F432416

General Info

Members Datasets Scaffolds Average Seq Length
392 295 218 373

Family's Representative Sequence

Representative Sequence 3300049132|Ga0501343_000122|Ga0501343_000122_534_1730
Length 398
Sequence MFKKFHLCVLRIKNCWEDYEMRFIIQRDRLVQSVQDVMKAVTSRTTIPILTGIKITASSEGVTLTGSDSDISIESFIPNEEDGDEIVEIKQAGSIVLQAKFFSEIVKKLPTDSVEIEVLGSLQTVIRSGKSEFNLNGLDAEEYPHLPQIEENNKFHIATDLLKMMIRQTFFAVSTSETRPILTGVNWKIENGELNCIATDSHRLALRKAKIEIENNESYNVVIPGKSLNELSKIIDDSNELIDIVITENQILFKAKHLLFFSRLLEGNYPDTSRLIPSESKTDIIVNTKDFLHAIDRASLLAREGRNNVVKLSTIDGGVIEISSNTPEVGKVVEEIQSQSIDGEELKISFSAKYMMDALKALEGTDIRVSFTGAMRPFVINPLHDETTLQLILPVRTY

Samples

Sample ID Description Type Environment
1 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
2 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
3 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
4 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
5 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
6 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
7 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
8 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
9 2554235283 Bacillus safensis VK Isolate Rhizosphere
10 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
11 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
12 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
13 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
14 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
15 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
16 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
17 2600255229 Lactobacillus acidophilus A 16 Isolate Rhizosphere
18 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
19 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
20 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
21 2643221729 Bacillus sp. Root11 Isolate Unclassified
22 2643221730 Bacillus sp. Root131 Isolate Unclassified
23 2643221731 Bacillus sp. Root147 Isolate Unclassified
24 2643221732 Bacillus sp. Root239 Isolate Unclassified
25 2643221735 Bacillus sp. Root920 Isolate Unclassified
26 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
27 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
28 2671180694 Paenibacillus sp. A3 Isolate Unclassified
29 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
30 2684622632 Bacillus cereus 905 Isolate Unclassified
31 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
32 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
33 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
34 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
35 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
36 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
37 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
38 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
39 2738541295 Bacillus sp. OK085 Isolate Unclassified
40 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
41 2738541358 Bacillus sp. OV752 Isolate Unclassified
42 2738543006 Bacillus sp. OK077 Isolate Unclassified
43 2738543010 Bacillus sp. YR335 Isolate Unclassified
44 2738543017 Bacillus sp. OV186 Isolate Unclassified
45 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
46 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
47 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
48 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
49 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
50 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
51 2811994870 Bacillus sp. JB4 Isolate Unclassified
52 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
53 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
54 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
55 2818991441 Niallia circulans 3243 Isolate Rhizosphere
56 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
57 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
58 2818991459 Paenibacillus sp. 597 Isolate Unclassified
59 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
60 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
61 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
62 2842682962 Bacillus sp. R-72492 Isolate Unclassified
63 2842882022 Bacillus sp. R-71893 Isolate Unclassified
64 2849139964 Bacillus sp. R-71875 Isolate Unclassified
65 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
66 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
67 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
68 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
69 2857581216 Bacillus sp. R-71922 Isolate Unclassified
70 2857586860 Bacillus sp. R-71935 Isolate Unclassified
71 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
72 2858438669 Leuconostoc mesenteroides YL48 Isolate Unclassified
73 2860837431 Bacillus sp. WR11 Isolate Unclassified
74 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
75 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
76 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
77 2881633906 Lactiplantibacillus garii FI11369 Isolate Unclassified
78 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
79 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
80 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
81 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
82 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
83 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
84 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
85 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
86 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
87 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
88 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
89 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
90 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
91 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
92 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
93 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
94 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
95 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
96 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
97 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
98 2919720352 Priestia megaterium 4340 Isolate Unclassified
99 2919726948 Bacillus pumilus 4489 Isolate Unclassified
100 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
101 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
102 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
103 2928519762 Leuconostoc citreum 1377 Isolate Rhizosphere
104 2929004312 Priestia megaterium 1104 Isolate Unclassified
105 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
106 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
107 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
108 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
109 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
110 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
111 2938917290 Bacillus sp. CR71 Isolate Unclassified
112 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
113 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
114 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
115 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
116 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
117 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
118 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
119 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
120 2965761152 Bacillus sp. COPE52 Isolate Unclassified
121 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
122 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
123 2969141011 Bacillus velezensis MH25 Isolate Unclassified
124 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
125 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
126 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
127 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
128 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
129 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
130 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
131 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
132 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
133 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
134 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
135 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
136 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
137 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
138 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
139 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
140 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
141 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
142 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
143 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
144 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
145 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
146 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
147 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
148 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
149 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
150 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
151 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
152 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
153 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
154 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
155 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
156 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
157 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
158 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
159 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
160 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
161 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
162 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
163 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
164 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
165 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
166 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
167 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
168 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
169 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
170 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
171 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
172 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
173 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
174 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
175 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
176 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
177 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
178 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
179 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
180 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
185 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
187 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
194 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
209 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
210 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
211 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
214 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
215 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
216 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
233 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
234 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
270 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
271 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
272 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
273 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
274 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
275 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
276 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
277 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
278 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
279 8022653035 Bacillus sp. Rc4 Isolate Unclassified
280 8022792930 Bacillus sp. Xin Isolate Rhizosphere
281 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
282 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
283 8023438354 Bacillus sp. BH2 Isolate Unclassified
284 8023444577 Bacillus sp. BH32 Isolate Unclassified
285 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
286 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
287 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
288 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
289 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
290 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
291 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
292 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
293 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
294 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
295 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 39.29
Metatranscriptomes 16.33
Isolates 44.39

