | 1219 |
| 242 | Ga0495581_0127178 | 3300047315 | Bacteria | 1484 |
| 243 | Ga0495676_0115388 | 3300047321 | Bacteria | 1964 |
| 244 | Ga0495676_0147618 | 3300047321 | Bacteria | 1678 |
| 245 | Ga0495676_0291430 | 3300047321 | Bacteria | 1103 |
| 246 | Ga0495602_0036869 | 3300048088 | Bacteria | 4545 |
| 247 | Ga0495602_0214527 | 3300048088 | Bacteria | 1458 |
| 248 | Ga0495614_0094438 | 3300048089 | Bacteria | 1303 |
| 249 | Ga0496100_0260508 | 3300048903 | Bacteria | 1286 |
| 250 | Ga0496100_0361604 | 3300048903 | Bacteria | 1098 |
| 251 | Ga0496100_0480845 | 3300048903 | Bacteria | 955 |
| 252 | Ga0496101_0116686 | 3300048904 | Bacteria | 2014 |
| 253 | Ga0496101_0677209 | 3300048904 | Bacteria | 815 |
| 254 | Ga0496102_0031580 | 3300048905 | Bacteria | 4752 |
| 255 | Ga0496102_0235348 | 3300048905 | Bacteria | 1727 |
| 256 | Ga0496102_0735560 | 3300048905 | Bacteria | 909 |
| 257 | Ga0496103_0040565 | 3300048906 | Bacteria | 2860 |
| 258 | Ga0496103_0166597 | 3300048906 | Bacteria | 1414 |
| 259 | Ga0496103_0483639 | 3300048906 | Bacteria | 793 |
| 260 | Ga0496104_0001134 | 3300048907 | Bacteria | 22797 |
| 261 | Ga0496104_0008804 | 3300048907 | Bacteria | 8971 |
| 262 | Ga0496105_0000101 | 3300048908 | Bacteria | 58062 |
| 263 | Ga0496105_0117514 | 3300048908 | Bacteria | 2193 |
| 264 | Ga0496106_0185112 | 3300048909 | Bacteria | 1654 |
| 265 | Ga0496106_0239190 | 3300048909 | Bacteria | 1451 |
| 266 | Ga0496107_0114331 | 3300048910 | Bacteria | 1985 |
| 267 | Ga0496107_0485237 | 3300048910 | Bacteria | 917 |
| 268 | Ga0496107_1292198 | 3300048910 | Bacteria | 522 |
| 269 | Ga0496108_0042143 | 3300048911 | Bacteria | 3811 |
| 270 | Ga0496108_1236792 | 3300048911 | Bacteria | 630 |
| 271 | Ga0496109_0022799 | 3300048912 | Bacteria | 5548 |
| 272 | Ga0496109_0205899 | 3300048912 | Bacteria | 1850 |
| 273 | Ga0496109_0885819 | 3300048912 | Bacteria | 830 |
| 274 | Ga0496109_1404873 | 3300048912 | Bacteria | 633 |
| 275 | Ga0496110_0007496 | 3300048913 | Bacteria | 8721 |
| 276 | Ga0496110_0474419 | 3300048913 | Bacteria | 1140 |
| 277 | Ga0496110_0826126 | 3300048913 | Bacteria | 831 |
| 278 | Ga0496111_0071699 | 3300048914 | Bacteria | 2521 |
| 279 | Ga0496111_0510248 | 3300048914 | Bacteria | 884 |
| 280 | Ga0496112_0000013 | 3300048915 | Bacteria | 237194 |
| 281 | Ga0496112_0118335 | 3300048915 | Bacteria | 2619 |
| 282 | Ga0496113_0014073 | 3300048916 | Bacteria | 5445 |
| 283 | Ga0496113_0081431 | 3300048916 | Bacteria | 2481 |
| 284 | Ga0496113_0896793 | 3300048916 | Bacteria | 701 |
| 285 | Ga0496114_0002456 | 3300048917 | Bacteria | 14155 |
| 286 | Ga0496114_0006057 | 3300048917 | Bacteria | 9518 |
| 287 | Ga0496115_0144299 | 3300048918 | Bacteria | 1964 |
| 288 | Ga0496116_0245039 | 3300048919 | Bacteria | 897 |
| 289 | Ga0501308_065303 | 3300049128 | Bacteria | 557 |
| 290 | Ga0501317_068429 | 3300049533 | Bacteria | 595 |
| 291 | Ga0501321_038365 | 3300049537 | Bacteria | 665 |
| 292 | Ga0501031_0747362 | 3300049568 | Bacteria | 627 |
| 293 | Ga0501031_0885532 | 3300049568 | Bacteria | 572 |
| 294 | Ga0501032_0019590 | 3300049569 | Bacteria | 4730 |
| 295 | Ga0501033_0542022 | 3300049570 | Bacteria | 802 |
| 296 | Ga0501034_0380356 | 3300049571 | Bacteria | 1337 |
| 297 | Ga0501034_0617636 | 3300049571 | Bacteria | 988 |
| 298 | Ga0501036_0031131 | 3300049572 | Bacteria | 4508 |
| 299 | Ga0501037_0081561 | 3300049573 | Bacteria | 2345 |
| 300 | Ga0501038_0216088 | 3300049574 | Bacteria | 1532 |
| 301 | Ga0501039_0038828 | 3300049575 | Bacteria | 3676 |
| 302 | Ga0501039_1576911 | 3300049575 | Bacteria | 504 |
| 303 | Ga0501040_0172758 | 3300049576 | Bacteria | 1530 |
| 304 | Ga0501040_0415280 | 3300049576 | Bacteria | 967 |
| 305 | Ga0501041_0006142 | 3300049577 | Bacteria | 7019 |
| 306 | Ga0501041_0578901 | 3300049577 | Bacteria | 716 |
| 307 | Ga0501042_0013998 | 3300049578 | Bacteria | 5467 |
| 308 | Ga0501042_0547030 | 3300049578 | Bacteria | 841 |
| 309 | Ga0501043_0969656 | 3300049579 | Bacteria | 606 |
| 310 | Ga0501043_1009065 | 3300049579 | Bacteria | 592 |
| 311 | Ga0501046_0044029 | 3300049580 | Bacteria | 3551 |
| 312 | Ga0501047_0235110 | 3300049581 | Bacteria | 1684 |
| 313 | Ga0501048_0073533 | 3300049582 | Bacteria | 2412 |
| 314 | Ga0501067_0461267 | 3300049583 | Bacteria | 710 |
| 315 | Ga0501068_0029383 | 3300049584 | Bacteria | 3254 |
| 316 | Ga0501068_0089781 | 3300049584 | Bacteria | 1895 |
| 317 | Ga0501068_0426258 | 3300049584 | Bacteria | 857 |
| 318 | Ga0501068_0565192 | 3300049584 | Bacteria | 740 |
| 319 | Ga0501068_0597075 | 3300049584 | Bacteria | 719 |
| 320 | Ga0501069_0045471 | 3300049585 | Bacteria | 2433 |
| 321 | Ga0501069_0265867 | 3300049585 | Bacteria | 1002 |
| 322 | Ga0501069_0601305 | 3300049585 | Bacteria | 660 |
| 323 | Ga0501070_0074002 | 3300049586 | Bacteria | 2819 |
| 324 | Ga0501070_0775056 | 3300049586 | Bacteria | 754 |
| 325 | Ga0501070_1129829 | 3300049586 | Bacteria | 603 |
| 326 | Ga0501071_0115672 | 3300049587 | Bacteria | 1985 |
