F432328

General Info

Members Datasets Scaffolds Average Seq Length
392 227 784 266

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10149080|Ga0207665_101490802
Length 271
Sequence MTETSYAGLAGRVVLISGGASGIGAAFVRAFAAQKARVAFLDIDADAGKALVQEVTGTCGAAPLFVPCDLLDIDALQTAMLGDAAVLVNNAANDQRQVLSEVTPAEFDWMIGVNLRHVFFAAQAVVPQMQARGGGSIINMSSIGGIQAGGGVMTYRASKAAVIMFTKSSAIELAHYEVRVNAIAPGNIPTPILASSASGKDREKLESFEHAIREQMRADRPLKREGTTDDIAEAALYLAGDRSRYVTGTVLPVDGGTVAGKVLRRRTEQKD

Samples

Sample ID Description Type Environment
1 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
148 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
162 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
163 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
180 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
200 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
210 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
211 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
212 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
213 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
216 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
217 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
218 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
219 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
220 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
221 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
222 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
223 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
224 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
225 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
226 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
227 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.45
Metatranscriptomes 0
Isolates 2.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.01
Nodule 0.51
Rhizoplane 9.69
Rhizosphere 69.9
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207665_10149080 3300025939 Bacteria 1674
2 JGI24739J22299_10027138 3300001989 Bacteria 2004
3 JGI24735J21928_10044802 3300002067 Bacteria 1285
4 JGI24034J26672_10018954 3300002239 Bacteria 1071
5 JGI24742J22300_10002125 3300002244 Bacteria 3151
6 Ga0070676_10103640 3300005328 Bacteria 1761
7 Ga0070690_100023931 3300005330 Bacteria 3752
8 Ga0070670_100416785 3300005331 Bacteria 1187
9 Ga0068869_100201094 3300005334 Bacteria 1571
10 Ga0070666_10036827 3300005335 Bacteria 3250
11 Ga0070682_100068058 3300005337 Bacteria 2269
12 Ga0070682_100076368 3300005337 Bacteria 2156
13 Ga0070682_100151548 3300005337 Bacteria 1591
14 Ga0068868_100133212 3300005338 Bacteria 2035
15 Ga0068868_100478092 3300005338 Bacteria 1088
16 Ga0070660_100121697 3300005339 Bacteria 2083
17 Ga0070689_100019982 3300005340 Bacteria 4963
18 Ga0070691_10029071 3300005341 Bacteria 2585
19 Ga0070691_10210496 3300005341 Bacteria 1026
20 Ga0070687_100015244 3300005343 Bacteria 3470
21 Ga0070668_100462153 3300005347 Bacteria 1093
22 Ga0070669_100000597 3300005353 Bacteria 26784
23 Ga0070669_100037398 3300005353 Bacteria 3521
24 Ga0070675_100051359 3300005354 Bacteria 3388
25 Ga0070675_100440561 3300005354 Bacteria 1167
26 Ga0070671_100267090 3300005355 Bacteria 1454
27 Ga0070674_100034429 3300005356 Bacteria 3383
28 Ga0070674_100244151 3300005356 Bacteria 1407
29 Ga0070674_100319835 3300005356 Bacteria 1243
30 Ga0070688_100021505 3300005365 Bacteria 3769
31 Ga0070659_100064290 3300005366 Bacteria 2904
32 Ga0070667_100000388 3300005367 Bacteria 47627
33 Ga0070667_100006205 3300005367 Bacteria 9944
34 Ga0070667_100243107 3300005367 Bacteria 1608
35 Ga0070709_10012970 3300005434 Bacteria 4675
36 Ga0070709_10059843 3300005434 Bacteria 2420
37 Ga0070714_100077301 3300005435 Bacteria 2891
38 Ga0070714_100203695 3300005435 Bacteria 1811
39 Ga0070710_10006167 3300005437 Bacteria 5737
40 Ga0070701_10000802 3300005438 Bacteria 11224
41 Ga0070711_100002361 3300005439 Bacteria 10733