Biome Distribution

Category Percentage (%)
Aerial Root 0.51
Bulb 0
Endosphere 13.27
Nodule 0.51
Rhizoplane 4.59
Rhizosphere 53.83
Stem 0
Stem Tuber 0
Unclassified 27.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1002685 3300002987 Bacteria 6620
2 JGI25159J45721_1009791 3300002987 Bacteria 2499
3 JGI25159J45721_1011375 3300002987 Bacteria 2187
4 JGI25151J46595_10001393 3300003187 Bacteria 16645
5 JGI25151J46595_10003384 3300003187 Bacteria 8822
6 JGI25151J46595_10003459 3300003187 Bacteria 8718
7 JGI25151J46595_10013495 3300003187 Bacteria 3675
8 JGI25151J46595_10016701 3300003187 Bacteria 3203
9 JGI25151J46595_10018507 3300003187 Bacteria 2988
10 JGI25151J46595_10028591 3300003187 Bacteria 2218
11 JGI25151J46595_10029236 3300003187 Bacteria 2185
12 JGI25151J46595_10033407 3300003187 Bacteria 1982
13 rootH1_10005976 3300003316 Bacteria 41135
14 rootL2_10004159 3300003322 Bacteria 42129
15 Ga0006562J51391_1001320 3300003578 Bacteria 23330
16 Ga0006562J51391_1001321 3300003578 Bacteria 11660
17 Ga0006562J51391_1001739 3300003578 Bacteria 9400
18 Ga0006562J51391_1018242 3300003578 Bacteria 1257
19 Ga0055538_1000734 3300003751 Bacteria 9608
20 Ga0055532_1000226 3300003758 Bacteria 42563
21 Ga0055532_1001570 3300003758 Bacteria 6095
22 Ga0055536_1006742 3300003781 Bacteria 5269
23 Ga0055541_1000529 3300003841 Bacteria 10526
24 Ga0070670_100041506 3300005331 Bacteria 3955
25 Ga0070669_100267925 3300005353 Bacteria 1365
26 Ga0070675_100173375 3300005354 Bacteria 1861
27 Ga0070671_100017732 3300005355 Bacteria 5772
28 Ga0105251_10022298 3300009011 Bacteria 3290
29 Ga0105244_10008260 3300009036 Bacteria 6516
30 Ga0105244_10016169 3300009036 Bacteria 4257
31 Ga0105244_10017637 3300009036 Bacteria 4029
32 Ga0105244_10069481 3300009036 Bacteria 1758
33 Ga0105250_10004058 3300009092 Bacteria 6811
34 Ga0105250_10007217 3300009092 Bacteria 4787
35 Ga0105250_10025546 3300009092 Bacteria 2380
36 Ga0105250_10072326 3300009092 Bacteria 1394
37 Ga0105245_10008978 3300009098 Bacteria 8719
38 Ga0105247_10002982 3300009101 Bacteria 11227
39 Ga0105243_10001225 3300009148 Bacteria 23108
40 Ga0105239_10245401 3300010375 Bacteria 2010
41 Ga0105246_10034945 3300011119 Bacteria 3354
42 Ga0157371_10002410 3300013102 Bacteria 17889
43 Ga0157371_10023355 3300013102 Bacteria 4522
44 Ga0157371_10146208 3300013102 Bacteria 1684
45 Ga0157372_10032104 3300013307 Bacteria 5755
46 Ga0157377_10017104 3300014745 Bacteria 3745
47 Ga0209784_100044 3300025224 Bacteria 206858
48 Ga0209566_100046 3300025225 Bacteria 247053
49 Ga0209147_100062 3300025229 Bacteria 242831
50 Ga0209147_100154 3300025229 Bacteria 94574
51 Ga0209147_100668 3300025229 Bacteria 17761
52 Ga0209147_100877 3300025229 Bacteria 13848
53 Ga0209147_103825 3300025229 Bacteria 2735
54 Ga0209673_1005622 3300025273 Bacteria 6262
55 Ga0209130_1002321 3300025284 Bacteria 9713
56 Ga0209130_1002495 3300025284 Bacteria 9107
57 Ga0209130_1005120 3300025284 Bacteria 4665
58 Ga0209676_1001113 3300025292 Bacteria 29797
59 Ga0209676_1007123 3300025292 Bacteria 5341
60 Ga0209676_1024648 3300025292 Bacteria 1943
61 Ga0209025_1000011 3300025294 Bacteria 976387
62 Ga0209025_1000904 3300025294 Bacteria 46012
63 Ga0209025_1001469 3300025294 Bacteria 30708
64 Ga0209025_1003298 3300025294 Bacteria 15530
65 Ga0209025_1003438 3300025294 Bacteria 14994
66 Ga0209025_1004814 3300025294 Bacteria 11415
67 Ga0209025_1006039 3300025294 Bacteria 9580
68 Ga0209025_1006703 3300025294 Bacteria 8838
69 Ga0209025_1007206 3300025294 Bacteria 8377
70 Ga0209025_1011258 3300025294 Bacteria 5920
71 Ga0209025_1013703 3300025294 Bacteria 5067
72 Ga0209025_1015001 3300025294 Bacteria 4711
73 Ga0209025_1015213 3300025294 Bacteria 4661
74 Ga0209025_1021196 3300025294 Bacteria 3513
75 Ga0209025_1024850 3300025294 Bacteria 3076
76 Ga0209025_1053850 3300025294 Bacteria 1573
77 Ga0209025_1053851 3300025294 Bacteria 1573
78 Ga0209025_1056581 3300025294 Bacteria 1506
79 Ga0209025_1060368 3300025294 Bacteria 1424
80 Ga0207696_1001066 3300025711 Bacteria 16181
81 Ga0207696_1004018 3300025711 Bacteria 6458
82 Ga0207696_1004193 3300025711 Bacteria 6275
83 Ga0207696_1009071 3300025711 Bacteria 3731
84 Ga0207655_1002077 3300025728 Bacteria 16812
85 Ga0207655_1036778 3300025728 Bacteria 2167
86 Ga0207713_1000488 3300025735 Bacteria 40997
87 Ga0207713_1003977 3300025735 Bacteria 9798
88 Ga0207709_10008350 3300025935 Bacteria 5733
89 Ga0209371_1002761 3300027312 Bacteria 9406
90 Ga0268266_10325864 3300028379 Bacteria 1439
91 Ga0237817_10091 3300030083 Bacteria 27928
92 Ga0237817_10166 3300030083 Bacteria 18982
93 Ga0268256_1005382 3300030500 Bacteria 5028
94 Ga0307408_100006045 3300031548 Bacteria 8052
95 Ga0307405_10036571 3300031731 Bacteria 2943
96 Ga0307409_100004669 3300031995 Bacteria 7746
97 Ga0307416_100026691 3300032002 Bacteria 4260
98 Ga0395899_0078704 3300037312 Bacteria 2402
99 Ga0395899_0128719 3300037312 Bacteria 1809
100 Ga0237819_00243 3300038705 Bacteria 19822
101 Ga0237819_00890 3300038705 Bacteria 9330
102 Ga0451577_0019161 3300042876 Bacteria 6294
103 Ga0466969_0001556 3300044656 Bacteria 12321
104 Ga0466961_0018617 3300044693 Bacteria 4468
105 Ga0453684_0000022 3300044712 Bacteria 860785
106 Ga0466968_0011268 3300044735 Bacteria 3481