| 327 | Ga0501071_0221326 | 3300049587 | Bacteria | 1424 |
| 328 | Ga0501072_0016304 | 3300049588 | Bacteria | 5700 |
| 329 | Ga0501072_0101631 | 3300049588 | Bacteria | 2285 |
| 330 | Ga0501072_0700351 | 3300049588 | Bacteria | 796 |
| 331 | Ga0501073_0077894 | 3300049589 | Bacteria | 2307 |
| 332 | Ga0501073_1083411 | 3300049589 | Bacteria | 551 |
| 333 | Ga0501074_0018198 | 3300049590 | Bacteria | 5104 |
| 334 | Ga0501074_0092513 | 3300049590 | Bacteria | 2165 |
| 335 | Ga0501074_0406618 | 3300049590 | Bacteria | 965 |
| 336 | Ga0501074_0584060 | 3300049590 | Bacteria | 790 |
| 337 | Ga0501075_0134484 | 3300049591 | Bacteria | 1883 |
| 338 | Ga0501076_0075230 | 3300049592 | Bacteria | 2706 |
| 339 | Ga0501076_0704176 | 3300049592 | Bacteria | 834 |
| 340 | Ga0501077_0121813 | 3300049593 | Bacteria | 1653 |
| 341 | Ga0501253_087254 | 3300049683 | Bacteria | 713 |
| 342 | Ga0501079_0007641 | 3300049741 | Bacteria | 8189 |
| 343 | Ga0501079_0423853 | 3300049741 | Bacteria | 1045 |
| 344 | Ga0501080_0103813 | 3300049742 | Bacteria | 2636 |
| 345 | Ga0501080_0357942 | 3300049742 | Bacteria | 1317 |
| 346 | Ga0501080_1182299 | 3300049742 | Bacteria | 658 |
| 347 | Ga0501081_0018878 | 3300049743 | Bacteria | 4582 |
| 348 | Ga0501081_0395703 | 3300049743 | Bacteria | 1022 |
| 349 | Ga0501083_0177702 | 3300049744 | Bacteria | 1390 |
| 350 | Ga0501083_0215829 | 3300049744 | Bacteria | 1250 |
| 351 | Ga0501035_0308195 | 3300049822 | Bacteria | 1332 |
| 352 | Ga0501045_0460140 | 3300049824 | Bacteria | 945 |
| 353 | Ga0501045_0869897 | 3300049824 | Bacteria | 663 |
| 354 | nmdc:mga03n38_170378_c1 | 3300050490 | Unclassified | 1108 |
| 355 | nmdc:mga00v17_122625_c1 | 3300050491 | Bacteria | 1656 |
| 356 | nmdc:mga00v17_362173_c1 | 3300050491 | Bacteria | 943 |
| 357 | nmdc:mga00v17_690362_c1 | 3300050491 | Bacteria | 655 |
| 358 | nmdc:mga00v17_872791_c1 | 3300050491 | Bacteria | 571 |
| 359 | nmdc:mga0yw44_140518_c1 | 3300050492 | Bacteria | 1569 |
| 360 | nmdc:mga0yw44_199041_c1 | 3300050492 | Bacteria | 1323 |
| 361 | nmdc:mga0yw44_54178_c1 | 3300050492 | Bacteria | 2437 |
| 362 | nmdc:mga06z11_169323_c1 | 3300050494 | Bacteria | 1253 |
| 363 | nmdc:mga06z11_812535_c1 | 3300050494 | Bacteria | 570 |
| 364 | nmdc:mga07m45_553266_c1 | 3300050496 | Bacteria | 665 |
| 365 | nmdc:mga05p37_1831332_c1 | 3300050507 | Bacteria | 584 |
| 366 | nmdc:mga05p37_2247293_c1 | 3300050507 | Bacteria | 504 |
| 367 | nmdc:mga05p37_303467_c1 | 3300050507 | Bacteria | 1896 |
| 368 | nmdc:mga0qj67_155893_c1 | 3300050509 | Bacteria | 1853 |
| 369 | nmdc:mga08y16_1835795_c1 | 3300050511 | Bacteria | 558 |
| 370 | nmdc:mga08y16_556608_c1 | 3300050511 | Bacteria | 1160 |
| 371 | nmdc:mga0n895_281191_c1 | 3300050512 | Bacteria | 1687 |
| 372 | nmdc:mga0n895_465470_c1 | 3300050512 | Bacteria | 1276 |
| 373 | nmdc:mga08x19_1297623_c1 | 3300050514 | Bacteria | 516 |
| 374 | nmdc:mga08x19_767007_c1 | 3300050514 | Unclassified | 685 |
| 375 | nmdc:mga0a205_1382231_c1 | 3300050515 | Bacteria | 552 |
| 376 | nmdc:mga0a205_802018_c1 | 3300050515 | Bacteria | 789 |
| 377 | Ga0495601_0005548 | 3300053077 | Bacteria | 7359 |
| 378 | Ga0495601_0039148 | 3300053077 | Bacteria | 2968 |
| 379 | Ga0495612_0335290 | 3300053078 | Bacteria | 681 |
| 380 | Ga0500573_0085904 | 3300053140 | Bacteria | 1783 |
| 381 | Ga0500573_0231856 | 3300053140 | Bacteria | 962 |
| 382 | Ga0501084_0104034 | 3300054114 | Bacteria | 2384 |
| 383 | Ga0501084_0359647 | 3300054114 | Bacteria | 1230 |
| 384 | Ga0501084_1653586 | 3300054114 | Bacteria | 535 |
| 385 | Ga0587111_0244801 | 3300060346 | Bacteria | 528 |
| 386 | Ga0501082_0034430 | 3300060353 | Bacteria | 4367 |
| 387 | Ga0501082_0393701 | 3300060353 | Bacteria | 1209 |
| 388 | Ga0501082_0659342 | 3300060353 | Bacteria | 916 |
| 389 | Ga0501082_1683439 | 3300060353 | Bacteria | 554 |
| 390 | Ga0530510_0022147 | 3300061734 | Bacteria | 4525 |
| 391 | Ga0530510_0684721 | 3300061734 | Bacteria | 781 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2857737099 | 2857738630 | 60 |
| 2 | 3300005330 | Ga0070690_100159838 | Ga0070690_1001598383 | 63 |
| 3 | 3300005337 | Ga0070682_100000093 | Ga0070682_10000009316 | 63 |
| 4 | 3300005337 | Ga0070682_100048425 | Ga0070682_1000484253 | 63 |
| 5 | 3300005338 | Ga0068868_100481533 | Ga0068868_1004815333 | 63 |
| 6 | 3300005339 | Ga0070660_101399702 | Ga0070660_1013997021 | 63 |
| 7 | 3300005340 | Ga0070689_100034705 | Ga0070689_1000347054 | 63 |
| 8 | 3300005354 | Ga0070675_100734939 | Ga0070675_1007349391 | 63 |
| 9 | 3300005356 | Ga0070674_100088000 | Ga0070674_1000880003 | 63 |
| 10 | 3300005365 | Ga0070688_100495909 | Ga0070688_1004959091 | 63 |
| 11 | 3300005367 | Ga0070667_101166602 | Ga0070667_1011666022 | 63 |
| 12 | 3300005406 | Ga0070703_10298454 | Ga0070703_102984542 | 63 |
| 13 | 3300005438 | Ga0070701_10049276 | Ga0070701_100492763 | 63 |
| 14 | 3300005439 | Ga0070711_100287136 | Ga0070711_1002871362 | 63 |
| 15 | 3300005440 | Ga0070705_101299515 | Ga0070705_1012995151 | 63 |