42 Ga0070711_100010183 3300005439 Bacteria 5811
43 Ga0070705_100031047 3300005440 Bacteria 2955
44 Ga0070705_100133492 3300005440 Bacteria 1623
45 Ga0070700_100016733 3300005441 Bacteria 4181
46 Ga0070694_100059857 3300005444 Bacteria 2596
47 Ga0070663_100019735 3300005455 Bacteria 4451
48 Ga0070678_100002715 3300005456 Bacteria 9767
49 Ga0070678_100631182 3300005456 Bacteria 959
50 Ga0070662_100011550 3300005457 Bacteria 5827
51 Ga0068867_100003221 3300005459 Bacteria 11509
52 Ga0070685_10110272 3300005466 Bacteria 1694
53 Ga0070685_10130626 3300005466 Bacteria 1570
54 Ga0068853_100065996 3300005539 Bacteria 3142
55 Ga0068853_100176040 3300005539 Bacteria 1938
56 Ga0070672_100094912 3300005543 Bacteria 2412
57 Ga0070686_100182734 3300005544 Bacteria 1491
58 Ga0070686_100259435 3300005544 Bacteria 1273
59 Ga0070695_100092104 3300005545 Bacteria 2026
60 Ga0070693_100036062 3300005547 Bacteria 2747
61 Ga0070665_100008312 3300005548 Bacteria 10498
62 Ga0070665_100012898 3300005548 Bacteria 8417
63 Ga0070665_100211332 3300005548 Bacteria 1941
64 Ga0070704_100000443 3300005549 Bacteria 19456
65 Ga0068854_100000515 3300005578 Bacteria 23453
66 Ga0068854_100094395 3300005578 Bacteria 2231
67 Ga0070702_100056039 3300005615 Bacteria 2275
68 Ga0068852_100105980 3300005616 Bacteria 2548
69 Ga0068859_100000276 3300005617 Bacteria 51118
70 Ga0068859_100025626 3300005617 Bacteria 5915
71 Ga0068859_100099159 3300005617 Bacteria 2968
72 Ga0068864_100065068 3300005618 Bacteria 3163
73 Ga0068864_100414836 3300005618 Bacteria 1282
74 Ga0068866_10014867 3300005718 Bacteria 3446
75 Ga0068866_10061824 3300005718 Bacteria 1946
76 Ga0068861_100000307 3300005719 Bacteria 27379
77 Ga0068863_100000431 3300005841 Bacteria 42342
78 Ga0068863_100029468 3300005841 Bacteria 5239
79 Ga0068863_100075839 3300005841 Bacteria 3181
80 Ga0068858_100000440 3300005842 Bacteria 43437
81 Ga0068858_100062106 3300005842 Bacteria 3454
82 Ga0068860_100000232 3300005843 Bacteria 85501
83 Ga0068860_100290219 3300005843 Bacteria 1600
84 Ga0068860_100527604 3300005843 Bacteria 1181
85 Ga0068862_100000055 3300005844 Bacteria 142386
86 Ga0068862_100146541 3300005844 Bacteria 2098
87 Ga0068862_100146869 3300005844 Bacteria 2096
88 Ga0068862_100484994 3300005844 Bacteria 1171
89 Ga0081455_10089043 3300005937 Bacteria 2506
90 Ga0081540_1004548 3300005983 Bacteria 10515
91 Ga0075365_10025315 3300006038 Bacteria 3755
92 Ga0075365_10109416 3300006038 Bacteria 1898
93 Ga0075368_10036003 3300006042 Bacteria 1933
94 Ga0075363_100000804 3300006048 Bacteria 10846
95 Ga0075363_100006100 3300006048 Bacteria 5439
96 Ga0075363_100006782 3300006048 Bacteria 5229
97 Ga0075363_100258548 3300006048 Bacteria 1004
98 Ga0075364_10000391 3300006051 Bacteria 21816
99 Ga0075364_10001597 3300006051 Bacteria 12392
100 Ga0075364_10001835 3300006051 Bacteria 11770
101 Ga0075364_10356575 3300006051 Bacteria 997
102 Ga0070715_10096762 3300006163 Bacteria 1369
103 Ga0070716_100013660 3300006173 Bacteria 4143
104 Ga0070716_100081008 3300006173 Bacteria 1937
105 Ga0070712_100001270 3300006175 Bacteria 15233
106 Ga0070712_100009279 3300006175 Bacteria 6198
107 Ga0070712_100140590 3300006175 Bacteria 1842
108 Ga0075367_10015781 3300006178 Bacteria 4114
109 Ga0075367_10068346 3300006178 Bacteria 2131
110 Ga0075369_10002249 3300006186 Bacteria 6849
111 Ga0075369_10002665 3300006186 Bacteria 6391
112 Ga0075369_10033588 3300006186 Bacteria 2174
113 Ga0075369_10070489 3300006186 Bacteria 1538
114 Ga0075369_10150423 3300006186 Bacteria 1064
115 Ga0075370_10000744 3300006353 Bacteria 13002
116 Ga0075370_10001636 3300006353 Bacteria 9880
117 Ga0075370_10076289 3300006353 Bacteria 1922
118 Ga0075428_100008700 3300006844 Bacteria 11262
119 Ga0075430_100032892 3300006846 Bacteria 4401
120 Ga0075431_100330051 3300006847 Bacteria 1536
121 Ga0068865_100008992 3300006881 Bacteria 6181
122 Ga0097620_100000276 3300006931 Bacteria 51118