107 Ga0466959_0002736 3300045049 Bacteria 11349
108 Ga0466967_0017548 3300045976 Bacteria 5688
109 Ga0495627_013773 3300046453 Bacteria 2840
110 Ga0495605_0030763 3300046474 Bacteria 2749
111 Ga0495584_0020568 3300046491 Bacteria 3351
112 Ga0495585_0011968 3300046492 Bacteria 5122
113 Ga0495631_0106302 3300046518 Bacteria 1207
114 Ga0495654_0106874 3300046530 Bacteria 1281
115 Ga0495622_0023865 3300046557 Bacteria 2853
116 Ga0495661_0070741 3300046665 Bacteria 2041
117 Ga0495661_0124928 3300046665 Bacteria 1417
118 Ga0495649_0040393 3300046694 Bacteria 2555
119 Ga0496100_0006851 3300048903 Bacteria 6242
120 Ga0496101_0327183 3300048904 Bacteria 1203
121 Ga0496102_0003030 3300048905 Bacteria 14222
122 Ga0496103_0009903 3300048906 Bacteria 5637
123 Ga0496103_0155298 3300048906 Bacteria 1466
124 Ga0496105_0000371 3300048908 Bacteria 29690
125 Ga0496106_0002237 3300048909 Bacteria 14432
126 Ga0496107_0000298 3300048910 Bacteria 26473
127 Ga0496108_0002091 3300048911 Bacteria 15968
128 Ga0496109_0001637 3300048912 Bacteria 18710
129 Ga0496110_0000276 3300048913 Bacteria 33352
130 Ga0496110_0005958 3300048913 Bacteria 9596
131 Ga0496111_0003343 3300048914 Bacteria 9917
132 Ga0496112_0018156 3300048915 Bacteria 6619
133 Ga0496113_0002424 3300048916 Bacteria 10841
134 Ga0496113_0079976 3300048916 Bacteria 2503
135 Ga0496116_0001211 3300048919 Bacteria 30120
136 Ga0496116_0060709 3300048919 Bacteria 2451
137 Ga0496117_0033616 3300048920 Bacteria 3875
138 Ga0496117_0132965 3300048920 Bacteria 1504
139 Ga0496119_0002345 3300048922 Bacteria 20856
140 Ga0496119_0003886 3300048922 Bacteria 15208
141 Ga0496120_0005619 3300048923 Bacteria 9933
142 Ga0496120_0103431 3300048923 Bacteria 1500
143 Ga0496122_0002911 3300048925 Bacteria 23381
144 Ga0496122_0175481 3300048925 Bacteria 1285
145 Ga0496124_0000258 3300048927 Bacteria 101956
146 Ga0496124_0056655 3300048927 Bacteria 3305
147 Ga0496125_0004002 3300048928 Bacteria 17332
148 Ga0496126_0001383 3300048929 Bacteria 38393
149 Ga0496126_0052089 3300048929 Bacteria 3722
150 Ga0496126_0063353 3300048929 Bacteria 3314
151 Ga0501309_001528 3300049129 Bacteria 2300
152 Ga0501341_00043 3300049131 Bacteria 3285
153 Ga0501341_00267 3300049131 Bacteria 1983
154 Ga0501343_000001 3300049132 Bacteria 9737
155 Ga0501343_000122 3300049132 Bacteria 3574
156 Ga0501343_002297 3300049132 Bacteria 1356
157 Ga0501344_00054 3300049133 Bacteria 3181
158 Ga0501344_00304 3300049133 Bacteria 1934
159 Ga0501305_000117 3300049161 Bacteria 4937
160 Ga0501305_000168 3300049161 Bacteria 4471
161 Ga0501305_003569 3300049161 Bacteria 1770
162 Ga0501307_001347 3300049162 Bacteria 2049
163 Ga0501342_00025 3300049163 Bacteria 3222
164 Ga0501311_000279 3300049527 Bacteria 3221
165 Ga0501311_000407 3300049527 Bacteria 2942
166 Ga0501312_000155 3300049528 Bacteria 4458
167 Ga0501312_000699 3300049528 Bacteria 2878
168 Ga0501312_003368 3300049528 Bacteria 1807
169 Ga0501313_000110 3300049529 Bacteria 4072
170 Ga0501313_000896 3300049529 Bacteria 2327
171 Ga0501315_000156 3300049531 Bacteria 3911
172 Ga0501315_000866 3300049531 Bacteria 2342
173 Ga0501315_006821 3300049531 Bacteria 1284
174 Ga0501316_000070 3300049532 Bacteria 4709
175 Ga0501316_000206 3300049532 Bacteria 3543
176 Ga0501316_004506 3300049532 Bacteria 1401
177 Ga0501317_000095 3300049533 Bacteria 4518
178 Ga0501317_000753 3300049533 Bacteria 2475
179 Ga0501317_005250 3300049533 Bacteria 1380
180 Ga0501318_000811 3300049534 Bacteria 2182
181 Ga0501318_001890 3300049534 Bacteria 1735
182 Ga0501319_001514 3300049535 Bacteria 1358
183 Ga0501321_000221 3300049537 Bacteria 3262
184 Ga0501321_001041 3300049537 Bacteria 2083
185 Ga0501321_002065 3300049537 Bacteria 1695
186 Ga0501322_000426 3300049538 Bacteria 1966
187 Ga0501323_000355 3300049539 Bacteria 3262
188 Ga0501323_001837 3300049539 Bacteria 1965
189 Ga0501324_001973 3300049540 Bacteria 1441
190 Ga0501326_00225 3300049542 Bacteria 2079
191 Ga0501327_00165 3300049543 Bacteria 2205
192 Ga0501327_00388 3300049543 Bacteria 1712
193 Ga0501330_000053 3300049546 Bacteria 3105
194 Ga0501330_000779 3300049546 Bacteria 1490
195 Ga0501331_00033 3300049547 Bacteria 3725
196 Ga0501331_00697 3300049547 Bacteria 1459
197 Ga0501332_00016 3300049548 Bacteria 4500
198 Ga0501333_000031 3300049549 Bacteria 3879
199 Ga0501333_000471 3300049549 Bacteria 1855
200 Ga0501334_00030 3300049550 Bacteria 4329
201 Ga0501334_01512 3300049550 Bacteria 1294
202 Ga0501335_000066 3300049551 Bacteria 4419
203 Ga0501335_000225 3300049551 Bacteria 3169
204 Ga0501335_001320 3300049551 Bacteria 1884
205 Ga0501335_003292 3300049551 Bacteria 1361
206 Ga0501336_000036 3300049552 Bacteria 4319
207 Ga0501336_000723 3300049552 Bacteria 1762
208 Ga0501337_000100 3300049553 Bacteria 3262
209 Ga0501338_00054 3300049554 Bacteria 3416
210 Ga0501340_000212 3300049556 Bacteria 2208
211 Ga0501202_005731 3300049652 Bacteria 2203
212 Ga0501217_000098 3300049661 Bacteria 10933
213 Ga0501227_006566 3300049665 Bacteria 2498
214 Ga0501221_005623 3300049704 Bacteria 2101
215 Ga0501245_009040 3300049708 Bacteria 1426
216 Ga0501212_003348 3300049851 Bacteria 2005
217 Ga0500566_0000013 3300053094 Bacteria 115589
218 Ga0500637_0000799 3300053178 Bacteria 12611