| 16 | 3300005445 | Ga0070708_100554338 | Ga0070708_1005543382 | 63 |
| 17 | 3300005456 | Ga0070678_101228648 | Ga0070678_1012286482 | 63 |
| 18 | 3300005466 | Ga0070685_10299630 | Ga0070685_102996302 | 63 |
| 19 | 3300005467 | Ga0070706_100939493 | Ga0070706_1009394932 | 63 |
| 20 | 3300005530 | Ga0070679_100708282 | Ga0070679_1007082822 | 63 |
| 21 | 3300005535 | Ga0070684_100563639 | Ga0070684_1005636391 | 63 |
| 22 | 3300005545 | Ga0070695_100211738 | Ga0070695_1002117382 | 63 |
| 23 | 3300005548 | Ga0070665_100348512 | Ga0070665_1003485122 | 63 |
| 24 | 3300005549 | Ga0070704_100440500 | Ga0070704_1004405002 | 63 |
| 25 | 3300005578 | Ga0068854_101138622 | Ga0068854_1011386222 | 63 |
| 26 | 3300005614 | Ga0068856_100440358 | Ga0068856_1004403582 | 63 |
| 27 | 3300005614 | Ga0068856_100818650 | Ga0068856_1008186502 | 63 |
| 28 | 3300005718 | Ga0068866_11233676 | Ga0068866_112336761 | 63 |
| 29 | 3300005842 | Ga0068858_102342198 | Ga0068858_1023421982 | 63 |
| 30 | 3300006038 | Ga0075365_10016297 | Ga0075365_100162973 | 63 |
| 31 | 3300006038 | Ga0075365_10570310 | Ga0075365_105703102 | 63 |
| 32 | 3300006051 | Ga0075364_10414888 | Ga0075364_104148882 | 63 |
| 33 | 3300006163 | Ga0070715_10312433 | Ga0070715_103124332 | 63 |
| 34 | 3300006173 | Ga0070716_100391194 | Ga0070716_1003911943 | 63 |
| 35 | 3300006175 | Ga0070712_100646320 | Ga0070712_1006463202 | 63 |
| 36 | 3300006178 | Ga0075367_10206416 | Ga0075367_102064162 | 63 |
| 37 | 3300006237 | Ga0097621_101065413 | Ga0097621_1010654132 | 63 |
| 38 | 3300006358 | Ga0068871_100946697 | Ga0068871_1009466971 | 63 |
| 39 | 3300006847 | Ga0075431_100558182 | Ga0075431_1005581822 | 63 |
| 40 | 3300006871 | Ga0075434_101981990 | Ga0075434_1019819902 | 63 |
| 41 | 3300006914 | Ga0075436_100962535 | Ga0075436_1009625352 | 63 |
| 42 | 3300009098 | Ga0105245_10000143 | Ga0105245_1000014358 | 63 |
| 43 | 3300009098 | Ga0105245_10055949 | Ga0105245_100559495 | 63 |
| 44 | 3300009177 | Ga0105248_10796579 | Ga0105248_107965793 | 63 |
| 45 | 3300009551 | Ga0105238_10000048 | Ga0105238_1000004867 | 63 |
| 46 | 3300009553 | Ga0105249_10000070 | Ga0105249_1000007083 | 63 |
| 47 | 3300013296 | Ga0157374_10789482 | Ga0157374_107894822 | 63 |
| 48 | 3300013297 | Ga0157378_10305656 | Ga0157378_103056562 | 63 |
| 49 | 3300013308 | Ga0157375_10128788 | Ga0157375_101287882 | 63 |
| 50 | 3300014325 | Ga0163163_10616273 | Ga0163163_106162733 | 63 |
| 51 | 3300014745 | Ga0157377_10438922 | Ga0157377_104389223 | 63 |
| 52 | 3300014968 | Ga0157379_11302141 | Ga0157379_113021412 | 63 |
| 53 | 3300014969 | Ga0157376_10478249 | Ga0157376_104782493 | 63 |
| 54 | 3300025885 | Ga0207653_10398051 | Ga0207653_103980512 | 63 |
| 55 | 3300025905 | Ga0207685_10852282 | Ga0207685_108522822 | 63 |
| 56 | 3300025910 | Ga0207684_10723456 | Ga0207684_107234562 | 63 |
| 57 | 3300025915 | Ga0207693_10001442 | Ga0207693_1000144220 | 63 |
| 58 | 3300025916 | Ga0207663_10961475 | Ga0207663_109614752 | 63 |
| 59 | 3300025926 | Ga0207659_11061035 | Ga0207659_110610352 | 63 |
| 60 | 3300025927 | Ga0207687_10020967 | Ga0207687_100209673 | 63 |
| 61 | 3300025939 | Ga0207665_10170470 | Ga0207665_101704703 | 63 |
| 62 | 3300025941 | Ga0207711_10434043 | Ga0207711_104340433 | 63 |
| 63 | 3300025972 | Ga0207668_11454067 | Ga0207668_114540672 | 63 |
| 64 | 3300025981 | Ga0207640_11280868 | Ga0207640_112808681 | 63 |
| 65 | 3300026023 | Ga0207677_10314703 | Ga0207677_103147032 | 63 |
| 66 | 3300026041 | Ga0207639_10721456 | Ga0207639_107214563 | 63 |
| 67 | 3300026118 | Ga0207675_100724998 | Ga0207675_1007249982 | 63 |
| 68 | 3300026121 | Ga0207683_10162210 | Ga0207683_101622102 | 63 |
| 69 | 3300028379 | Ga0268266_12097428 | Ga0268266_120974281 | 63 |
| 70 | 3300032002 | Ga0307416_101290674 | Ga0307416_1012906742 | 63 |
| 71 | 3300035171 | Ga0373946_0409452 | Ga0373946_0409452_272_466 | 63 |
| 72 | 3300035725 | Ga0373947_0232857 | Ga0373947_0232857_232_426 | 63 |
| 73 | 3300039437 | Ga0436365_1482571 | Ga0436365_1482571_213_410 | 63 |
| 74 | 3300041512 | Ga0451853_0893560 | Ga0451853_0893560_761_955 | 63 |
| 75 | 3300045976 | Ga0466967_0273616 | Ga0466967_0273616_656_856 | 63 |
| 76 | 3300046455 | Ga0495603_0502359 | Ga0495603_0502359_157_351 | 63 |
| 77 | 3300046472 | Ga0495580_0988621 | Ga0495580_0988621_78_272 | 63 |
| 78 | 3300046473 | Ga0495582_0121598 | Ga0495582_0121598_967_1161 | 63 |
| 79 | 3300046499 | Ga0495594_0142797 | Ga0495594_0142797_218_412 | 63 |
| 80 | 3300046523 | Ga0495644_0415966 | Ga0495644_0415966_327_521 | 63 |
| 81 | 3300046526 | Ga0495666_0398057 | Ga0495666_0398057_323_517 | 63 |
| 82 | 3300046681 | Ga0495647_0129553 | Ga0495647_0129553_741_935 | 63 |
| 83 | 3300046690 | Ga0495624_0658316 | Ga0495624_0658316_390_584 | 63 |
| 84 | 3300047315 | Ga0495581_0127178 | Ga0495581_0127178_513_707 | 63 |
| 85 | 3300047321 | Ga0495676_0147618 | Ga0495676_0147618_1213_1407 | 63 |
| 86 | 3300048089 | Ga0495614_0094438 | Ga0495614_0094438_359_553 | 63 |
| 87 | 3300048903 | Ga0496100_0361604 | Ga0496100_0361604_568_762 | 63 |