123 Ga0097620_100025628 3300006931 Bacteria 5915
124 Ga0097620_100099157 3300006931 Bacteria 2968
125 Ga0105250_10012797 3300009092 Bacteria 3456
126 Ga0111539_10479414 3300009094 Bacteria 1449
127 Ga0105245_10010633 3300009098 Bacteria 8007
128 Ga0105245_10031418 3300009098 Bacteria 4699
129 Ga0105247_10000029 3300009101 Bacteria 198763
130 Ga0105247_10000584 3300009101 Bacteria 29668
131 Ga0105247_10074303 3300009101 Bacteria 2132
132 Ga0114129_10009255 3300009147 Bacteria 14047
133 Ga0105243_10009400 3300009148 Bacteria 7450
134 Ga0105243_10186156 3300009148 Bacteria 1810
135 Ga0105241_10071846 3300009174 Bacteria 2688
136 Ga0105242_10003225 3300009176 Bacteria 12717
137 Ga0105248_10000136 3300009177 Bacteria 85507
138 Ga0105248_10014990 3300009177 Bacteria 8533
139 Ga0105248_10504426 3300009177 Bacteria 1364
140 Ga0105248_10652327 3300009177 Bacteria 1188
141 Ga0105237_10036314 3300009545 Bacteria 4985
142 Ga0105249_10000077 3300009553 Bacteria 141905
143 Ga0105249_10024146 3300009553 Bacteria 5462
144 Ga0105249_10039812 3300009553 Bacteria 4267
145 Ga0105249_10307441 3300009553 Bacteria 1592
146 Ga0105239_10005314 3300010375 Bacteria 15120
147 Ga0105239_10126268 3300010375 Bacteria 2843
148 Ga0105246_10138037 3300011119 Bacteria 1830
149 Ga0157378_10005026 3300013297 Bacteria 11608
150 Ga0157378_10404177 3300013297 Bacteria 1346
151 Ga0163162_10040972 3300013306 Bacteria 4633
152 Ga0163162_10315588 3300013306 Bacteria 1696
153 Ga0163162_10935355 3300013306 Bacteria 978
154 Ga0157372_10000875 3300013307 Bacteria 32716
155 Ga0157372_10190704 3300013307 Bacteria 2374
156 Ga0157375_10010499 3300013308 Bacteria 8153
157 Ga0157375_10365189 3300013308 Bacteria 1610
158 Ga0163163_10224915 3300014325 Bacteria 1925
159 Ga0163163_10309250 3300014325 Bacteria 1633
160 Ga0163163_10606269 3300014325 Bacteria 1158
161 Ga0157380_10043090 3300014326 Bacteria 3531
162 Ga0157379_10001901 3300014968 Bacteria 17267
163 Ga0157379_10172591 3300014968 Bacteria 1952
164 Ga0157376_10048523 3300014969 Bacteria 3511
165 Ga0163161_10001293 3300017792 Bacteria 18669
166 Ga0213875_10003128 3300021388 Bacteria 9526
167 Ga0207692_10020053 3300025898 Bacteria 3033
168 Ga0207692_10022822 3300025898 Bacteria 2886
169 Ga0207710_10000046 3300025900 Bacteria 198754
170 Ga0207710_10003445 3300025900 Bacteria 7053
171 Ga0207710_10040237 3300025900 Bacteria 2071
172 Ga0207688_10000623 3300025901 Bacteria 17410
173 Ga0207688_10000910 3300025901 Bacteria 14940
174 Ga0207647_10145631 3300025904 Bacteria 1386
175 Ga0207685_10140949 3300025905 Bacteria 1081
176 Ga0207699_10028439 3300025906 Bacteria 3107
177 Ga0207699_10162834 3300025906 Bacteria 1486
178 Ga0207671_10075057 3300025914 Bacteria 2528
179 Ga0207693_10000614 3300025915 Bacteria 31922
180 Ga0207693_10201956 3300025915 Bacteria 1563
181 Ga0207693_10335907 3300025915 Bacteria 1183
182 Ga0207663_10002572 3300025916 Bacteria 8730
183 Ga0207663_10097522 3300025916 Bacteria 1966
184 Ga0207662_10027816 3300025918 Bacteria 3266
185 Ga0207681_10000341 3300025923 Bacteria 33602
186 Ga0207659_10163887 3300025926 Bacteria 1748
187 Ga0207687_10004910 3300025927 Bacteria 8883
188 Ga0207687_10011562 3300025927 Bacteria 5770
189 Ga0207644_10068995 3300025931 Bacteria 2580
190 Ga0207706_10001079 3300025933 Bacteria 27701
191 Ga0207706_10256819 3300025933 Bacteria 1526
192 Ga0207686_10004045 3300025934 Bacteria 7870
193 Ga0207709_10031625 3300025935 Bacteria 3093
194 Ga0207709_10142845 3300025935 Bacteria 1647
195 Ga0207670_10070586 3300025936 Bacteria 2413
196 Ga0207670_10141369 3300025936 Bacteria 1775
197 Ga0207669_10000085 3300025937 Bacteria 47505
198 Ga0207669_10143466 3300025937 Bacteria 1661
199 Ga0207704_10018460 3300025938 Bacteria 3641
200 Ga0207704_10350979 3300025938 Bacteria 1148
201 Ga0207665_10012387 3300025939 Bacteria 5602
202 Ga0207665_10016891 3300025939 Bacteria 4792
203 Ga0207711_10000111 3300025941 Bacteria 85466