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053178 Ga0500637_0000799 Ga0500637_0000799_4306_5436 317
2 3300053094 Ga0500566_0000013 Ga0500566_0000013_91285_92415 328
3 3300048913 Ga0496110_0000276 Ga0496110_0000276_4837_5922 346
4 3300049551 Ga0501335_003292 Ga0501335_003292_58_1143 346
5 3300048904 Ga0496101_0327183 Ga0496101_0327183_22_1107 348
6 3300049532 Ga0501316_004506 Ga0501316_004506_198_1283 348
7 3300013102 Ga0157371_10002410 Ga0157371_1000241010 351
8 3300013102 Ga0157371_10146208 Ga0157371_101462082 352
9 iso_pu_bacteria 8022621104 8022626991 354
10 3300003578 Ga0006562J51391_1018242 Ga0006562J51391_10182421 355
11 3300049132 Ga0501343_002297 Ga0501343_002297_234_1319 355
12 3300049547 Ga0501331_00697 Ga0501331_00697_268_1353 355
13 3300042876 Ga0451577_0019161 Ga0451577_0019161_4598_5692 357
14 3300044712 Ga0453684_0000022 Ga0453684_0000022_339887_340981 357
15 3300013102 Ga0157371_10023355 Ga0157371_100233552 358
16 3300049161 Ga0501305_003569 Ga0501305_003569_187_1323 358
17 3300049528 Ga0501312_003368 Ga0501312_003368_417_1553 358
18 3300049533 Ga0501317_005250 Ga0501317_005250_59_1195 358
19 3300049537 Ga0501321_002065 Ga0501321_002065_250_1386 358
20 3300049543 Ga0501327_00388 Ga0501327_00388_422_1558 358
21 3300049552 Ga0501336_000723 Ga0501336_000723_179_1315 358
22 3300003758 Ga0055532_1001570 Ga0055532_10015707 359
23 3300025229 Ga0209147_100154 Ga0209147_1001545 359
24 3300009036 Ga0105244_10069481 Ga0105244_100694812 361
25 3300049538 Ga0501322_000426 Ga0501322_000426_663_1799 362
26 3300025294 Ga0209025_1015213 Ga0209025_10152133 363
27 3300046474 Ga0495605_0030763 Ga0495605_0030763_458_1594 364
28 3300046530 Ga0495654_0106874 Ga0495654_0106874_94_1230 364
29 3300046557 Ga0495622_0023865 Ga0495622_0023865_841_1977 364
30 3300046665 Ga0495661_0124928 Ga0495661_0124928_168_1304 364
31 3300046694 Ga0495649_0040393 Ga0495649_0040393_470_1606 364
32 iso_pu_bacteria 2600255229 2601446584 364
33 3300027312 Ga0209371_1002761 Ga0209371_10027612 365
34 3300030500 Ga0268256_1005382 Ga0268256_10053825 365
35 3300048916 Ga0496113_0079976 Ga0496113_0079976_377_1522 365
36 3300049539 Ga0501323_000355 Ga0501323_000355_1898_3031 365
37 iso_pu_bacteria 2928519762 2928520818 365
38 3300003187 JGI25151J46595_10003384 JGI25151J46595_100033842 366
39 3300003316 rootH1_10005976 rootH1_1000597643 366
40 3300003322 rootL2_10004159 rootL2_1000415942 366
41 3300003578 Ga0006562J51391_1001739 Ga0006562J51391_10017392 366
42 3300005331 Ga0070670_100041506 Ga0070670_1000415062 366
43 3300005355 Ga0070671_100017732 Ga0070671_1000177323 366
44 3300009098 Ga0105245_10008978 Ga0105245_100089787 366
45 3300009101 Ga0105247_10002982 Ga0105247_100029825 366
46 3300009148 Ga0105243_10001225 Ga0105243_1000122517 366
47 3300010375 Ga0105239_10245401 Ga0105239_102454011 366
48 3300013307 Ga0157372_10032104 Ga0157372_100321042 366
49 3300014745 Ga0157377_10017104 Ga0157377_100171042 366
50 3300025229 Ga0209147_100668 Ga0209147_1006685 366
51 3300025273 Ga0209673_1005622 Ga0209673_10056222 366
52 3300025294 Ga0209025_1053850 Ga0209025_10538502 366
53 3300025294 Ga0209025_1053851 Ga0209025_10538511 366
54 3300025735 Ga0207713_1000488 Ga0207713_100048838 366
55 3300025935 Ga0207709_10008350 Ga0207709_100083506 366
56 3300028379 Ga0268266_10325864 Ga0268266_103258642 366
57 3300031548 Ga0307408_100006045 Ga0307408_1000060456 366
58 3300031731 Ga0307405_10036571 Ga0307405_100365713 366
59 3300031995 Ga0307409_100004669 Ga0307409_1000046695 366
60 3300032002 Ga0307416_100026691 Ga0307416_1000266915 366
61 3300046491 Ga0495584_0020568 Ga0495584_0020568_1992_3128 366
62 3300046492 Ga0495585_0011968 Ga0495585_0011968_1765_2901 366
63 3300046518 Ga0495631_0106302 Ga0495631_0106302_14_1150 366
64 3300046665 Ga0495661_0070741 Ga0495661_0070741_842_1978 366
65 3300048903 Ga0496100_0006851 Ga0496100_0006851_4677_5813 366
66 3300048906 Ga0496103_0009903 Ga0496103_0009903_482_1618 366
67 3300048908 Ga0496105_0000371 Ga0496105_0000371_323_1459 366
68 3300048909 Ga0496106_0002237 Ga0496106_0002237_6525_7661 366
69 3300048910 Ga0496107_0000298 Ga0496107_0000298_18800_19936 366
70 3300048911 Ga0496108_0002091 Ga0496108_0002091_3597_4733 366
71 3300048912 Ga0496109_0001637 Ga0496109_0001637_17336_18472 366
72 3300048913 Ga0496110_0005958 Ga0496110_0005958_3912_5048 366
73 3300048914 Ga0496111_0003343 Ga0496111_0003343_4040_5176 366
74 3300048915 Ga0496112_0018156 Ga0496112_0018156_2489_3625 366
75 3300048916 Ga0496113_0002424 Ga0496113_0002424_3119_4255 366
76 3300048919 Ga0496116_0001211 Ga0496116_0001211_28504_29640 366
77 3300048920 Ga0496117_0033616 Ga0496117_0033616_1867_3003 366
78 3300048922 Ga0496119_0003886 Ga0496119_0003886_7509_8645 366
79 3300048923 Ga0496120_0103431 Ga0496120_0103431_72_1208 366
80 3300048927 Ga0496124_0056655 Ga0496124_0056655_1885_3021 366
81 3300048928 Ga0496125_0004002 Ga0496125_0004002_15743_16879 366
82 3300048929 Ga0496126_0001383 Ga0496126_0001383_30646_31782 366
83 3300049129 Ga0501309_001528 Ga0501309_001528_412_1548 366
84 3300049131 Ga0501341_00043 Ga0501341_00043_1408_2544 366
85 3300049132 Ga0501343_000001 Ga0501343_000001_6712_7848 366
86 3300049133 Ga0501344_00054 Ga0501344_00054_233_1369 366
87 3300049161 Ga0501305_000117 Ga0501305_000117_1923_3059 366
88 3300049161 Ga0501305_000168 Ga0501305_000168_1898_3034 366