| 88 | 3300048904 | Ga0496101_0116686 | Ga0496101_0116686_1658_1852 | 63 |
| 89 | 3300048905 | Ga0496102_0031580 | Ga0496102_0031580_2257_2451 | 63 |
| 90 | 3300048906 | Ga0496103_0040565 | Ga0496103_0040565_2205_2399 | 63 |
| 91 | 3300048907 | Ga0496104_0008804 | Ga0496104_0008804_4782_4976 | 63 |
| 92 | 3300048908 | Ga0496105_0117514 | Ga0496105_0117514_1592_1786 | 63 |
| 93 | 3300048909 | Ga0496106_0185112 | Ga0496106_0185112_43_237 | 63 |
| 94 | 3300048910 | Ga0496107_0114331 | Ga0496107_0114331_566_760 | 63 |
| 95 | 3300048911 | Ga0496108_0042143 | Ga0496108_0042143_917_1111 | 63 |
| 96 | 3300048912 | Ga0496109_0022799 | Ga0496109_0022799_4788_4982 | 63 |
| 97 | 3300048912 | Ga0496109_0885819 | Ga0496109_0885819_351_545 | 63 |
| 98 | 3300048913 | Ga0496110_0007496 | Ga0496110_0007496_2594_2788 | 63 |
| 99 | 3300048913 | Ga0496110_0826126 | Ga0496110_0826126_310_504 | 63 |
| 100 | 3300048914 | Ga0496111_0071699 | Ga0496111_0071699_2017_2211 | 63 |
| 101 | 3300048914 | Ga0496111_0510248 | Ga0496111_0510248_311_505 | 63 |
| 102 | 3300048915 | Ga0496112_0118335 | Ga0496112_0118335_1284_1478 | 63 |
| 103 | 3300048916 | Ga0496113_0081431 | Ga0496113_0081431_306_500 | 63 |
| 104 | 3300048917 | Ga0496114_0002456 | Ga0496114_0002456_11678_11872 | 63 |
| 105 | 3300048918 | Ga0496115_0144299 | Ga0496115_0144299_422_616 | 63 |
| 106 | 3300050491 | nmdc:mga00v17_362173_c1 | nmdc:mga00v17_362173_c1_310_504 | 63 |
| 107 | 3300050492 | nmdc:mga0yw44_54178_c1 | nmdc:mga0yw44_54178_c1_1182_1376 | 63 |
| 108 | 3300050494 | nmdc:mga06z11_812535_c1 | nmdc:mga06z11_812535_c1_323_517 | 63 |
| 109 | 3300050514 | nmdc:mga08x19_767007_c1 | nmdc:mga08x19_767007_c1_122_316 | 63 |
| 110 | 3300009986 | Ga0105033_112647 | Ga0105033_1126471 | 64 |
| 111 | 3300009988 | Ga0105035_104127 | Ga0105035_1041272 | 64 |
| 112 | 3300012503 | Ga0157313_1046159 | Ga0157313_10461591 | 64 |
| 113 | 3300014326 | Ga0157380_12098361 | Ga0157380_120983612 | 64 |
| 114 | 3300020076 | Ga0206355_1025272 | Ga0206355_10252721 | 64 |
| 115 | 3300020076 | Ga0206355_1637660 | Ga0206355_16376601 | 64 |
| 116 | 3300020081 | Ga0206354_10089471 | Ga0206354_100894712 | 64 |
| 117 | 3300031251 | Ga0265327_10464019 | Ga0265327_104640192 | 64 |
| 118 | 3300041494 | Ga0451837_1385598 | Ga0451837_1385598_257_451 | 64 |
| 119 | 3300042438 | Ga0439459_0122774 | Ga0439459_0122774_348_542 | 64 |
| 120 | 3300048917 | Ga0496114_0006057 | Ga0496114_0006057_7189_7383 | 64 |
| 121 | 3300049128 | Ga0501308_065303 | Ga0501308_065303_64_258 | 64 |
| 122 | 3300049533 | Ga0501317_068429 | Ga0501317_068429_109_303 | 64 |
| 123 | 3300049537 | Ga0501321_038365 | Ga0501321_038365_337_531 | 64 |
| 124 | 3300049568 | Ga0501031_0885532 | Ga0501031_0885532_52_246 | 64 |
| 125 | 3300049569 | Ga0501032_0019590 | Ga0501032_0019590_3301_3495 | 64 |
| 126 | 3300049570 | Ga0501033_0542022 | Ga0501033_0542022_421_615 | 64 |
| 127 | 3300049571 | Ga0501034_0380356 | Ga0501034_0380356_289_483 | 64 |
| 128 | 3300049572 | Ga0501036_0031131 | Ga0501036_0031131_866_1060 | 64 |
| 129 | 3300049573 | Ga0501037_0081561 | Ga0501037_0081561_1319_1513 | 64 |
| 130 | 3300049574 | Ga0501038_0216088 | Ga0501038_0216088_401_595 | 64 |
| 131 | 3300049575 | Ga0501039_0038828 | Ga0501039_0038828_2159_2353 | 64 |
| 132 | 3300049576 | Ga0501040_0172758 | Ga0501040_0172758_1013_1207 | 64 |
| 133 | 3300049577 | Ga0501041_0006142 | Ga0501041_0006142_1782_1976 | 64 |
| 134 | 3300049578 | Ga0501042_0013998 | Ga0501042_0013998_3088_3282 | 64 |
| 135 | 3300049579 | Ga0501043_0969656 | Ga0501043_0969656_202_396 | 64 |
| 136 | 3300049580 | Ga0501046_0044029 | Ga0501046_0044029_1082_1276 | 64 |
| 137 | 3300049582 | Ga0501048_0073533 | Ga0501048_0073533_1810_2004 | 64 |
| 138 | 3300049584 | Ga0501068_0029383 | Ga0501068_0029383_587_781 | 64 |
| 139 | 3300049585 | Ga0501069_0265867 | Ga0501069_0265867_423_617 | 64 |
| 140 | 3300049586 | Ga0501070_0775056 | Ga0501070_0775056_305_499 | 64 |
| 141 | 3300049587 | Ga0501071_0221326 | Ga0501071_0221326_714_908 | 64 |
| 142 | 3300049588 | Ga0501072_0016304 | Ga0501072_0016304_5004_5198 | 64 |
| 143 | 3300049590 | Ga0501074_0018198 | Ga0501074_0018198_3347_3541 | 64 |
| 144 | 3300049591 | Ga0501075_0134484 | Ga0501075_0134484_859_1053 | 64 |
| 145 | 3300049592 | Ga0501076_0075230 | Ga0501076_0075230_1929_2123 | 64 |
| 146 | 3300049593 | Ga0501077_0121813 | Ga0501077_0121813_1058_1252 | 64 |
| 147 | 3300049741 | Ga0501079_0007641 | Ga0501079_0007641_4674_4868 | 64 |
| 148 | 3300049742 | Ga0501080_0357942 | Ga0501080_0357942_278_472 | 64 |
| 149 | 3300049743 | Ga0501081_0018878 | Ga0501081_0018878_4176_4370 | 64 |
| 150 | 3300049744 | Ga0501083_0215829 | Ga0501083_0215829_356_550 | 64 |
| 151 | 3300049822 | Ga0501035_0308195 | Ga0501035_0308195_417_611 | 64 |
| 152 | 3300049824 | Ga0501045_0460140 | Ga0501045_0460140_305_499 | 64 |
| 153 | 3300054114 | Ga0501084_0104034 | Ga0501084_0104034_1651_1845 | 64 |
| 154 | 3300060346 | Ga0587111_0244801 | Ga0587111_0244801_46_240 | 64 |