204 Ga0207711_10026873 3300025941 Bacteria 4831
205 Ga0207651_10463144 3300025960 Bacteria 1090
206 Ga0207712_10000017 3300025961 Bacteria 337943
207 Ga0207712_10030695 3300025961 Bacteria 3615
208 Ga0207712_10134647 3300025961 Bacteria 1888
209 Ga0207668_10006550 3300025972 Bacteria 6883
210 Ga0207668_10510653 3300025972 Bacteria 1035
211 Ga0207640_10012787 3300025981 Bacteria 4793
212 Ga0207658_10000016 3300025986 Bacteria 215618
213 Ga0207658_10076343 3300025986 Bacteria 2552
214 Ga0207658_10483828 3300025986 Bacteria 1100
215 Ga0207677_10001633 3300026023 Bacteria 11908
216 Ga0207677_10347361 3300026023 Bacteria 1242
217 Ga0207703_10289790 3300026035 Bacteria 1489
218 Ga0207678_10044033 3300026067 Bacteria 3862
219 Ga0207708_10000329 3300026075 Bacteria 37329
220 Ga0207641_10000378 3300026088 Bacteria 53027
221 Ga0207641_10019974 3300026088 Bacteria 5499
222 Ga0207641_10046745 3300026088 Bacteria 3649
223 Ga0207641_10509603 3300026088 Bacteria 1169
224 Ga0207648_10000112 3300026089 Bacteria 78746
225 Ga0207676_10344993 3300026095 Bacteria 1375
226 Ga0207675_100000117 3300026118 Bacteria 64829
227 Ga0207675_100046569 3300026118 Bacteria 4052
228 Ga0207683_10000451 3300026121 Bacteria 38077
229 Ga0207683_10016000 3300026121 Bacteria 6384
230 Ga0207683_10319263 3300026121 Bacteria 1423
231 Ga0268266_10022603 3300028379 Bacteria 5355
232 Ga0268266_10030229 3300028379 Bacteria 4603
233 Ga0268266_10436987 3300028379 Bacteria 1242
234 Ga0268265_10000067 3300028380 Bacteria 142389
235 Ga0268265_10108343 3300028380 Bacteria 2261
236 Ga0268265_10164956 3300028380 Bacteria 1887
237 Ga0268264_10000146 3300028381 Bacteria 165733
238 Ga0268264_10008289 3300028381 Bacteria 8635
239 Ga0268264_10123149 3300028381 Bacteria 2288
240 Ga0307413_10129898 3300031824 Bacteria 1722
241 Ga0307413_10328371 3300031824 Bacteria 1172
242 Ga0307410_10051774 3300031852 Bacteria 2769
243 Ga0307407_10232908 3300031903 Bacteria 1252
244 Ga0307409_100125849 3300031995 Bacteria 2179
245 Ga0307416_100019511 3300032002 Bacteria 4809
246 Ga0307414_10333752 3300032004 Bacteria 1295
247 Ga0307411_10091900 3300032005 Bacteria 2121
248 Ga0373931_0016499 3300035691 Bacteria 3637
249 Ga0395900_0539928 3300037418 Bacteria 1112
250 Ga0436364_0545294 3300037853 Bacteria 1055
251 Ga0436364_0943073 3300037853 Bacteria 18642
252 Ga0436365_0277195 3300039437 Bacteria 6950
253 Ga0436365_0957112 3300039437 Bacteria 4970
254 Ga0436365_1082477 3300039437 Bacteria 1601
255 Ga0436365_1710859 3300039437 Bacteria 22724
256 Ga0439465_0002332 3300041413 Bacteria 6223
257 Ga0439465_0008756 3300041413 Bacteria 3189
258 Ga0451853_0380447 3300041512 Bacteria 1069
259 Ga0439431_0033842 3300041997 Bacteria 1279
260 Ga0439445_0015107 3300042004 Bacteria 1887
261 Ga0466972_0057434 3300044658 Bacteria 1869
262 Ga0466972_0074604 3300044658 Bacteria 1616
263 Ga0466965_0055914 3300044683 Bacteria 1964
264 Ga0466964_0138337 3300044706 Bacteria 1116
265 Ga0466971_0130368 3300044719 Bacteria 1167
266 Ga0466970_0050512 3300044765 Bacteria 2218
267 Ga0466970_0152879 3300044765 Bacteria 1274
268 Ga0466970_0184973 3300044765 Bacteria 1157
269 Ga0466957_0038429 3300044842 Bacteria 2884
270 Ga0466957_0546600 3300044842 Bacteria 807
271 Ga0466960_0001027 3300044901 Bacteria 9982
272 Ga0466960_0063448 3300044901 Bacteria 1819
273 Ga0466959_0032455 3300045049 Bacteria 3865
274 Ga0466959_0036631 3300045049 Bacteria 3625
275 Ga0466967_0007332 3300045976 Bacteria 7943
276 Ga0466967_0324983 3300045976 Bacteria 1484
277 Ga0466967_0619203 3300045976 Bacteria 1069
278 Ga0495638_0008171 3300046460 Bacteria 7440
279 Ga0495638_0138579 3300046460 Bacteria 1422
280 Ga0495643_0216168 3300046522 Bacteria 912
281 Ga0495640_0279625 3300046533 Bacteria 1039
282 Ga0495649_0118196 3300046694 Bacteria 1403
283 Ga0495589_0188082 3300046794 Bacteria 978
284 Ga0495672_0075320 3300047320 Bacteria 1898
285 Ga0495672_0221408 3300047320 Bacteria 934