89 3300049162 Ga0501307_001347 Ga0501307_001347_246_1382 366
90 3300049163 Ga0501342_00025 Ga0501342_00025_184_1320 366
91 3300049527 Ga0501311_000279 Ga0501311_000279_1413_2549 366
92 3300049528 Ga0501312_000155 Ga0501312_000155_1833_2969 366
93 3300049529 Ga0501313_000110 Ga0501313_000110_1500_2636 366
94 3300049531 Ga0501315_000156 Ga0501315_000156_1335_2471 366
95 3300049532 Ga0501316_000070 Ga0501316_000070_1439_2575 366
96 3300049533 Ga0501317_000095 Ga0501317_000095_1898_3034 366
97 3300049534 Ga0501318_001890 Ga0501318_001890_501_1637 366
98 3300049535 Ga0501319_001514 Ga0501319_001514_39_1175 366
99 3300049537 Ga0501321_000221 Ga0501321_000221_232_1368 366
100 3300049540 Ga0501324_001973 Ga0501324_001973_178_1314 366
101 3300049542 Ga0501326_00225 Ga0501326_00225_663_1799 366
102 3300049547 Ga0501331_00033 Ga0501331_00033_1156_2292 366
103 3300049548 Ga0501332_00016 Ga0501332_00016_1880_3016 366
104 3300049549 Ga0501333_000031 Ga0501333_000031_1264_2400 366
105 3300049550 Ga0501334_00030 Ga0501334_00030_1708_2844 366
106 3300049551 Ga0501335_000066 Ga0501335_000066_1451_2587 366
107 3300049552 Ga0501336_000036 Ga0501336_000036_1686_2822 366
108 3300049553 Ga0501337_000100 Ga0501337_000100_1890_3026 366
109 3300049554 Ga0501338_00054 Ga0501338_00054_742_1878 366
110 3300049556 Ga0501340_000212 Ga0501340_000212_218_1354 366
111 3300049652 Ga0501202_005731 Ga0501202_005731_860_1996 366
112 3300049661 Ga0501217_000098 Ga0501217_000098_6703_7839 366
113 3300049665 Ga0501227_006566 Ga0501227_006566_57_1193 366
114 3300049704 Ga0501221_005623 Ga0501221_005623_303_1439 366
115 3300049708 Ga0501245_009040 Ga0501245_009040_80_1216 366
116 3300049851 Ga0501212_003348 Ga0501212_003348_368_1504 366
117 iso_pu_bacteria 2858438669 2858439548 366
118 3300002987 JGI25159J45721_1011375 JGI25159J45721_10113752 367
119 3300025284 Ga0209130_1005120 Ga0209130_10051203 367
120 3300025294 Ga0209025_1001469 Ga0209025_100146928 367
121 3300025294 Ga0209025_1021196 Ga0209025_10211963 367
122 3300025294 Ga0209025_1060368 Ga0209025_10603681 367
123 3300025711 Ga0207696_1009071 Ga0207696_10090714 367
124 3300030083 Ga0237817_10166 Ga0237817_1016617 367
125 iso_pu_bacteria 2818991441 2819569089 367
126 iso_pu_bacteria 2881633906 2881634572 367
127 3300048925 Ga0496122_0002911 Ga0496122_0002911_14431_15558 368
128 iso_pu_bacteria 2511231119 2511697857 368
129 iso_pu_bacteria 2540341094 2540605083 368
130 iso_pu_bacteria 2545555800 2545557452 368
131 iso_pu_bacteria 2554235283 2555468980 368
132 iso_pu_bacteria 2576861599 2578931832 368
133 iso_pu_bacteria 2630968484 2631984290 368
134 iso_pu_bacteria 2643221731 2644720573 368
135 iso_pu_bacteria 2643221732 2644726344 368
136 iso_pu_bacteria 2643221735 2644740259 368
137 iso_pu_bacteria 2648501850 2651531408 368
138 iso_pu_bacteria 2671180330 2672333444 368
139 iso_pu_bacteria 2671180844 2674421246 368
140 iso_pu_bacteria 2684623153 2686995177 368
141 iso_pu_bacteria 2687453109 2687496424 368
142 iso_pu_bacteria 2695420354 2695629771 368
143 iso_pu_bacteria 2716884898 2717914538 368
144 iso_pu_bacteria 2738541295 2738813468 368
145 iso_pu_bacteria 2738541299 2738839975 368
146 iso_pu_bacteria 2738543010 2739233690 368
147 iso_pu_bacteria 2808606364 2808871029 368
148 iso_pu_bacteria 2808606399 2809054189 368
149 iso_pu_bacteria 2811994870 2812314309 368
150 iso_pu_bacteria 2816332186 2816865242 368
151 iso_pu_bacteria 2816332295 2817478040 368
152 iso_pu_bacteria 2818991451 2819627719 368
153 iso_pu_bacteria 2818991465 2819710928 368
154 iso_pu_bacteria 2818991468 2819723321 368
155 iso_pu_bacteria 2823526263 2823526264 368
156 iso_pu_bacteria 2842682962 2842687682 368
157 iso_pu_bacteria 2842882022 2842886511 368
158 iso_pu_bacteria 2849139964 2849143098 368
159 iso_pu_bacteria 2852673933 2852676368 368
160 iso_pu_bacteria 2857581216 2857582999 368
161 iso_pu_bacteria 2860837431 2860837432 368
162 iso_pu_bacteria 2877768649 2877768650 368
163 iso_pu_bacteria 2880169592 2880169593 368
164 iso_pu_bacteria 2881644220 2881648761 368
165 iso_pu_bacteria 2897109615 2897109616 368
166 iso_pu_bacteria 2904524088 2904528922 368
167 iso_pu_bacteria 2904560550 2904563426 368
168 iso_pu_bacteria 2904606771 2904609959 368
169 iso_pu_bacteria 2908665501 2908667578 368
170 iso_pu_bacteria 2919093281 2919094407 368
171 iso_pu_bacteria 2919143609 2919148554 368
172 iso_pu_bacteria 2919414237 2919416721 368
173 iso_pu_bacteria 2919517244 2919521679 368
174 iso_pu_bacteria 2919720352 2919724804 368
175 iso_pu_bacteria 2919726948 2919726954 368
176 iso_pu_bacteria 2928093941 2928098099 368
177 iso_pu_bacteria 2928510474 2928513335 368
178 iso_pu_bacteria 2929004312 2929007538 368
179 iso_pu_bacteria 2936361878 2936363549 368
180 iso_pu_bacteria 2939593269 2939597110 368
181 iso_pu_bacteria 2954773129 2954776230 368
182 iso_pu_bacteria 2960319331 2960321491 368
183 iso_pu_bacteria 2960375949 2960378274 368
184 iso_pu_bacteria 2962290636 2962290637 368
185 iso_pu_bacteria 2969136845 2969136846 368
186 iso_pu_bacteria 2969141011 2969141012 368
187 iso_pu_bacteria 2969765954 2969765962 368
188 iso_pu_bacteria 2969770375 2969770491 368
189 iso_pu_bacteria 2971893375 2971893376 368
190 iso_pu_bacteria 2977254563 2977254844 368
191 iso_pu_bacteria 2980492589 2980492591 368