| 155 | 3300060353 | Ga0501082_0034430 | Ga0501082_0034430_884_1078 | 64 |
| 156 | 3300061734 | Ga0530510_0022147 | Ga0530510_0022147_3318_3512 | 64 |
| 157 | 3300005347 | Ga0070668_100026874 | Ga0070668_1000268745 | 65 |
| 158 | 3300005367 | Ga0070667_100001327 | Ga0070667_10000132710 | 65 |
| 159 | 3300005548 | Ga0070665_100457359 | Ga0070665_1004573592 | 65 |
| 160 | 3300005844 | Ga0068862_100004149 | Ga0068862_1000041498 | 65 |
| 161 | 3300006038 | Ga0075365_10085201 | Ga0075365_100852011 | 65 |
| 162 | 3300006038 | Ga0075365_10451917 | Ga0075365_104519172 | 65 |
| 163 | 3300006051 | Ga0075364_10221371 | Ga0075364_102213712 | 65 |
| 164 | 3300006051 | Ga0075364_10804950 | Ga0075364_108049502 | 65 |
| 165 | 3300006178 | Ga0075367_10697535 | Ga0075367_106975352 | 65 |
| 166 | 3300009553 | Ga0105249_10024574 | Ga0105249_100245742 | 65 |
| 167 | 3300014968 | Ga0157379_10053835 | Ga0157379_100538354 | 65 |
| 168 | 3300017792 | Ga0163161_10449081 | Ga0163161_104490812 | 65 |
| 169 | 3300025922 | Ga0207646_10848894 | Ga0207646_108488942 | 65 |
| 170 | 3300025961 | Ga0207712_10012661 | Ga0207712_100126612 | 65 |
| 171 | 3300025972 | Ga0207668_10016787 | Ga0207668_100167872 | 65 |
| 172 | 3300025986 | Ga0207658_10005122 | Ga0207658_100051224 | 65 |
| 173 | 3300026035 | Ga0207703_10241021 | Ga0207703_102410213 | 65 |
| 174 | 3300028380 | Ga0268265_10003909 | Ga0268265_100039098 | 65 |
| 175 | 3300041451 | Ga0451791_1375121 | Ga0451791_1375121_256_453 | 65 |
| 176 | 3300041494 | Ga0451837_1474113 | Ga0451837_1474113_219_416 | 65 |
| 177 | 3300041512 | Ga0451853_1742991 | Ga0451853_1742991_414_611 | 65 |
| 178 | 3300044901 | Ga0466960_0333373 | Ga0466960_0333373_313_510 | 65 |
| 179 | 3300046660 | Ga0495625_0000453 | Ga0495625_0000453_38667_38864 | 65 |
| 180 | 3300048913 | Ga0496110_0474419 | Ga0496110_0474419_642_839 | 65 |
| 181 | 3300048919 | Ga0496116_0245039 | Ga0496116_0245039_666_863 | 65 |
| 182 | 3300049589 | Ga0501073_1083411 | Ga0501073_1083411_236_433 | 65 |
| 183 | 3300049742 | Ga0501080_1182299 | Ga0501080_1182299_251_448 | 65 |
| 184 | 3300050490 | nmdc:mga03n38_170378_c1 | nmdc:mga03n38_170378_c1_701_910 | 65 |
| 185 | 3300050491 | nmdc:mga00v17_122625_c1 | nmdc:mga00v17_122625_c1_1197_1394 | 65 |
| 186 | 3300050492 | nmdc:mga0yw44_199041_c1 | nmdc:mga0yw44_199041_c1_1054_1251 | 65 |
| 187 | 3300050496 | nmdc:mga07m45_553266_c1 | nmdc:mga07m45_553266_c1_112_309 | 65 |
| 188 | 3300060353 | Ga0501082_1683439 | Ga0501082_1683439_181_378 | 65 |
| 189 | 3300002459 | JGI24751J29686_10004171 | JGI24751J29686_100041714 | 66 |
| 190 | 3300005329 | Ga0070683_100073285 | Ga0070683_1000732853 | 66 |
| 191 | 3300005333 | Ga0070677_10000413 | Ga0070677_1000041317 | 66 |
| 192 | 3300005338 | Ga0068868_100000445 | Ga0068868_1000004456 | 66 |
| 193 | 3300005338 | Ga0068868_102282449 | Ga0068868_1022824492 | 66 |
| 194 | 3300005439 | Ga0070711_100011596 | Ga0070711_1000115962 | 66 |
| 195 | 3300005440 | Ga0070705_100353244 | Ga0070705_1003532442 | 66 |
| 196 | 3300005444 | Ga0070694_100820231 | Ga0070694_1008202312 | 66 |
| 197 | 3300005457 | Ga0070662_100000006 | Ga0070662_10000000699 | 66 |
| 198 | 3300005471 | Ga0070698_100639302 | Ga0070698_1006393022 | 66 |
| 199 | 3300005471 | Ga0070698_101101299 | Ga0070698_1011012992 | 66 |
| 200 | 3300005518 | Ga0070699_101426029 | Ga0070699_1014260292 | 66 |
| 201 | 3300005535 | Ga0070684_100446177 | Ga0070684_1004461772 | 66 |
| 202 | 3300005539 | Ga0068853_102042269 | Ga0068853_1020422691 | 66 |
| 203 | 3300005545 | Ga0070695_100539396 | Ga0070695_1005393961 | 66 |
| 204 | 3300005545 | Ga0070695_101455039 | Ga0070695_1014550392 | 66 |
| 205 | 3300005546 | Ga0070696_100685701 | Ga0070696_1006857013 | 66 |
| 206 | 3300005546 | Ga0070696_100858215 | Ga0070696_1008582152 | 66 |
| 207 | 3300005549 | Ga0070704_102093518 | Ga0070704_1020935182 | 66 |
| 208 | 3300005615 | Ga0070702_100663886 | Ga0070702_1006638861 | 66 |
| 209 | 3300005718 | Ga0068866_10993587 | Ga0068866_109935871 | 66 |
| 210 | 3300005834 | Ga0068851_10100255 | Ga0068851_101002553 | 66 |
| 211 | 3300005937 | Ga0081455_10009454 | Ga0081455_1000945414 | 66 |
| 212 | 3300005937 | Ga0081455_10025792 | Ga0081455_100257925 | 66 |
| 213 | 3300005937 | Ga0081455_10336533 | Ga0081455_103365333 | 66 |
| 214 | 3300005981 | Ga0081538_10000002 | Ga0081538_10000002169 | 66 |
| 215 | 3300006038 | Ga0075365_10079464 | Ga0075365_100794642 | 66 |
| 216 | 3300006048 | Ga0075363_100194976 | Ga0075363_1001949762 | 66 |
| 217 | 3300006178 | Ga0075367_10131342 | Ga0075367_101313423 | 66 |
| 218 | 3300006358 | Ga0068871_100309327 | Ga0068871_1003093272 | 66 |
| 219 | 3300006846 | Ga0075430_100306266 | Ga0075430_1003062662 | 66 |
| 220 | 3300006852 | Ga0075433_10580051 | Ga0075433_105800512 | 66 |
| 221 | 3300006871 | Ga0075434_100193981 | Ga0075434_1001939813 | 66 |
| 222 | 3300006871 | Ga0075434_100420993 | Ga0075434_1004209932 | 66 |
| 223 | 3300006881 | Ga0068865_101026704 | Ga0068865_1010267042 | 66 |