286 Ga0496100_0000456 3300048903 Bacteria 19698
287 Ga0496100_0065961 3300048903 Bacteria 2400
288 Ga0496100_0224671 3300048903 Bacteria 1379
289 Ga0496101_0004109 3300048904 Bacteria 9110
290 Ga0496101_0032752 3300048904 Bacteria 3661
291 Ga0496101_0110549 3300048904 Bacteria 2068
292 Ga0496101_0138840 3300048904 Bacteria 1851
293 Ga0496102_0000268 3300048905 Bacteria 66717
294 Ga0496102_0010611 3300048905 Bacteria 7936
295 Ga0496102_0028491 3300048905 Bacteria 4989
296 Ga0496102_0049429 3300048905 Bacteria 3826
297 Ga0496103_0000237 3300048906 Bacteria 53762
298 Ga0496103_0003795 3300048906 Bacteria 9195
299 Ga0496104_0028153 3300048907 Bacteria 5207
300 Ga0496105_0040722 3300048908 Bacteria 3831
301 Ga0496105_0061690 3300048908 Bacteria 3094
302 Ga0496105_0103658 3300048908 Bacteria 2349
303 Ga0496106_0000758 3300048909 Bacteria 23299
304 Ga0496106_0006699 3300048909 Bacteria 8531
305 Ga0496106_0300930 3300048909 Bacteria 1286
306 Ga0496107_0004395 3300048910 Bacteria 9548
307 Ga0496107_0020031 3300048910 Bacteria 4725
308 Ga0496107_0028420 3300048910 Bacteria 3974
309 Ga0496107_0111177 3300048910 Bacteria 2014
310 Ga0496108_0002116 3300048911 Bacteria 15905
311 Ga0496108_0015324 3300048911 Bacteria 6254
312 Ga0496108_0085404 3300048911 Bacteria 2679
313 Ga0496108_0574055 3300048911 Bacteria 983
314 Ga0496109_0007462 3300048912 Bacteria 9260
315 Ga0496110_0028720 3300048913 Bacteria 4780
316 Ga0496112_0033694 3300048915 Bacteria 4980
317 Ga0496112_0052098 3300048915 Bacteria 4016
318 Ga0496113_0179286 3300048916 Bacteria 1679
319 Ga0496114_0002083 3300048917 Bacteria 15214
320 Ga0496114_0004945 3300048917 Bacteria 10389
321 Ga0496114_0332828 3300048917 Bacteria 1342
322 Ga0496115_0001294 3300048918 Bacteria 17870
323 Ga0496115_0079004 3300048918 Bacteria 2678
324 Ga0496116_0073804 3300048919 Bacteria 2148
325 Ga0496117_0005334 3300048920 Bacteria 13553
326 Ga0496118_0000185 3300048921 Bacteria 109095
327 Ga0496118_0014631 3300048921 Bacteria 7333
328 Ga0496119_0001469 3300048922 Bacteria 28203
329 Ga0496120_0022885 3300048923 Bacteria 3923
330 Ga0496121_0005710 3300048924 Bacteria 15801
331 Ga0496124_0047943 3300048927 Bacteria 3652
332 Ga0496125_0017560 3300048928 Bacteria 6816
333 Ga0496125_0117419 3300048928 Bacteria 1908
334 Ga0496126_0004200 3300048929 Bacteria 17349
335 Ga0496126_0005075 3300048929 Bacteria 15273
336 Ga0501032_0002313 3300049569 Bacteria 14948
337 Ga0501034_0006673 3300049571 Bacteria 12378
338 Ga0501036_0010059 3300049572 Bacteria 7792
339 Ga0501037_0001502 3300049573 Bacteria 17059
340 Ga0501038_0001711 3300049574 Bacteria 20376
341 Ga0501039_0000526 3300049575 Bacteria 27681
342 Ga0501043_0000633 3300049579 Bacteria 31114
343 Ga0501070_0000448 3300049586 Bacteria 37506
344 Ga0501070_0044571 3300049586 Bacteria 3690
345 Ga0501070_0681401 3300049586 Bacteria 814
346 Ga0501073_0133029 3300049589 Bacteria 1724
347 Ga0501077_0363958 3300049593 Bacteria 923
348 Ga0501044_0006652 3300049823 Bacteria 12743
349 nmdc:mga03683_781_c1 3300050489 Bacteria 9138
350 nmdc:mga03n38_280291_c1 3300050490 Bacteria 889
351 nmdc:mga03n38_4468_c1 3300050490 Bacteria 4641
352 nmdc:mga03n38_5746_c1 3300050490 Bacteria 4253
353 nmdc:mga03n38_87805_c1 3300050490 Bacteria 1474
354 nmdc:mga03n38_9923_c1 3300050490 Bacteria 3484
355 nmdc:mga00v17_1485_c1 3300050491 Bacteria 12272
356 nmdc:mga00v17_171946_c1 3300050491 Bacteria 1397
357 nmdc:mga00v17_19972_c1 3300050491 Bacteria 3832
358 nmdc:mga00v17_33986_c1 3300050491 Bacteria 3026
359 nmdc:mga0yw44_144630_c1 3300050492 Bacteria 1547
360 nmdc:mga0yw44_1566_c1 3300050492 Bacteria 8430
361 nmdc:mga0yw44_273537_c1 3300050492 Bacteria 1128
362 nmdc:mga0yw44_78966_c1 3300050492 Bacteria 2058
363 nmdc:mga06z11_26442_c1 3300050494 Bacteria 2761
364 nmdc:mga04h51_76366_c1 3300050495 Bacteria 1180
365 nmdc:mga07m45_148321_c1 3300050496 Bacteria 1360
366 nmdc:mga07m45_813_c2 3300050496 Bacteria 12202