192 iso_pu_bacteria 2990275345 2990275840 368
193 iso_pu_bacteria 3001267043 3001270433 368
194 iso_pu_bacteria 3001272096 3001275786 368
195 iso_pu_bacteria 3001892409 3001894267 368
196 iso_pu_bacteria 3006826541 3006831843 368
197 iso_pu_bacteria 3006858327 3006858358 368
198 iso_pu_bacteria 3006879489 3006883561 368
199 iso_pu_bacteria 3006969106 3006969892 368
200 iso_pu_bacteria 3006973921 3006977799 368
201 iso_pu_bacteria 3006978542 3006980191 368
202 iso_pu_bacteria 3006984091 3006986052 368
203 iso_pu_bacteria 3006988479 3006990112 368
204 iso_pu_bacteria 8022630665 8022632919 368
205 iso_pu_bacteria 8022653035 8022656565 368
206 iso_pu_bacteria 8022893055 8022894543 368
207 iso_pu_bacteria 8022914991 8022918344 368
208 iso_pu_bacteria 8051952484 8051953665 368
209 iso_pu_bacteria 8052174270 8052178117 368
210 iso_pu_bacteria 8054280661 8054284418 368
211 iso_pu_bacteria 8055531788 8055531789 368
212 iso_pu_bacteria 8057632132 8057632133 368
213 3300003187 JGI25151J46595_10033407 JGI25151J46595_100334073 369
214 3300009011 Ga0105251_10022298 Ga0105251_100222982 369
215 3300009036 Ga0105244_10017637 Ga0105244_100176373 369
216 3300009092 Ga0105250_10025546 Ga0105250_100255461 369
217 3300025294 Ga0209025_1003438 Ga0209025_100343811 369
218 3300025711 Ga0207696_1001066 Ga0207696_10010664 369
219 3300025728 Ga0207655_1002077 Ga0207655_10020773 369
220 3300025735 Ga0207713_1003977 Ga0207713_10039778 369
221 3300038705 Ga0237819_00890 Ga0237819_00890_6230_7375 369
222 iso_pu_bacteria 2510917027 2511177450 369
223 iso_pu_bacteria 2512564013 2512637287 369
224 iso_pu_bacteria 2512564039 2512729425 369
225 iso_pu_bacteria 2548877040 2550899822 369
226 iso_pu_bacteria 2571042143 2571531096 369
227 iso_pu_bacteria 2571042588 2573039577 369
228 iso_pu_bacteria 2576861424 2578334512 369
229 iso_pu_bacteria 2585428059 2587744500 369
230 iso_pu_bacteria 2593339198 2595319193 369
231 iso_pu_bacteria 2600255286 2601640042 369
232 iso_pu_bacteria 2643221676 2644424634 369
233 iso_pu_bacteria 2671180694 2673820752 369
234 iso_pu_bacteria 2728368933 2728533765 369
235 iso_pu_bacteria 2744054657 2745167490 369
236 iso_pu_bacteria 2816332336 2817616273 369
237 iso_pu_bacteria 2818991459 2819674381 369
238 iso_pu_bacteria 2857453340 2857458786 369
239 iso_pu_bacteria 2857460504 2857465091 369
240 iso_pu_bacteria 2857465823 2857468820 369
241 iso_pu_bacteria 2857591370 2857595783 369
242 iso_pu_bacteria 2864997549 2864998339 369
243 iso_pu_bacteria 2881636855 2881638988 369
244 iso_pu_bacteria 2888578766 2888578929 369
245 iso_pu_bacteria 2889049205 2889052539 369
246 iso_pu_bacteria 2889295896 2889299272 369
247 iso_pu_bacteria 2898907183 2898908248 369
248 iso_pu_bacteria 2904755435 2904762716 369
249 iso_pu_bacteria 2915597211 2915598414 369
250 iso_pu_bacteria 2915606848 2915612543 369
251 iso_pu_bacteria 2919425241 2919430316 369
252 iso_pu_bacteria 2925326138 2925332985 369
253 iso_pu_bacteria 2929183550 2929183551 369
254 iso_pu_bacteria 2929206907 2929206908 369
255 iso_pu_bacteria 2938649242 2938654710 369
256 iso_pu_bacteria 2968558590 2968559706 369
257 iso_pu_bacteria 2971403814 2971409808 369
258 iso_pu_bacteria 2971410472 2971414940 369
259 iso_pu_bacteria 2971511577 2971513990 369
260 iso_pu_bacteria 2980125574 2980129206 369
261 iso_pu_bacteria 2980176882 2980178795 369
262 iso_pu_bacteria 2980182181 2980183996 369
263 iso_pu_bacteria 2981284811 2981288337 369
264 iso_pu_bacteria 2981289755 2981293158 369
265 iso_pu_bacteria 2981980479 2981984156 369
266 iso_pu_bacteria 2981985349 2981989081 369
267 iso_pu_bacteria 2984527788 2984531955 369
268 iso_pu_bacteria 2984532647 2984533208 369
269 iso_pu_bacteria 2988225383 2988229432 369
270 iso_pu_bacteria 2996632988 2996636886 369
271 iso_pu_bacteria 8023438354 8023441633 369
272 iso_pu_bacteria 8054465665 8054471975 369
273 iso_pu_bacteria 8054795415 8054803403 369
274 iso_pu_bacteria 8055632911 8055636404 369
275 iso_pu_bacteria 8056533031 8056539539 369
276 iso_pu_bacteria 8057977335 8057982158 369
277 3300002987 JGI25159J45721_1009791 JGI25159J45721_10097911 370
278 3300009092 Ga0105250_10072326 Ga0105250_100723261 370
279 3300025229 Ga0209147_100877 Ga0209147_1008778 370
280 3300025284 Ga0209130_1002321 Ga0209130_10023213 370
281 3300025294 Ga0209025_1015001 Ga0209025_10150012 370
282 3300025294 Ga0209025_1024850 Ga0209025_10248502 370
283 3300025294 Ga0209025_1056581 Ga0209025_10565811 370
284 3300030083 Ga0237817_10091 Ga0237817_1009123 370
285 3300038705 Ga0237819_00243 Ga0237819_00243_12449_13594 370
286 3300045976 Ga0466967_0017548 Ga0466967_0017548_2373_3518 370
287 iso_pu_bacteria 2916971899 2916971900 370
288 iso_pu_bacteria 2964375228 2964375565 370
289 3300009092 Ga0105250_10007217 Ga0105250_100072174 371
290 3300025711 Ga0207696_1004193 Ga0207696_10041933 371
291 iso_pu_bacteria 2551306519 2553394273 371
292 iso_pu_bacteria 2593339131 2595092326 371
293 iso_pu_bacteria 2643221729 2644705633 371
294 iso_pu_bacteria 2643221730 2644712728 371
295 iso_pu_bacteria 2684622632 2685153447 371
296 iso_pu_bacteria 2695420987 2698319741 371
297 iso_pu_bacteria 2703719227 2705997368 371
298 iso_pu_bacteria 2718218445 2721503314 371
299 iso_pu_bacteria 2738541358 2739159972 371
300 iso_pu_bacteria 2738543006 2739212538 371
301 iso_pu_bacteria 2738543017 2739269293 371