| 224 | 3300006914 | Ga0075436_101127732 | Ga0075436_1011277322 | 66 |
| 225 | 3300006914 | Ga0075436_101489416 | Ga0075436_1014894161 | 66 |
| 226 | 3300009036 | Ga0105244_10291418 | Ga0105244_102914183 | 66 |
| 227 | 3300009094 | Ga0111539_10336004 | Ga0111539_103360043 | 66 |
| 228 | 3300009094 | Ga0111539_12022421 | Ga0111539_120224211 | 66 |
| 229 | 3300009094 | Ga0111539_12157165 | Ga0111539_121571652 | 66 |
| 230 | 3300009098 | Ga0105245_10491819 | Ga0105245_104918191 | 66 |
| 231 | 3300009101 | Ga0105247_11690529 | Ga0105247_116905292 | 66 |
| 232 | 3300009147 | Ga0114129_10641529 | Ga0114129_106415293 | 66 |
| 233 | 3300009147 | Ga0114129_10729804 | Ga0114129_107298043 | 66 |
| 234 | 3300009148 | Ga0105243_10984532 | Ga0105243_109845322 | 66 |
| 235 | 3300009148 | Ga0105243_11069138 | Ga0105243_110691382 | 66 |
| 236 | 3300009148 | Ga0105243_11731823 | Ga0105243_117318232 | 66 |
| 237 | 3300009176 | Ga0105242_10279058 | Ga0105242_102790583 | 66 |
| 238 | 3300009553 | Ga0105249_10228852 | Ga0105249_102288521 | 66 |
| 239 | 3300009553 | Ga0105249_11303999 | Ga0105249_113039992 | 66 |
| 240 | 3300010375 | Ga0105239_11246827 | Ga0105239_112468272 | 66 |
| 241 | 3300010375 | Ga0105239_13283960 | Ga0105239_132839601 | 66 |
| 242 | 3300013296 | Ga0157374_10002572 | Ga0157374_100025723 | 66 |
| 243 | 3300013306 | Ga0163162_10508945 | Ga0163162_105089452 | 66 |
| 244 | 3300013306 | Ga0163162_12187712 | Ga0163162_121877122 | 66 |
| 245 | 3300013308 | Ga0157375_11383640 | Ga0157375_113836402 | 66 |
| 246 | 3300014325 | Ga0163163_10215435 | Ga0163163_102154353 | 66 |
| 247 | 3300014969 | Ga0157376_12130436 | Ga0157376_121304362 | 66 |
| 248 | 3300021384 | Ga0213876_10036671 | Ga0213876_100366712 | 66 |
| 249 | 3300021388 | Ga0213875_10074736 | Ga0213875_100747362 | 66 |
| 250 | 3300025315 | Ga0207697_10330388 | Ga0207697_103303882 | 66 |
| 251 | 3300025893 | Ga0207682_10000408 | Ga0207682_100004084 | 66 |
| 252 | 3300025916 | Ga0207663_10007602 | Ga0207663_100076025 | 66 |
| 253 | 3300025927 | Ga0207687_10349377 | Ga0207687_103493772 | 66 |
| 254 | 3300025933 | Ga0207706_10000017 | Ga0207706_1000001799 | 66 |
| 255 | 3300025935 | Ga0207709_10184730 | Ga0207709_101847302 | 66 |
| 256 | 3300025937 | Ga0207669_11953970 | Ga0207669_119539702 | 66 |
| 257 | 3300025938 | Ga0207704_10420465 | Ga0207704_104204652 | 66 |
| 258 | 3300025938 | Ga0207704_11817177 | Ga0207704_118171772 | 66 |
| 259 | 3300025944 | Ga0207661_10089580 | Ga0207661_100895803 | 66 |
| 260 | 3300025961 | Ga0207712_10060307 | Ga0207712_100603073 | 66 |
| 261 | 3300026023 | Ga0207677_10000299 | Ga0207677_1000029917 | 66 |
| 262 | 3300026089 | Ga0207648_10543159 | Ga0207648_105431593 | 66 |
| 263 | 3300026118 | Ga0207675_101485085 | Ga0207675_1014850852 | 66 |
| 264 | 3300026121 | Ga0207683_12140184 | Ga0207683_121401842 | 66 |
| 265 | 3300028380 | Ga0268265_10118604 | Ga0268265_101186043 | 66 |
| 266 | 3300028381 | Ga0268264_10544202 | Ga0268264_105442023 | 66 |
| 267 | 3300028381 | Ga0268264_12211540 | Ga0268264_122115402 | 66 |
| 268 | 3300031901 | Ga0307406_10828333 | Ga0307406_108283332 | 66 |
| 269 | 3300031901 | Ga0307406_10913219 | Ga0307406_109132192 | 66 |
| 270 | 3300031995 | Ga0307409_100241049 | Ga0307409_1002410492 | 66 |
| 271 | 3300032002 | Ga0307416_100089226 | Ga0307416_1000892264 | 66 |
| 272 | 3300032004 | Ga0307414_11288276 | Ga0307414_112882762 | 66 |
| 273 | 3300035242 | Ga0373962_0199481 | Ga0373962_0199481_417_626 | 66 |
| 274 | 3300035724 | Ga0373933_0179296 | Ga0373933_0179296_319_519 | 66 |
| 275 | 3300037853 | Ga0436364_1029426 | Ga0436364_1029426_1619_1819 | 66 |
| 276 | 3300039437 | Ga0436365_1413912 | Ga0436365_1413912_5239_5439 | 66 |
| 277 | 3300039450 | Ga0436363_0927148 | Ga0436363_0927148_403_612 | 66 |
| 278 | 3300039450 | Ga0436363_1111990 | Ga0436363_1111990_853_1056 | 66 |
| 279 | 3300039453 | Ga0436362_0719752 | Ga0436362_0719752_1996_2196 | 66 |
| 280 | 3300039453 | Ga0436362_1233701 | Ga0436362_1233701_201_404 | 66 |
| 281 | 3300044656 | Ga0466969_0086879 | Ga0466969_0086879_294_497 | 66 |
| 282 | 3300044765 | Ga0466970_0159822 | Ga0466970_0159822_485_688 | 66 |
| 283 | 3300044901 | Ga0466960_0552301 | Ga0466960_0552301_330_530 | 66 |
| 284 | 3300045049 | Ga0466959_0007719 | Ga0466959_0007719_4168_4371 | 66 |
| 285 | 3300045836 | Ga0466958_1079494 | Ga0466958_1079494_141_344 | 66 |
| 286 | 3300046454 | Ga0495592_0027224 | Ga0495592_0027224_3908_4108 | 66 |
| 287 | 3300046459 | Ga0495629_0315841 | Ga0495629_0315841_567_767 | 66 |
| 288 | 3300046459 | Ga0495629_0686643 | Ga0495629_0686643_322_522 | 66 |
| 289 | 3300046461 | Ga0495641_0094927 | Ga0495641_0094927_961_1170 | 66 |
| 290 | 3300046462 | Ga0495651_0307021 | Ga0495651_0307021_476_676 | 66 |
| 291 | 3300046462 | Ga0495651_0320283 | Ga0495651_0320283_531_731 | 66 |
| 292 | 3300046463 | Ga0495653_0016152 | Ga0495653_0016152_2099_2299 | 66 |
| 293 | 3300046475 | Ga0495639_0052899 | Ga0495639_0052899_1533_1733 | 66 |