367 nmdc:mga07m45_854_c1 3300050496 Bacteria 1622
368 nmdc:mga05p37_15793_c1 3300050507 Bacteria 9079
369 nmdc:mga0qj67_27780_c1 3300050509 Bacteria 4387
370 nmdc:mga06r32_587164_c1 3300050510 Bacteria 1086
371 nmdc:mga0sz30_35169_c1 3300050516 Bacteria 2089
372 nmdc:mga0sz30_37435_c1 3300050516 Bacteria 2030
373 nmdc:mga0sz30_385_c1 3300050516 Bacteria 16818
374 nmdc:mga0sz30_621_c2 3300050516 Bacteria 12035
375 Ga0500643_014152 3300053087 Bacteria 2785
376 Ga0500651_0316142 3300053093 Bacteria 893
377 Ga0500562_029680 3300053108 Bacteria 1439
378 Ga0500655_021760 3300053133 Bacteria 1204
379 Ga0500616_0003873 3300053153 Bacteria 11012
380 Ga0500627_0026894 3300053158 Bacteria 2378
381 Ga0500645_000007 3300053730 Bacteria 233700
382 Ga0466962_0153374 3300061719 Bacteria 1118
383 2524442582 2524023205 Bacteria 8918781
384 2738705773 2738541274 Bacteria 6909446
385 2739330263 2738543028 Bacteria 6917070
386 2824606006 2824600985 Bacteria 8488197
387 2824615945 2824609381 Bacteria 8672835
388 2847935333 2847930680 Bacteria 9342022
389 2906646338 2906643746 Bacteria 8722424
390 2929216817 2929212328 Bacteria 7708288
391 2935960378 2935959822 Bacteria 7869783
392 2939588857 2939582691 Bacteria 7088898
393 Ga0207665_10149080
394 JGI24739J22299_10027138
395 JGI24735J21928_10044802
396 JGI24034J26672_10018954
397 JGI24742J22300_10002125
398 Ga0070676_10103640
399 Ga0070690_100023931
400 Ga0070670_100416785
401 Ga0068869_100201094
402 Ga0070666_10036827
403 Ga0070682_100068058
404 Ga0070682_100076368
405 Ga0070682_100151548
406 Ga0068868_100133212
407 Ga0068868_100478092
408 Ga0070660_100121697
409 Ga0070689_100019982
410 Ga0070691_10029071
411 Ga0070691_10210496
412 Ga0070687_100015244
413 Ga0070668_100462153
414 Ga0070669_100000597
415 Ga0070669_100037398
416 Ga0070675_100051359
417 Ga0070675_100440561
418 Ga0070671_100267090
419 Ga0070674_100034429
420 Ga0070674_100244151
421 Ga0070674_100319835
422 Ga0070688_100021505
423 Ga0070659_100064290
424 Ga0070667_100000388
425 Ga0070667_100006205
426 Ga0070667_100243107
427 Ga0070709_10012970
428 Ga0070709_10059843
429 Ga0070714_100077301
430 Ga0070714_100203695
431 Ga0070710_10006167
432 Ga0070701_10000802
433 Ga0070711_100002361
434 Ga0070711_100010183
435 Ga0070705_100031047
436 Ga0070705_100133492
437 Ga0070700_100016733
438 Ga0070694_100059857
439 Ga0070663_100019735
440 Ga0070678_100002715
441 Ga0070678_100631182
442 Ga0070662_100011550
443 Ga0068867_100003221
444 Ga0070685_10110272
445 Ga0070685_10130626
446 Ga0068853_100065996
447 Ga0068853_100176040
448 Ga0070672_100094912
449 Ga0070686_100182734
450 Ga0070686_100259435
451 Ga0070695_100092104
452 Ga0070693_100036062
453 Ga0070665_100008312
454 Ga0070665_100012898
455 Ga0070665_100211332
456 Ga0070704_100000443
457 Ga0068854_100000515
458 Ga0068854_100094395
459 Ga0070702_100056039
460 Ga0068852_100105980
461 Ga0068859_100000276
462 Ga0068859_100025626
463 Ga0068859_100099159
464 Ga0068864_100065068
465 Ga0068864_100414836
466 Ga0068866_10014867
467 Ga0068866_10061824
468 Ga0068861_100000307
469 Ga0068863_100000431
470 Ga0068863_100029468
471 Ga0068863_100075839
472 Ga0068858_100000440
473 Ga0068858_100062106
474 Ga0068860_100000232
475 Ga0068860_100290219
476 Ga0068860_100527604
477 Ga0068862_100000055
478 Ga0068862_100146541
479 Ga0068862_100146869
480 Ga0068862_100484994
481 Ga0081455_10089043
482 Ga0081540_1004548
483 Ga0075365_10025315
484 Ga0075365_10109416
485 Ga0075368_10036003
486 Ga0075363_100000804
487 Ga0075363_100006100
488 Ga0075363_100006782
489 Ga0075363_100258548
490 Ga0075364_10000391
491 Ga0075364_10001597
492 Ga0075364_10001835
493 Ga0075364_10356575
494 Ga0070715_10096762
495 Ga0070716_100013660
496 Ga0070716_100081008
497 Ga0070712_100001270
498 Ga0070712_100009279
499 Ga0070712_100140590
500 Ga0075367_10015781
501 Ga0075367_10068346
502 Ga0075369_10002249
503 Ga0075369_10002665
504 Ga0075369_10033588
505 Ga0075369_10070489