302 iso_pu_bacteria 2757320391 2757566862 371
303 iso_pu_bacteria 2775507177 2777760760 371
304 iso_pu_bacteria 2775507192 2777836529 371
305 iso_pu_bacteria 2818991443 2819584940 371
306 iso_pu_bacteria 2857586860 2857589095 371
307 iso_pu_bacteria 2929233124 2929233125 371
308 iso_pu_bacteria 2936340661 2936344347 371
309 iso_pu_bacteria 2938917290 2938923389 371
310 iso_pu_bacteria 2947426588 2947426589 371
311 iso_pu_bacteria 2956897341 2956898620 371
312 iso_pu_bacteria 2965761152 2965766781 371
313 iso_pu_bacteria 2979083700 2979089144 371
314 iso_pu_bacteria 8022792930 8022793776 371
315 iso_pu_bacteria 8023444577 8023447591 371
316 iso_pu_bacteria 8057582654 8057582655 371
317 3300003187 JGI25151J46595_10001393 JGI25151J46595_100013936 372
318 3300003578 Ga0006562J51391_1001320 Ga0006562J51391_10013205 372
319 3300003578 Ga0006562J51391_1001321 Ga0006562J51391_10013216 372
320 3300003751 Ga0055538_1000734 Ga0055538_10007342 372
321 3300003781 Ga0055536_1006742 Ga0055536_10067424 372
322 3300025224 Ga0209784_100044 Ga0209784_1000447 372
323 3300025229 Ga0209147_103825 Ga0209147_1038253 372
324 3300025292 Ga0209676_1007123 Ga0209676_10071234 372
325 3300025292 Ga0209676_1024648 Ga0209676_10246481 372
326 3300025294 Ga0209025_1000011 Ga0209025_10000117 372
327 3300025294 Ga0209025_1004814 Ga0209025_10048147 372
328 3300025294 Ga0209025_1011258 Ga0209025_10112584 372
329 3300048920 Ga0496117_0132965 Ga0496117_0132965_140_1288 372
330 3300048922 Ga0496119_0002345 Ga0496119_0002345_1898_3046 372
331 3300048923 Ga0496120_0005619 Ga0496120_0005619_815_1963 372
332 3300048925 Ga0496122_0175481 Ga0496122_0175481_122_1270 372
333 3300048927 Ga0496124_0000258 Ga0496124_0000258_7132_8280 372
334 3300048929 Ga0496126_0052089 Ga0496126_0052089_615_1763 372
335 3300048929 Ga0496126_0063353 Ga0496126_0063353_1684_2832 372
336 3300049131 Ga0501341_00267 Ga0501341_00267_502_1692 372
337 3300049132 Ga0501343_000122 Ga0501343_000122_534_1730 372
338 3300049133 Ga0501344_00304 Ga0501344_00304_721_1857 372
339 3300049527 Ga0501311_000407 Ga0501311_000407_1793_2929 372
340 3300049528 Ga0501312_000699 Ga0501312_000699_535_1671 372
341 3300049529 Ga0501313_000896 Ga0501313_000896_898_2094 372
342 3300049531 Ga0501315_000866 Ga0501315_000866_642_1838 372
343 3300049531 Ga0501315_006821 Ga0501315_006821_124_1260 372
344 3300049532 Ga0501316_000206 Ga0501316_000206_584_1780 372
345 3300049533 Ga0501317_000753 Ga0501317_000753_55_1191 372
346 3300049534 Ga0501318_000811 Ga0501318_000811_748_1944 372
347 3300049537 Ga0501321_001041 Ga0501321_001041_364_1560 372
348 3300049539 Ga0501323_001837 Ga0501323_001837_79_1275 372
349 3300049543 Ga0501327_00165 Ga0501327_00165_490_1686 372
350 3300049546 Ga0501330_000053 Ga0501330_000053_1834_3030 372
351 3300049546 Ga0501330_000779 Ga0501330_000779_205_1341 372
352 3300049549 Ga0501333_000471 Ga0501333_000471_141_1337 372
353 3300049550 Ga0501334_01512 Ga0501334_01512_139_1275 372
354 3300049551 Ga0501335_000225 Ga0501335_000225_1841_2977 372
355 3300049551 Ga0501335_001320 Ga0501335_001320_126_1262 372
356 3300003187 JGI25151J46595_10016701 JGI25151J46595_100167013 373
357 3300003841 Ga0055541_1000529 Ga0055541_10005295 373
358 3300025225 Ga0209566_100046 Ga0209566_1000469 373
359 3300025294 Ga0209025_1007206 Ga0209025_10072065 373
360 3300037312 Ga0395899_0078704 Ga0395899_0078704_231_1373 373
361 3300037312 Ga0395899_0128719 Ga0395899_0128719_437_1579 373
362 3300044656 Ga0466969_0001556 Ga0466969_0001556_917_2059 373
363 3300044693 Ga0466961_0018617 Ga0466961_0018617_1745_2887 373
364 3300044735 Ga0466968_0011268 Ga0466968_0011268_742_1884 373
365 3300045049 Ga0466959_0002736 Ga0466959_0002736_6125_7267 373
366 3300046453 Ga0495627_013773 Ga0495627_013773_489_1631 373
367 3300048919 Ga0496116_0060709 Ga0496116_0060709_242_1384 373
368 3300009036 Ga0105244_10016169 Ga0105244_100161695 374
369 3300011119 Ga0105246_10034945 Ga0105246_100349452 374
370 3300025728 Ga0207655_1036778 Ga0207655_10367781 374
371 3300002987 JGI25159J45721_1002685 JGI25159J45721_10026854 375
372 3300003187 JGI25151J46595_10003459 JGI25151J46595_100034595 375
373 3300003187 JGI25151J46595_10013495 JGI25151J46595_100134952 375
374 3300003187 JGI25151J46595_10018507 JGI25151J46595_100185072 375
375 3300003187 JGI25151J46595_10028591 JGI25151J46595_100285913 375
376 3300003187 JGI25151J46595_10029236 JGI25151J46595_100292363 375
377 3300003758 Ga0055532_1000226 Ga0055532_100022639 375
378 3300005353 Ga0070669_100267925 Ga0070669_1002679251 375
379 3300005354 Ga0070675_100173375 Ga0070675_1001733753 375
380 3300009036 Ga0105244_10008260 Ga0105244_100082602 375
381 3300009092 Ga0105250_10004058 Ga0105250_100040582 375
382 3300025229 Ga0209147_100062 Ga0209147_1000626 375
383 3300025284 Ga0209130_1002495 Ga0209130_10024952 375
384 3300025292 Ga0209676_1001113 Ga0209676_100111328 375
385 3300025294 Ga0209025_1000904 Ga0209025_10009047 375
386 3300025294 Ga0209025_1003298 Ga0209025_10032989 375
387 3300025294 Ga0209025_1006039 Ga0209025_10060396 375
388 3300025294 Ga0209025_1006703 Ga0209025_10067031 375
389 3300025294 Ga0209025_1013703 Ga0209025_10137031 375
390 3300025711 Ga0207696_1004018 Ga0207696_10040184 375
391 3300048905 Ga0496102_0003030 Ga0496102_0003030_2235_3380 375
392 3300048906 Ga0496103_0155298 Ga0496103_0155298_119_1264 375