| 294 | 3300046512 | Ga0495610_0039553 | Ga0495610_0039553_678_878 | 66 |
| 295 | 3300046514 | Ga0495618_0137830 | Ga0495618_0137830_707_907 | 66 |
| 296 | 3300046516 | Ga0495628_0044680 | Ga0495628_0044680_1795_1995 | 66 |
| 297 | 3300046523 | Ga0495644_0001780 | Ga0495644_0001780_1178_1378 | 66 |
| 298 | 3300046529 | Ga0495652_0015700 | Ga0495652_0015700_1455_1655 | 66 |
| 299 | 3300046535 | Ga0495586_0001338 | Ga0495586_0001338_1363_1563 | 66 |
| 300 | 3300046536 | Ga0495587_0780811 | Ga0495587_0780811_211_411 | 66 |
| 301 | 3300046537 | Ga0495598_0014741 | Ga0495598_0014741_836_1036 | 66 |
| 302 | 3300046539 | Ga0495621_0065989 | Ga0495621_0065989_953_1153 | 66 |
| 303 | 3300046543 | Ga0495645_0139797 | Ga0495645_0139797_566_766 | 66 |
| 304 | 3300046558 | Ga0495633_0169466 | Ga0495633_0169466_51_251 | 66 |
| 305 | 3300046678 | Ga0495599_0648619 | Ga0495599_0648619_246_446 | 66 |
| 306 | 3300046679 | Ga0495623_0170750 | Ga0495623_0170750_403_603 | 66 |
| 307 | 3300046679 | Ga0495623_0245959 | Ga0495623_0245959_297_497 | 66 |
| 308 | 3300046679 | Ga0495623_0325566 | Ga0495623_0325566_437_637 | 66 |
| 309 | 3300046679 | Ga0495623_0530716 | Ga0495623_0530716_211_411 | 66 |
| 310 | 3300046680 | Ga0495646_0555032 | Ga0495646_0555032_297_497 | 66 |
| 311 | 3300046680 | Ga0495646_0672748 | Ga0495646_0672748_194_394 | 66 |
| 312 | 3300046681 | Ga0495647_0000009 | Ga0495647_0000009_46676_46876 | 66 |
| 313 | 3300046690 | Ga0495624_0000414 | Ga0495624_0000414_5156_5356 | 66 |
| 314 | 3300046691 | Ga0495670_0150708 | Ga0495670_0150708_978_1178 | 66 |
| 315 | 3300047321 | Ga0495676_0115388 | Ga0495676_0115388_1245_1445 | 66 |
| 316 | 3300047321 | Ga0495676_0291430 | Ga0495676_0291430_547_747 | 66 |
| 317 | 3300048088 | Ga0495602_0036869 | Ga0495602_0036869_2215_2415 | 66 |
| 318 | 3300048088 | Ga0495602_0214527 | Ga0495602_0214527_471_671 | 66 |
| 319 | 3300048903 | Ga0496100_0260508 | Ga0496100_0260508_1023_1223 | 66 |
| 320 | 3300048903 | Ga0496100_0480845 | Ga0496100_0480845_634_837 | 66 |
| 321 | 3300048904 | Ga0496101_0677209 | Ga0496101_0677209_478_681 | 66 |
| 322 | 3300048905 | Ga0496102_0235348 | Ga0496102_0235348_466_669 | 66 |
| 323 | 3300048905 | Ga0496102_0735560 | Ga0496102_0735560_38_241 | 66 |
| 324 | 3300048906 | Ga0496103_0166597 | Ga0496103_0166597_347_550 | 66 |
| 325 | 3300048906 | Ga0496103_0483639 | Ga0496103_0483639_425_625 | 66 |
| 326 | 3300048907 | Ga0496104_0001134 | Ga0496104_0001134_18825_19025 | 66 |
| 327 | 3300048908 | Ga0496105_0000101 | Ga0496105_0000101_44002_44202 | 66 |
| 328 | 3300048909 | Ga0496106_0239190 | Ga0496106_0239190_536_739 | 66 |
| 329 | 3300048910 | Ga0496107_0485237 | Ga0496107_0485237_452_655 | 66 |
| 330 | 3300048910 | Ga0496107_1292198 | Ga0496107_1292198_269_472 | 66 |
| 331 | 3300048911 | Ga0496108_1236792 | Ga0496108_1236792_288_491 | 66 |
| 332 | 3300048912 | Ga0496109_0205899 | Ga0496109_0205899_379_582 | 66 |
| 333 | 3300048912 | Ga0496109_1404873 | Ga0496109_1404873_11_211 | 66 |
| 334 | 3300048915 | Ga0496112_0000013 | Ga0496112_0000013_17995_18222 | 66 |
| 335 | 3300048916 | Ga0496113_0014073 | Ga0496113_0014073_5002_5202 | 66 |
| 336 | 3300048916 | Ga0496113_0896793 | Ga0496113_0896793_66_266 | 66 |
| 337 | 3300049568 | Ga0501031_0747362 | Ga0501031_0747362_184_384 | 66 |
| 338 | 3300049571 | Ga0501034_0617636 | Ga0501034_0617636_657_857 | 66 |
| 339 | 3300049575 | Ga0501039_1576911 | Ga0501039_1576911_271_474 | 66 |
| 340 | 3300049576 | Ga0501040_0415280 | Ga0501040_0415280_435_638 | 66 |
| 341 | 3300049577 | Ga0501041_0578901 | Ga0501041_0578901_486_689 | 66 |
| 342 | 3300049578 | Ga0501042_0547030 | Ga0501042_0547030_195_398 | 66 |
| 343 | 3300049579 | Ga0501043_1009065 | Ga0501043_1009065_48_251 | 66 |
| 344 | 3300049581 | Ga0501047_0235110 | Ga0501047_0235110_723_923 | 66 |
| 345 | 3300049583 | Ga0501067_0461267 | Ga0501067_0461267_421_621 | 66 |
| 346 | 3300049584 | Ga0501068_0089781 | Ga0501068_0089781_373_573 | 66 |
| 347 | 3300049584 | Ga0501068_0426258 | Ga0501068_0426258_473_676 | 66 |
| 348 | 3300049584 | Ga0501068_0565192 | Ga0501068_0565192_480_683 | 66 |
| 349 | 3300049584 | Ga0501068_0597075 | Ga0501068_0597075_423_623 | 66 |
| 350 | 3300049585 | Ga0501069_0045471 | Ga0501069_0045471_424_624 | 66 |
| 351 | 3300049585 | Ga0501069_0601305 | Ga0501069_0601305_362_565 | 66 |
| 352 | 3300049586 | Ga0501070_0074002 | Ga0501070_0074002_1246_1446 | 66 |
| 353 | 3300049586 | Ga0501070_1129829 | Ga0501070_1129829_184_384 | 66 |
| 354 | 3300049587 | Ga0501071_0115672 | Ga0501071_0115672_1733_1933 | 66 |
| 355 | 3300049588 | Ga0501072_0101631 | Ga0501072_0101631_1802_2002 | 66 |
| 356 | 3300049588 | Ga0501072_0700351 | Ga0501072_0700351_216_416 | 66 |
| 357 | 3300049589 | Ga0501073_0077894 | Ga0501073_0077894_1312_1512 | 66 |
| 358 | 3300049590 | Ga0501074_0092513 | Ga0501074_0092513_152_352 | 66 |
| 359 | 3300049590 | Ga0501074_0406618 | Ga0501074_0406618_148_348 | 66 |
| 360 | 3300049590 | Ga0501074_0584060 | Ga0501074_0584060_543_746 | 66 |