506 Ga0075369_10150423
507 Ga0075370_10000744
508 Ga0075370_10001636
509 Ga0075370_10076289
510 Ga0075428_100008700
511 Ga0075430_100032892
512 Ga0075431_100330051
513 Ga0068865_100008992
514 Ga0097620_100000276
515 Ga0097620_100025628
516 Ga0097620_100099157
517 Ga0105250_10012797
518 Ga0111539_10479414
519 Ga0105245_10010633
520 Ga0105245_10031418
521 Ga0105247_10000029
522 Ga0105247_10000584
523 Ga0105247_10074303
524 Ga0114129_10009255
525 Ga0105243_10009400
526 Ga0105243_10186156
527 Ga0105241_10071846
528 Ga0105242_10003225
529 Ga0105248_10000136
530 Ga0105248_10014990
531 Ga0105248_10504426
532 Ga0105248_10652327
533 Ga0105237_10036314
534 Ga0105249_10000077
535 Ga0105249_10024146
536 Ga0105249_10039812
537 Ga0105249_10307441
538 Ga0105239_10005314
539 Ga0105239_10126268
540 Ga0105246_10138037
541 Ga0157378_10005026
542 Ga0157378_10404177
543 Ga0163162_10040972
544 Ga0163162_10315588
545 Ga0163162_10935355
546 Ga0157372_10000875
547 Ga0157372_10190704
548 Ga0157375_10010499
549 Ga0157375_10365189
550 Ga0163163_10224915
551 Ga0163163_10309250
552 Ga0163163_10606269
553 Ga0157380_10043090
554 Ga0157379_10001901
555 Ga0157379_10172591
556 Ga0157376_10048523
557 Ga0163161_10001293
558 Ga0213875_10003128
559 Ga0207692_10020053
560 Ga0207692_10022822
561 Ga0207710_10000046
562 Ga0207710_10003445
563 Ga0207710_10040237
564 Ga0207688_10000623
565 Ga0207688_10000910
566 Ga0207647_10145631
567 Ga0207685_10140949
568 Ga0207699_10028439
569 Ga0207699_10162834
570 Ga0207671_10075057
571 Ga0207693_10000614
572 Ga0207693_10201956
573 Ga0207693_10335907
574 Ga0207663_10002572
575 Ga0207663_10097522
576 Ga0207662_10027816
577 Ga0207681_10000341
578 Ga0207659_10163887
579 Ga0207687_10004910
580 Ga0207687_10011562
581 Ga0207644_10068995
582 Ga0207706_10001079
583 Ga0207706_10256819
584 Ga0207686_10004045
585 Ga0207709_10031625
586 Ga0207709_10142845
587 Ga0207670_10070586
588 Ga0207670_10141369
589 Ga0207669_10000085
590 Ga0207669_10143466
591 Ga0207704_10018460
592 Ga0207704_10350979
593 Ga0207665_10012387
594 Ga0207665_10016891
595 Ga0207711_10000111
596 Ga0207711_10026873
597 Ga0207651_10463144
598 Ga0207712_10000017
599 Ga0207712_10030695
600 Ga0207712_10134647
601 Ga0207668_10006550
602 Ga0207668_10510653
603 Ga0207640_10012787
604 Ga0207658_10000016
605 Ga0207658_10076343
606 Ga0207658_10483828
607 Ga0207677_10001633
608 Ga0207677_10347361
609 Ga0207703_10289790
610 Ga0207678_10044033
611 Ga0207708_10000329
612 Ga0207641_10000378
613 Ga0207641_10019974
614 Ga0207641_10046745
615 Ga0207641_10509603
616 Ga0207648_10000112
617 Ga0207676_10344993
618 Ga0207675_100000117
619 Ga0207675_100046569
620 Ga0207683_10000451
621 Ga0207683_10016000
622 Ga0207683_10319263
623 Ga0268266_10022603
624 Ga0268266_10030229
625 Ga0268266_10436987
626 Ga0268265_10000067
627 Ga0268265_10108343
628 Ga0268265_10164956
629 Ga0268264_10000146
630 Ga0268264_10008289
631 Ga0268264_10123149
632 Ga0307413_10129898
633 Ga0307413_10328371
634 Ga0307410_10051774
635 Ga0307407_10232908
636 Ga0307409_100125849
637 Ga0307416_100019511
638 Ga0307414_10333752
639 Ga0307411_10091900
640 Ga0373931_0016499
641 Ga0395900_0539928
642 Ga0436364_0545294
643 Ga0436364_0943073
644 Ga0436365_0277195
645 Ga0436365_0957112
646 Ga0436365_1082477
647 Ga0436365_1710859
648 Ga0439465_0002332
649 Ga0439465_0008756
650 Ga0451853_0380447
651 Ga0439431_0033842
652 Ga0439445_0015107
653 Ga0466972_0057434
654 Ga0466972_0074604
655 Ga0466965_0055914
656 Ga0466964_0138337
657 Ga0466971_0130368
658 Ga0466970_0050512
659 Ga0466970_0152879
660 Ga0466970_0184973
661 Ga0466957_0038429
662 Ga0466957_0546600
663 Ga0466960_0001027
664 Ga0466960_0063448
665 Ga0466959_0032455
666 Ga0466959_0036631
667 Ga0466967_0007332
668 Ga0466967_0324983
669 Ga0466967_0619203
670 Ga0495638_0008171
671 Ga0495638_0138579
672 Ga0495643_0216168
673 Ga0495640_0279625
674 Ga0495649_0118196
675 Ga0495589_0188082
676 Ga0495672_0075320
677 Ga0495672_0221408
678 Ga0496100_0000456
679 Ga0496100_0065961
680 Ga0496100_0224671
681 Ga0496101_0004109
682 Ga0496101_0032752
683 Ga0496101_0110549
684 Ga0496101_0138840
685 Ga0496102_0000268
686 Ga0496102_0010611
687 Ga0496102_0028491
688 Ga0496102_0049429
689 Ga0496103_0000237
690 Ga0496103_0003795
691 Ga0496104_0028153
692 Ga0496105_0040722
693 Ga0496105_0061690
694 Ga0496105_0103658
695 Ga0496106_0000758
696 Ga0496106_0006699
697 Ga0496106_0300930
698 Ga0496107_0004395
699 Ga0496107_0020031
700 Ga0496107_0028420
701 Ga0496107_0111177
702 Ga0496108_0002116
703 Ga0496108_0015324
704 Ga0496108_0085404
705 Ga0496108_0574055
706 Ga0496109_0007462
707 Ga0496110_0028720
708 Ga0496112_0033694
709 Ga0496112_0052098
710 Ga0496113_0179286
711 Ga0496114_0002083
712 Ga0496114_0004945
713 Ga0496114_0332828
714 Ga0496115_0001294
715 Ga0496115_0079004
716 Ga0496116_0073804
717 Ga0496117_0005334
718 Ga0496118_0000185
719 Ga0496118_0014631
720 Ga0496119_0001469
721 Ga0496120_0022885
722 Ga0496121_0005710
723 Ga0496124_0047943
724 Ga0496125_0017560
725 Ga0496125_0117419
726 Ga0496126_0004200
727 Ga0496126_0005075
728 Ga0501032_0002313
729 Ga0501034_0006673
730 Ga0501036_0010059
731 Ga0501037_0001502
732 Ga0501038_0001711
733 Ga0501039_0000526
734 Ga0501043_0000633
735 Ga0501070_0000448
736 Ga0501070_0044571
737 Ga0501070_0681401
738 Ga0501073_0133029
739 Ga0501077_0363958
740 Ga0501044_0006652
741 nmdc:mga03683_781_c1
742 nmdc:mga03n38_280291_c1
743 nmdc:mga03n38_4468_c1
744 nmdc:mga03n38_5746_c1
745 nmdc:mga03n38_87805_c1
746 nmdc:mga03n38_9923_c1
747 nmdc:mga00v17_1485_c1
748 nmdc:mga00v17_171946_c1
749 nmdc:mga00v17_19972_c1
750 nmdc:mga00v17_33986_c1
751 nmdc:mga0yw44_144630_c1
752 nmdc:mga0yw44_1566_c1
753 nmdc:mga0yw44_273537_c1
754 nmdc:mga0yw44_78966_c1
755 nmdc:mga06z11_26442_c1
756 nmdc:mga04h51_76366_c1
757 nmdc:mga07m45_148321_c1
758 nmdc:mga07m45_813_c2
759 nmdc:mga07m45_854_c1
760 nmdc:mga05p37_15793_c1
761 nmdc:mga0qj67_27780_c1
762 nmdc:mga06r32_587164_c1
763 nmdc:mga0sz30_35169_c1
764 nmdc:mga0sz30_37435_c1
765 nmdc:mga0sz30_385_c1
766 nmdc:mga0sz30_621_c2
767 Ga0500643_014152
768 Ga0500651_0316142
769 Ga0500562_029680
770 Ga0500655_021760
771 Ga0500616_0003873
772 Ga0500627_0026894
773 Ga0500645_000007
774 Ga0466962_0153374
775 2524442582
776 2738705773
777 2739330263
778 2824606006
779 2824615945
780 2847935333
781 2906646338
782 2929216817
783 2935960378
784 2939588857

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

12

201

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

18

258

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cdy-assembly1.cif.gz_A the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9445 4 256
5cdy-assembly1.cif.gz_B the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9439 4 256
4cqm-assembly2.cif.gz_B crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9419 8 256
4nbu-assembly1.cif.gz_D crystal structure of fabg from bacillus sp 0.9377 4 257
3emk-assembly1.cif.gz_B 2.5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis 0.9374 1 257
ID Description Score Start End Superfamily
af_Q0D3U8_30_207_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9679 2 169 3.40.50.720
af_P9WGR9_1_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.937 1 258 3.40.50.720
af_Q0JDN0_53_323_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9357 8 192 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9343 1 260 3.40.50.720
3ioyB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9341 6 189 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2P5DZW0-F1-model_v4 Short-chain dehydrogenase/reductase 0.9707 2 192 GO:0016491
AF-A0A382K148-F1-model_v4 Uncharacterized protein 0.9689 4 179 GO:0016491
AF-A0A1R3HDP7-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9671 2 159 GO:0016491
AF-A7EQI6-F1-model_v4 Uncharacterized protein 0.9664 4 184
AF-A0A7J6I870-F1-model_v4 Uncharacterized protein 0.9652 5 198 GO:0016491

Map