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00712

DNA_pol3_beta

DNA polymerase III beta subunit, N-terminal domain

21

147

0.99

PF02767

DNA_pol3_beta_2

DNA polymerase III beta subunit, central domain

156

271

0.99

PF02768

DNA_pol3_beta_3

DNA polymerase III beta subunit, C-terminal domain

273

396

0.97

PF00712

DNA_pol3_beta

DNA polymerase III beta subunit, N-terminal domain

153

271

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6e8d-assembly2.cif.gz_D crystal structure of the bacillus subtilis sliding clamp-mutl complex. 0.9608 1 375
6e8d-assembly1.cif.gz_C crystal structure of the bacillus subtilis sliding clamp-mutl complex. 0.9605 1 375
6e8d-assembly1.cif.gz_A crystal structure of the bacillus subtilis sliding clamp-mutl complex. 0.9603 1 375
6e8d-assembly2.cif.gz_B crystal structure of the bacillus subtilis sliding clamp-mutl complex. 0.9593 1 375
6e8d-assembly2.cif.gz_D crystal structure of the bacillus subtilis sliding clamp-mutl complex. 0.9583 1 375
ID Description Score Start End Superfamily
4tr6B01 Alpha Beta;Roll;DNA Polymerase III; Chain A, domain 2;DNA Polymerase III, subunit A, domain 2 0.9877 1 247 3.10.150.10
af_Q2G2H4_2_131_3.10.150.10 Alpha Beta;Roll;DNA Polymerase III; Chain A, domain 2;DNA Polymerase III, subunit A, domain 2 0.981 1 130 3.10.150.10
af_Q2G2H4_2_244_3.10.150.10 Alpha Beta;Roll;DNA Polymerase III; Chain A, domain 2;DNA Polymerase III, subunit A, domain 2 0.9747 1 247 3.10.150.10
af_Q2G2H4_2_131_3.10.150.10 Alpha Beta;Roll;DNA Polymerase III; Chain A, domain 2;DNA Polymerase III, subunit A, domain 2 0.9736 1 130 3.10.150.10
4tr6B01 Alpha Beta;Roll;DNA Polymerase III; Chain A, domain 2;DNA Polymerase III, subunit A, domain 2 0.9715 1 247 3.10.150.10
ID Description Score Start End GO Terms
AF-A0A5S9M2M7-F1-model_v4 DNA polymerase III subunit beta 0.9881 41 193 GO:0003677
GO:0003887
GO:0005737
GO:0006271
GO:0008408
GO:0009360
AF-W7DNG0-F1-model_v4 DNA polymerase III subunit beta 0.9873 1 130 GO:0003677
GO:0003887
GO:0005737
GO:0006271
GO:0008408
GO:0009360
AF-A0A6L7E8P5-F1-model_v4 deleted 0.9789 45 211
AF-A0A396QCY6-F1-model_v4 deleted 0.9746 1 161
AF-A0A7X8LYD4-F1-model_v4 DNA polymerase III subunit beta 0.9738 1 186 GO:0003677
GO:0003887
GO:0005737
GO:0006271
GO:0008408
GO:0009360

Feature Viewer

pLDDT pTM Quality
89.74 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map