| 361 | 3300049592 | Ga0501076_0704176 | Ga0501076_0704176_141_347 | 66 |
| 362 | 3300049683 | Ga0501253_087254 | Ga0501253_087254_429_632 | 66 |
| 363 | 3300049741 | Ga0501079_0423853 | Ga0501079_0423853_474_674 | 66 |
| 364 | 3300049742 | Ga0501080_0103813 | Ga0501080_0103813_843_1043 | 66 |
| 365 | 3300049743 | Ga0501081_0395703 | Ga0501081_0395703_243_449 | 66 |
| 366 | 3300049744 | Ga0501083_0177702 | Ga0501083_0177702_763_963 | 66 |
| 367 | 3300049824 | Ga0501045_0869897 | Ga0501045_0869897_267_470 | 66 |
| 368 | 3300050491 | nmdc:mga00v17_690362_c1 | nmdc:mga00v17_690362_c1_306_512 | 66 |
| 369 | 3300050491 | nmdc:mga00v17_872791_c1 | nmdc:mga00v17_872791_c1_255_458 | 66 |
| 370 | 3300050492 | nmdc:mga0yw44_140518_c1 | nmdc:mga0yw44_140518_c1_602_805 | 66 |
| 371 | 3300050494 | nmdc:mga06z11_169323_c1 | nmdc:mga06z11_169323_c1_882_1085 | 66 |
| 372 | 3300050507 | nmdc:mga05p37_1831332_c1 | nmdc:mga05p37_1831332_c1_190_393 | 66 |
| 373 | 3300050507 | nmdc:mga05p37_2247293_c1 | nmdc:mga05p37_2247293_c1_33_236 | 66 |
| 374 | 3300050507 | nmdc:mga05p37_303467_c1 | nmdc:mga05p37_303467_c1_1080_1283 | 66 |
| 375 | 3300050509 | nmdc:mga0qj67_155893_c1 | nmdc:mga0qj67_155893_c1_544_747 | 66 |
| 376 | 3300050511 | nmdc:mga08y16_1835795_c1 | nmdc:mga08y16_1835795_c1_302_505 | 66 |
| 377 | 3300050511 | nmdc:mga08y16_556608_c1 | nmdc:mga08y16_556608_c1_202_405 | 66 |
| 378 | 3300050512 | nmdc:mga0n895_281191_c1 | nmdc:mga0n895_281191_c1_277_477 | 66 |
| 379 | 3300050512 | nmdc:mga0n895_465470_c1 | nmdc:mga0n895_465470_c1_202_405 | 66 |
| 380 | 3300050514 | nmdc:mga08x19_1297623_c1 | nmdc:mga08x19_1297623_c1_68_271 | 66 |
| 381 | 3300050515 | nmdc:mga0a205_1382231_c1 | nmdc:mga0a205_1382231_c1_144_347 | 66 |
| 382 | 3300050515 | nmdc:mga0a205_802018_c1 | nmdc:mga0a205_802018_c1_321_524 | 66 |
| 383 | 3300053077 | Ga0495601_0005548 | Ga0495601_0005548_6975_7175 | 66 |
| 384 | 3300053077 | Ga0495601_0039148 | Ga0495601_0039148_1165_1365 | 66 |
| 385 | 3300053078 | Ga0495612_0335290 | Ga0495612_0335290_197_397 | 66 |
| 386 | 3300053140 | Ga0500573_0085904 | Ga0500573_0085904_532_735 | 66 |
| 387 | 3300053140 | Ga0500573_0231856 | Ga0500573_0231856_131_334 | 66 |
| 388 | 3300054114 | Ga0501084_0359647 | Ga0501084_0359647_633_839 | 66 |
| 389 | 3300054114 | Ga0501084_1653586 | Ga0501084_1653586_167_370 | 66 |
| 390 | 3300060353 | Ga0501082_0393701 | Ga0501082_0393701_414_617 | 66 |
| 391 | 3300060353 | Ga0501082_0659342 | Ga0501082_0659342_493_693 | 66 |
| 392 | 3300061734 | Ga0530510_0684721 | Ga0530510_0684721_185_388 | 66 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6xqe-assembly1.cif.gz_18 | crystal structure of the thermus thermophilus 70s ribosome in complex with sarecycline, uaa-mrna, and deacylated p-site trna at 3.00a resolution | 0.7265 | 2 | 62 |
| 4wqu-assembly1.cif.gz_A8 | crystal structure of the thermus thermophilus 70s ribosome in complex with elongation factor g trapped by the antibiotic dityromycin | 0.7207 | 2 | 63 |
| 6cae-assembly1.cif.gz_18 | crystal structure of the thermus thermophilus 70s ribosome in complex with noso-95179 antibiotic and bound to mrna and a-, p- and e-site trnas at 2.6a resolution | 0.7205 | 2 | 61 |
| 1vy7-assembly2.cif.gz_D8 | crystal structure of the thermus thermophilus 70s ribosome in the pre-attack state of peptide bond formation containing short substrate-mimic cytidine-cytidine-puromycin in the a site and acylated trna in the p site. | 0.7203 | 2 | 61 |
| 6ndk-assembly1.cif.gz_R8 | structure of aslsufa6 a37.5 bound to the 70s a site | 0.7156 | 2 | 62 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vw4Z00 | Few Secondary Structures;Irregular;Factor Xa Inhibitor; | 0.692 | 4 | 61 | 4.10.410.60 |
| 4qs1800 | Few Secondary Structures;Irregular;Factor Xa Inhibitor; | 0.6459 | 2 | 62 | 4.10.410.60 |
| 1vw4Z00 | Few Secondary Structures;Irregular;Factor Xa Inhibitor; | 0.6403 | 4 | 61 | 4.10.410.60 |
| 3d5b800 | Few Secondary Structures;Irregular;Factor Xa Inhibitor; | 0.6394 | 2 | 63 | 4.10.410.60 |
| 4wfn300 | Few Secondary Structures;Irregular;Factor Xa Inhibitor; | 0.632 | 6 | 62 | 4.10.410.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2G2WAH3-F1-model_v4 | 50S ribosomal protein L35 | 0.8267 | 10 | 63 |
GO:0003735
GO:0005840 GO:0006412 GO:0031080 GO:1990904 |
| AF-A0A136MXF5-F1-model_v4 | Multifunctional fusion protein [Includes: Translation initiation factor IF-3; Large ribosomal subunit protein bL35] | 0.8235 | 1 | 63 |
GO:0003735
GO:0003743 GO:0005829 GO:0005840 GO:0016020 GO:0032790 GO:0043022 GO:1990904 |
| AF-A0A6L7Y510-F1-model_v4 | 50S ribosomal protein L35 | 0.7996 | 4 | 61 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7R9AID9-F1-model_v4 | Large ribosomal subunit protein bL20c | 0.788 | 1 | 63 |
GO:0003735
GO:0003743 GO:0005829 GO:0005840 GO:0016020 GO:0019843 GO:0032790 GO:0043022 GO:1990904 |
| AF-A0A1R3HF44-F1-model_v4 | 50S ribosomal protein L35 | 0.7873 | 3 | 59 |
GO:0003735
GO:0005840 GO:0006412 GO:0031080 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar