F432260

General Info

Members Datasets Scaffolds Average Seq Length
392 216 784 212

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100029823|Ga0068857_1000298232
Length 239
Sequence MKNQAKQTTRASNHAPAVQPNPPAQSEKKPLRILIADDHSIVRKGLKQVLIDELGPIDFGEACNGQEALTQVQKAHWDIALLDVTMPGPSGLDVLKQLKELQPAIRVLVLSMHPEDQYAVRVLRAGAAGYLTKNTASDLVAEAVKKVLAGGTYVSPSLAENLAGSLNEPPAKAAHEKLSDREFQILRLIAAGKSVKEIGFDLSLSVKTVSTYRTRLLHKLKLTTTAELIRYALREGLVE

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
101 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
144 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
147 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
163 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
172 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
199 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
200 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
201 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
202 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
215 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.26
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 2.55
Rhizosphere 91.84
Stem 0
Stem Tuber 0
Unclassified 20.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100029823 3300005577 Bacteria 4814
2 JGI24737J22298_10079613 3300001990 Unclassified 975
3 rootH2_10000256 3300003320 Bacteria 54479
4 rootH2_10284619 3300003320 Unclassified 1582
5 rootH2_10323289 3300003320 Unclassified 1755
6 rootL2_10146969 3300003322 Bacteria 7022
7 rootL2_10193217 3300003322 Bacteria 3403
8 rootL2_10357646 3300003322 Unclassified 1189
9 rootH1_10129672 3300003323 Bacteria 3918
10 rootH1_10195394 3300003323 Unclassified 1296
11 Ga0058863_11648696 3300004799 Bacteria 1101
12 Ga0065717_1003857 3300005276 Bacteria 1162
13 Ga0065704_10005192 3300005289 Bacteria 6398
14 Ga0065715_10028988 3300005293 Bacteria 1759
15 Ga0065715_10292359 3300005293 Bacteria 1060
16 Ga0065707_10150745 3300005295 Bacteria 1661
17 Ga0070676_10202638 3300005328 Bacteria 1301
18 Ga0070683_100059807 3300005329 Unclassified 3540
19 Ga0070683_100658670 3300005329 Bacteria 1002
20 Ga0070690_100000241 3300005330 Bacteria 28094
21 Ga0070690_100985436 3300005330 Unclassified 663
22 Ga0068869_100085989 3300005334 Bacteria 2356
23 Ga0070666_10356864 3300005335 Bacteria 1047
24 Ga0070680_100001044 3300005336 Bacteria 19833
25 Ga0070680_100003453 3300005336 Bacteria 11794
26 Ga0070680_100209160 3300005336 Bacteria 1646
27 Ga0070689_100000299 3300005340 Bacteria 28834
28 Ga0070689_100022219 3300005340 Bacteria 4735
29 Ga0070689_100120929 3300005340 Bacteria 2091
30 Ga0070687_100005131 3300005343 Bacteria 5280
31 Ga0070687_100226214 3300005343 Unclassified 1149
32 Ga0070661_100070209 3300005344 Bacteria 2576
33 Ga0070669_100852519 3300005353 Bacteria 776
34 Ga0070675_100011689 3300005354 Bacteria 6882
35 Ga0070671_100964129 3300005355 Unclassified 746
36 Ga0070674_100044562 3300005356 Unclassified 3025
37 Ga0070674_100068722 3300005356 Bacteria 2497
38 Ga0070674_100163704 3300005356 Bacteria 1690
39 Ga0070688_100001140 3300005365 Bacteria 13294
40 Ga0070688_100323936 3300005365 Bacteria 1120
41 Ga0070659_100004363 3300005366 Bacteria 10097
42 Ga0070703_10001843 3300005406 Bacteria 6237
43 Ga0070703_10138304 3300005406 Bacteria 902
44 Ga0070709_10148417 3300005434 Bacteria 1618
45 Ga0070714_100196859 3300005435 Bacteria 1842
46 Ga0070713_100036270 3300005436 Unclassified 3978
47 Ga0070710_10160840 3300005437 Unclassified 1392
48 Ga0070701_10001958 3300005438 Bacteria 7799
49 Ga0070701_10081181 3300005438 Unclassified 1756
50 Ga0070705_100002122 3300005440 Bacteria 10091
51 Ga0070705_100018874 3300005440 Bacteria 3621
52 Ga0070700_100001159 3300005441 Bacteria 13026
53 Ga0070700_100016139 3300005441 Unclassified 4249
54 Ga0070700_100396506 3300005441 Bacteria 1036
55 Ga0070700_100550133 3300005441 Unclassified 896
56 Ga0070700_100819446 3300005441 Bacteria 751
57 Ga0070694_100000469 3300005444 Bacteria 22081
58 Ga0070694_100001666 3300005444 Bacteria 13061
59 Ga0070694_100050524 3300005444 Bacteria 2803
60 Ga0070694_100073190 3300005444 Bacteria 2366
61 Ga0070694_100172975 3300005444 Bacteria 1592
62 Ga0070694_100234966 3300005444 Bacteria 1381
63 Ga0070694_100297362 3300005444 Bacteria 1236
64 Ga0070694_100591074 3300005444 Bacteria 893
65 Ga0070708_100017538 3300005445 Bacteria 5977
66 Ga0070708_100104430 3300005445 Bacteria 2598
67 Ga0070708_100260063 3300005445 Unclassified 1631
68 Ga0070681_10004493 3300005458 Bacteria 13306
69 Ga0070681_10140820 3300005458 Bacteria 2342
70 Ga0070681_10233319 3300005458 Unclassified 1754
71 Ga0070681_10885709 3300005458 Unclassified 811
72 Ga0068867_100002772 3300005459 Bacteria 12341
73 Ga0068867_100122913 3300005459 Bacteria 2008
74 Ga0070685_10000330 3300005466 Bacteria 29127
75 Ga0070706_100204760 3300005467 Bacteria 1843
76 Ga0070706_100427785 3300005467 Bacteria 1232
77 Ga0070707_100000095 3300005468 Bacteria 79610
78 Ga0070707_100005481 3300005468 Bacteria 11865
79 Ga0070707_100150101 3300005468 Bacteria 2269
80 Ga0070707_100324969 3300005468 Bacteria 1495
81 Ga0070707_100553006 3300005468 Bacteria 1113
82 Ga0070707_100805227 3300005468 Bacteria 903
83 Ga0070698_100002792 3300005471 Bacteria 19232
84 Ga0070698_100446852 3300005471 Bacteria 1228
85 Ga0070698_100548340 3300005471 Bacteria 1096
86 Ga0070699_100011787 3300005518 Bacteria 7544
87 Ga0070699_100015740 3300005518 Bacteria 6494
88 Ga0070699_100094244 3300005518 Bacteria 2621
89 Ga0070699_100130819 3300005518 Bacteria 2212
90 Ga0070699_100155149 3300005518 Bacteria 2026
91 Ga0070679_100035618 3300005530 Unclassified 4938
92 Ga0070684_100032986 3300005535 Unclassified 4418
93 Ga0070684_100397172 3300005535 Bacteria 1271
94 Ga0070697_100012143 3300005536 Bacteria 6745
95 Ga0070697_100093231 3300005536 Bacteria 2493
96 Ga0070697_100255782 3300005536 Bacteria 1498
97 Ga0070697_100352810 3300005536 Bacteria 1271
98 Ga0070697_100562634 3300005536 Bacteria 1000
99 Ga0070686_100000902 3300005544 Bacteria 17283
100 Ga0070686_100022274 3300005544 Bacteria 3772
101 Ga0070695_100007539 3300005545 Bacteria 6445
102 Ga0070695_100034843 3300005545 Bacteria 3159
103 Ga0070695_100119862 3300005545 Unclassified 1798
104 Ga0070695_100188471 3300005545 Bacteria 1466
105 Ga0070695_100235377 3300005545 Bacteria 1326
106 Ga0070695_100433196 3300005545 Bacteria 1004
107 Ga0070696_100001730 3300005546 Bacteria 14304
108 Ga0070696_100002653 3300005546 Bacteria 11855
109 Ga0070696_100070721 3300005546 Bacteria 2455
110 Ga0070696_100076126 3300005546 Bacteria 2368
111 Ga0070696_100092559 3300005546 Bacteria 2155
112 Ga0070696_100113016 3300005546 Bacteria 1958
113 Ga0070693_100707374 3300005547 Bacteria 738
114 Ga0070665_100275162 3300005548 Unclassified 1685
115 Ga0070704_100001987 3300005549 Bacteria 11313
116 Ga0070704_100028744 3300005549 Unclassified 3702
117 Ga0070704_100041951 3300005549 Bacteria 3162
118 Ga0070704_100048406 3300005549 Bacteria 2976
119 Ga0070704_100070110 3300005549 Bacteria 2542
120 Ga0070704_100145484 3300005549 Unclassified 1856
121 Ga0070704_100999815 3300005549 Bacteria 756
122 Ga0068854_100097688 3300005578 Bacteria 2196
123 Ga0070702_100016528 3300005615 Bacteria 3787
124 Ga0070702_100090155 3300005615 Bacteria 1858
125 Ga0068859_100002079 3300005617 Bacteria 20415
126 Ga0068859_100106820 3300005617 Unclassified 2859
127 Ga0068864_100139061 3300005618 Bacteria 2189
128 Ga0068866_10040548 3300005718 Unclassified 2306
129 Ga0068861_100079860 3300005719 Bacteria 2558
130 Ga0068861_100357239 3300005719 Bacteria 1284
131 Ga0068870_10317231 3300005840 Bacteria 989
132 Ga0068863_100187403 3300005841 Bacteria 1987
133 Ga0068863_100303993 3300005841 Unclassified 1548
134 Ga0068860_100131107 3300005843 Unclassified 2406
135 Ga0068862_100598270 3300005844 Bacteria 1058
136 Ga0081455_10114689 3300005937 Bacteria 2134
137 Ga0081539_10012109 3300005985 Bacteria 6702
138 Ga0081539_10097446 3300005985 Bacteria 1506
139 Ga0070715_10044185 3300006163 Unclassified 1883
140 Ga0070716_100000007 3300006173 Bacteria 256300
141 Ga0070716_100094339 3300006173 Bacteria 1819
142 Ga0068871_100100127 3300006358 Bacteria 2427
143 Ga0075428_100036444 3300006844 Bacteria 5417
144 Ga0075431_100152713 3300006847 Bacteria 2377
145 Ga0075431_100157303 3300006847 Bacteria 2338
146 Ga0075431_100655355 3300006847 Bacteria 1030
147 Ga0075433_10021783 3300006852 Bacteria 5377
148 Ga0075433_10044408 3300006852 Bacteria 3861
149 Ga0075433_10045113 3300006852 Bacteria 3831
150 Ga0075433_10083400 3300006852 Bacteria 2821
151 Ga0075433_10100187 3300006852 Unclassified 2565
152 Ga0075433_10145055 3300006852 Bacteria 2110
153 Ga0075433_10275804 3300006852 Unclassified 1490
154 Ga0075433_10528957 3300006852 Bacteria 1037
155 Ga0075434_100000315 3300006871 Bacteria 34579
156 Ga0075434_100017951 3300006871 Bacteria 6827
157 Ga0075434_100421202 3300006871 Unclassified 1356
158 Ga0075429_100332026 3300006880 Unclassified 1331
159 Ga0068865_100164339 3300006881 Bacteria 1696
160 Ga0075436_100019582 3300006914 Bacteria 4638
161 Ga0075436_100023522 3300006914 Bacteria 4232
162 Ga0075436_100045199 3300006914 Bacteria 3037
163 Ga0075436_100195783 3300006914 Bacteria 1431
164 Ga0075436_100543771 3300006914 Bacteria 852
165 Ga0075436_100608487 3300006914 Unclassified 805
166 Ga0097620_100002079 3300006931 Bacteria 20415
167 Ga0097620_100106807 3300006931 Unclassified 2859
168 Ga0075435_100021272 3300007076 Bacteria 4986
169 Ga0075435_100021428 3300007076 Bacteria 4971
170 Ga0075435_100035274 3300007076 Bacteria 3969
171 Ga0099794_10000497 3300007265 Bacteria 13185
172 Ga0099794_10021004 3300007265 Bacteria 2963
173 Ga0099794_10122470 3300007265 Bacteria 1309
174 Ga0111539_10079447 3300009094 Unclassified 3859
175 Ga0111539_10333868 3300009094 Bacteria 1764
176 Ga0105247_10000001 3300009101 Bacteria 739726
177 Ga0105247_10001072 3300009101 Bacteria 20420
178 Ga0114129_10068769 3300009147 Unclassified 4937
179 Ga0114129_10122916 3300009147 Bacteria 3571
180 Ga0114129_10128222 3300009147 Bacteria 3487
181 Ga0105243_10530676 3300009148 Bacteria 1121
182 Ga0105243_10720457 3300009148 Bacteria 975
183 Ga0105242_10256398 3300009176 Unclassified 1578
184 Ga0105242_10361389 3300009176 Bacteria 1344
185 Ga0105242_10465313 3300009176 Bacteria 1195
186 Ga0105248_10001247 3300009177 Bacteria 28424
187 Ga0105248_10170437 3300009177 Bacteria 2453
188 Ga0105237_10639712 3300009545 Bacteria 1070
189 Ga0105249_10116380 3300009553 Bacteria 2534
190 Ga0105239_10000249 3300010375 Bacteria 80515
191 Ga0105239_10028774 3300010375 Bacteria 6110
192 Ga0157373_10200834 3300013100 Bacteria 1405
193 Ga0157373_10287481 3300013100 Bacteria 1166
194 Ga0157371_10194164 3300013102 Bacteria 1454
195 Ga0157371_10387560 3300013102 Bacteria 1021
196 Ga0157369_11145931 3300013105 Unclassified 794
197 Ga0157374_10000054 3300013296 Bacteria 121713
198 Ga0157374_10314556 3300013296 Bacteria 1551
199 Ga0157374_10823943 3300013296 Bacteria 944
200 Ga0157378_10006322 3300013297 Bacteria 10375
201 Ga0157378_10106807 3300013297 Unclassified 2561
202 Ga0157378_10567790 3300013297 Bacteria 1142
203 Ga0157372_10131273 3300013307 Bacteria 2882
204 Ga0163163_10120628 3300014325 Bacteria 2656
205 Ga0163163_10149833 3300014325 Bacteria 2377
206 Ga0163163_10570349 3300014325 Bacteria 1195
207 Ga0157380_10000232 3300014326 Bacteria 33436
208 Ga0157380_10004357 3300014326 Bacteria 9816
209 Ga0157380_10028206 3300014326 Bacteria 4277
210 Ga0182008_10005505 3300014497 Bacteria 7201
211 Ga0157377_10154319 3300014745 Bacteria 1422
212 Ga0157379_10011981 3300014968 Bacteria 7576
213 Ga0157376_10001518 3300014969 Bacteria 15333
214 Ga0157376_10221988 3300014969 Bacteria 1751
215 Ga0157376_10344397 3300014969 Unclassified 1424
216 Ga0182006_1000062 3300015261 Bacteria 155622
217 Ga0182007_10002830 3300015262 Bacteria 8448
218 Ga0182005_1002353 3300015265 Bacteria 6815
219 Ga0213872_10002668 3300021361 Bacteria 10330
220 Ga0213876_10000518 3300021384 Bacteria 29600
221 Ga0213876_10002976 3300021384 Bacteria 9820
222 Ga0207697_10026812 3300025315 Bacteria 2357
223 Ga0207653_10000126 3300025885 Bacteria 54271
224 Ga0207642_10004506 3300025899 Unclassified 4497
225 Ga0207642_10255814 3300025899 Unclassified 996
226 Ga0207688_10058532 3300025901 Bacteria 2168
227 Ga0207647_10010632 3300025904 Bacteria 6490
228 Ga0207685_10141613 3300025905 Unclassified 1079
229 Ga0207699_10052619 3300025906 Unclassified 2411
230 Ga0207684_10057398 3300025910 Bacteria 3303
231 Ga0207684_10102366 3300025910 Bacteria 2449
232 Ga0207684_10304362 3300025910 Bacteria 1374
233 Ga0207684_10442358 3300025910 Bacteria 1116
234 Ga0207707_10008072 3300025912 Bacteria 9141
235 Ga0207707_10170919 3300025912 Bacteria 1899
236 Ga0207693_10357331 3300025915 Unclassified 1143
237 Ga0207693_10910774 3300025915 Unclassified 674
238 Ga0207660_10027839 3300025917 Bacteria 3861
239 Ga0207660_10153448 3300025917 Bacteria 1771
240 Ga0207660_10330281 3300025917 Bacteria 1219
241 Ga0207662_10241016 3300025918 Unclassified 1184
242 Ga0207646_10000234 3300025922 Bacteria 76450
243 Ga0207646_10129699 3300025922 Bacteria 2269
244 Ga0207646_10146547 3300025922 Bacteria 2127
245 Ga0207646_10269337 3300025922 Unclassified 1539
246 Ga0207646_10605380 3300025922 Bacteria 983
247 Ga0207646_10654749 3300025922 Bacteria 941
248 Ga0207659_10224023 3300025926 Unclassified 1513
249 Ga0207700_10234771 3300025928 Bacteria 1561
250 Ga0207664_10258891 3300025929 Bacteria 1521
251 Ga0207644_10427470 3300025931 Bacteria 1086
252 Ga0207690_10475912 3300025932 Bacteria 1007
253 Ga0207706_10079902 3300025933 Bacteria 2876
254 Ga0207686_10243871 3300025934 Bacteria 1309
255 Ga0207686_10618951 3300025934 Unclassified 854
256 Ga0207670_10000317 3300025936 Bacteria 28976
257 Ga0207670_10063082 3300025936 Unclassified 2534
258 Ga0207670_10085511 3300025936 Bacteria 2216
259 Ga0207669_10109433 3300025937 Bacteria 1848
260 Ga0207665_10000027 3300025939 Bacteria 96926
261 Ga0207711_10004676 3300025941 Bacteria 11627
262 Ga0207711_10026832 3300025941 Bacteria 4835
263 Ga0207689_10016351 3300025942 Bacteria 6283
264 Ga0207661_10096252 3300025944 Unclassified 2477
265 Ga0207679_10238890 3300025945 Unclassified 1538
266 Ga0207640_10137880 3300025981 Bacteria 1774
267 Ga0207703_10164172 3300026035 Bacteria 1947
268 Ga0207678_10209337 3300026067 Unclassified 1668
269 Ga0207708_10001297 3300026075 Bacteria 18799
270 Ga0207708_10042180 3300026075 Bacteria 3479
271 Ga0207641_10147133 3300026088 Unclassified 2131
272 Ga0207648_10004223 3300026089 Bacteria 14844
273 Ga0207648_10034747 3300026089 Bacteria 4442
274 Ga0207648_10413385 3300026089 Bacteria 1224
275 Ga0207676_10038971 3300026095 Bacteria 3632
276 Ga0207674_10003602 3300026116 Bacteria 18885
277 Ga0207675_100056296 3300026118 Bacteria 3667
278 Ga0207675_100242857 3300026118 Bacteria 1741
279 Ga0207683_10224949 3300026121 Bacteria 1710
280 Ga0209588_1001697 3300027671 Bacteria 5814
281 Ga0209588_1002190 3300027671 Bacteria 5279
282 Ga0268266_10293613 3300028379 Unclassified 1514
283 Ga0268264_10066285 3300028381 Unclassified 3044
284 Ga0265318_10019198 3300028577 Bacteria 2775
285 Ga0307517_10167599 3300028786 Unclassified 1454
286 Ga0265338_10062295 3300028800 Bacteria 3261
287 Ga0373956_0162541 3300035119 Bacteria 1053
288 Ga0373957_0093319 3300035120 Bacteria 1199
289 Ga0373931_0226901 3300035691 Bacteria 1127
290 Ga0373931_0567571 3300035691 Unclassified 739
291 Ga0373935_0483125 3300035692 Unclassified 898
292 Ga0373933_0598019 3300035724 Bacteria 724
293 Ga0436364_0235999 3300037853 Bacteria 4958
294 Ga0436364_0589569 3300037853 Bacteria 1101
295 Ga0436365_0073655 3300039437 Bacteria 10229
296 Ga0451577_0040376 3300042876 Bacteria 4189
297 Ga0453683_0028930 3300044673 Bacteria 3506
298 Ga0453684_0014533 3300044712 Bacteria 12571
299 Ga0451576_0001826 3300045051 Bacteria 34537
300 Ga0451576_0005833 3300045051 Bacteria 15299
301 Ga0451576_0015698 3300045051 Bacteria 8384
302 Ga0451576_0018693 3300045051 Bacteria 7582
303 Ga0451576_0095947 3300045051 Bacteria 3084
304 Ga0451576_0130842 3300045051 Bacteria 2616
305 Ga0451576_0279589 3300045051 Bacteria 1745
306 Ga0451576_0449643 3300045051 Bacteria 1352
307 Ga0451576_0470976 3300045051 Bacteria 1319
308 Ga0495641_0101125 3300046461 Bacteria 1286
309 Ga0495664_0206243 3300046477 Bacteria 1191
310 Ga0495585_0000131 3300046492 Bacteria 81427
311 Ga0495594_0292140 3300046499 Bacteria 929
312 Ga0495628_0076664 3300046516 Bacteria 2601
313 Ga0495631_0000249 3300046518 Bacteria 37329
314 Ga0495648_0005506 3300046524 Bacteria 10504
315 Ga0495666_0065436 3300046526 Bacteria 1734
316 Ga0495642_0066938 3300046528 Bacteria 1497
317 Ga0495642_0176062 3300046528 Bacteria 930
318 Ga0495586_0063202 3300046535 Bacteria 2016
319 Ga0495587_0187898 3300046536 Unclassified 1170
320 Ga0495645_0338460 3300046543 Bacteria 972
321 Ga0495656_0175633 3300046615 Bacteria 1050
322 Ga0495668_0009540 3300046616 Bacteria 5950
323 Ga0495611_0000088 3300046648 Bacteria 64558
324 Ga0495661_0001009 3300046665 Bacteria 25232
325 Ga0495657_0006947 3300046675 Bacteria 8788
326 Ga0495647_0038190 3300046681 Unclassified 1815
327 Ga0495658_0165890 3300046683 Bacteria 1364
328 Ga0495669_0021354 3300046684 Bacteria 2809
329 Ga0495660_0000936 3300046810 Bacteria 21389
330 Ga0495674_0162910 3300047319 Bacteria 1865
331 Ga0495675_0132323 3300047444 Bacteria 1550
332 Ga0495673_0000072 3300047469 Bacteria 213166
333 Ga0495686_0000263 3300047472 Bacteria 94308
334 Ga0495686_0025745 3300047472 Bacteria 3854
335 Ga0495614_0096545 3300048089 Bacteria 1289
336 Ga0496100_0100120 3300048903 Unclassified 1996
337 Ga0496101_0370213 3300048904 Bacteria 1127
338 Ga0496103_0177379 3300048906 Bacteria 1369
339 Ga0496104_0284277 3300048907 Unclassified 1567
340 Ga0496104_0975487 3300048907 Unclassified 752
341 Ga0496107_0109758 3300048910 Bacteria 2027
342 Ga0496108_0855422 3300048911 Unclassified 782
343 Ga0496109_0125534 3300048912 Bacteria 2393
344 Ga0496113_0679385 3300048916 Unclassified 823
345 Ga0496115_0055746 3300048918 Unclassified 3175
346 Ga0496116_0042673 3300048919 Bacteria 3098
347 Ga0496117_0216551 3300048920 Bacteria 1069
348 Ga0496121_0001210 3300048924 Bacteria 45020
349 Ga0496121_0075480 3300048924 Bacteria 2693
350 Ga0496126_0122104 3300048929 Bacteria 2258
351 Ga0495682_0001819 3300049460 Bacteria 10718
352 Ga0501034_0073360 3300049571 Bacteria 3431
353 Ga0501207_031031 3300049654 Bacteria 898
354 Ga0501211_010674 3300049658 Bacteria 900
355 Ga0501242_000144 3300049674 Bacteria 5249
356 Ga0501259_001171 3300049688 Unclassified 4367
357 Ga0501225_0009231 3300049705 Unclassified 2813
358 Ga0501044_0139959 3300049823 Bacteria 2409
359 nmdc:mga05p37_504400_c1 3300050507 Bacteria 1388
360 nmdc:mga05p37_528247_c1 3300050507 Bacteria 1348
361 nmdc:mga05p37_606870_c1 3300050507 Bacteria 1234
362 nmdc:mga09592_476994_c1 3300050508 Unclassified 1075
363 nmdc:mga06r32_172961_c1 3300050510 Bacteria 2144
364 nmdc:mga06r32_463222_c1 3300050510 Bacteria 1246
365 nmdc:mga08y16_203140_c1 3300050511 Unclassified 2053
366 nmdc:mga0n895_118540_c1 3300050512 Unclassified 2667
367 nmdc:mga0n895_148674_c1 3300050512 Unclassified 2372
368 nmdc:mga0n895_291789_c1 3300050512 Unclassified 1654
369 nmdc:mga0n895_37952_c1 3300050512 Unclassified 4664
370 nmdc:mga0n895_460031_c1 3300050512 Unclassified 1284
371 nmdc:mga0n895_555495_c1 3300050512 Bacteria 1154
372 nmdc:mga0n895_6939_c1 3300050512 Bacteria 9675
373 nmdc:mga0rr50_11484_c1 3300050513 Bacteria 5674
374 nmdc:mga0rr50_132458_c1 3300050513 Bacteria 1998
375 nmdc:mga0rr50_9600_c1 3300050513 Bacteria 6095
376 nmdc:mga08x19_15221_c1 3300050514 Bacteria 4678
377 nmdc:mga08x19_195605_c1 3300050514 Bacteria 1385
378 nmdc:mga08x19_40509_c1 3300050514 Bacteria 2965
379 nmdc:mga08x19_539407_c1 3300050514 Unclassified 825
380 nmdc:mga08x19_718_c1 3300050514 Bacteria 21192
381 nmdc:mga0a205_151278_c1 3300050515 Bacteria 2220
382 nmdc:mga0a205_23866_c1 3300050515 Bacteria 5805
383 nmdc:mga0a205_24119_c1 3300050515 Bacteria 5777
384 nmdc:mga0a205_294463_c1 3300050515 Bacteria 1497
385 nmdc:mga0a205_3160_c1 3300050515 Bacteria 14618
386 nmdc:mga0a205_446559_c1 3300050515 Bacteria 1154
387 nmdc:mga0a205_52652_c1 3300050515 Bacteria 3928
388 Ga0500566_0230928 3300053094 Unclassified 913
389 Ga0500616_0130981 3300053153 Bacteria 1185
390 Ga0500645_001021 3300053730 Bacteria 15687
391 Ga0590077_007903 3300059426 Bacteria 2175
392 2721028474 2718218334 Bacteria 4765486
393 Ga0068857_100029823
394 JGI24737J22298_10079613
395 rootH2_10000256
396 rootH2_10284619
397 rootH2_10323289
398 rootL2_10146969
399 rootL2_10193217
400 rootL2_10357646
401 rootH1_10129672
402 rootH1_10195394
403 Ga0058863_11648696
404 Ga0065717_1003857
405 Ga0065704_10005192
406 Ga0065715_10028988
407 Ga0065715_10292359
408 Ga0065707_10150745
409 Ga0070676_10202638
410 Ga0070683_100059807
411 Ga0070683_100658670
412 Ga0070690_100000241
413 Ga0070690_100985436
414 Ga0068869_100085989
415 Ga0070666_10356864
416 Ga0070680_100001044
417 Ga0070680_100003453
418 Ga0070680_100209160
419 Ga0070689_100000299
420 Ga0070689_100022219
421 Ga0070689_100120929
422 Ga0070687_100005131
423 Ga0070687_100226214
424 Ga0070661_100070209
425 Ga0070669_100852519
426 Ga0070675_100011689
427 Ga0070671_100964129
428 Ga0070674_100044562
429 Ga0070674_100068722
430 Ga0070674_100163704
431 Ga0070688_100001140
432 Ga0070688_100323936
433 Ga0070659_100004363
434 Ga0070703_10001843
435 Ga0070703_10138304
436 Ga0070709_10148417
437 Ga0070714_100196859
438 Ga0070713_100036270
439 Ga0070710_10160840
440 Ga0070701_10001958
441 Ga0070701_10081181
442 Ga0070705_100002122
443 Ga0070705_100018874
444 Ga0070700_100001159
445 Ga0070700_100016139
446 Ga0070700_100396506
447 Ga0070700_100550133
448 Ga0070700_100819446
449 Ga0070694_100000469
450 Ga0070694_100001666
451 Ga0070694_100050524
452 Ga0070694_100073190
453 Ga0070694_100172975
454 Ga0070694_100234966
455 Ga0070694_100297362
456 Ga0070694_100591074
457 Ga0070708_100017538
458 Ga0070708_100104430
459 Ga0070708_100260063
460 Ga0070681_10004493
461 Ga0070681_10140820
462 Ga0070681_10233319
463 Ga0070681_10885709
464 Ga0068867_100002772
465 Ga0068867_100122913
466 Ga0070685_10000330
467 Ga0070706_100204760
468 Ga0070706_100427785
469 Ga0070707_100000095
470 Ga0070707_100005481
471 Ga0070707_100150101
472 Ga0070707_100324969
473 Ga0070707_100553006
474 Ga0070707_100805227
475 Ga0070698_100002792
476 Ga0070698_100446852
477 Ga0070698_100548340
478 Ga0070699_100011787
479 Ga0070699_100015740
480 Ga0070699_100094244
481 Ga0070699_100130819
482 Ga0070699_100155149
483 Ga0070679_100035618
484 Ga0070684_100032986
485 Ga0070684_100397172
486 Ga0070697_100012143
487 Ga0070697_100093231
488 Ga0070697_100255782
489 Ga0070697_100352810
490 Ga0070697_100562634
491 Ga0070686_100000902
492 Ga0070686_100022274
493 Ga0070695_100007539
494 Ga0070695_100034843
495 Ga0070695_100119862
496 Ga0070695_100188471
497 Ga0070695_100235377
498 Ga0070695_100433196
499 Ga0070696_100001730
500 Ga0070696_100002653
501 Ga0070696_100070721
502 Ga0070696_100076126
503 Ga0070696_100092559
504 Ga0070696_100113016
505 Ga0070693_100707374
506 Ga0070665_100275162
507 Ga0070704_100001987
508 Ga0070704_100028744
509 Ga0070704_100041951
510 Ga0070704_100048406
511 Ga0070704_100070110
512 Ga0070704_100145484
513 Ga0070704_100999815
514 Ga0068854_100097688
515 Ga0070702_100016528
516 Ga0070702_100090155
517 Ga0068859_100002079
518 Ga0068859_100106820
519 Ga0068864_100139061
520 Ga0068866_10040548
521 Ga0068861_100079860
522 Ga0068861_100357239
523 Ga0068870_10317231
524 Ga0068863_100187403
525 Ga0068863_100303993
526 Ga0068860_100131107
527 Ga0068862_100598270
528 Ga0081455_10114689
529 Ga0081539_10012109
530 Ga0081539_10097446
531 Ga0070715_10044185
532 Ga0070716_100000007
533 Ga0070716_100094339
534 Ga0068871_100100127
535 Ga0075428_100036444
536 Ga0075431_100152713
537 Ga0075431_100157303
538 Ga0075431_100655355
539 Ga0075433_10021783
540 Ga0075433_10044408
541 Ga0075433_10045113
542 Ga0075433_10083400
543 Ga0075433_10100187
544 Ga0075433_10145055
545 Ga0075433_10275804
546 Ga0075433_10528957
547 Ga0075434_100000315
548 Ga0075434_100017951
549 Ga0075434_100421202
550 Ga0075429_100332026
551 Ga0068865_100164339
552 Ga0075436_100019582
553 Ga0075436_100023522
554 Ga0075436_100045199
555 Ga0075436_100195783
556 Ga0075436_100543771
557 Ga0075436_100608487
558 Ga0097620_100002079
559 Ga0097620_100106807
560 Ga0075435_100021272
561 Ga0075435_100021428
562 Ga0075435_100035274
563 Ga0099794_10000497
564 Ga0099794_10021004
565 Ga0099794_10122470
566 Ga0111539_10079447
567 Ga0111539_10333868
568 Ga0105247_10000001
569 Ga0105247_10001072
570 Ga0114129_10068769
571 Ga0114129_10122916
572 Ga0114129_10128222
573 Ga0105243_10530676
574 Ga0105243_10720457
575 Ga0105242_10256398
576 Ga0105242_10361389
577 Ga0105242_10465313
578 Ga0105248_10001247
579 Ga0105248_10170437
580 Ga0105237_10639712
581 Ga0105249_10116380
582 Ga0105239_10000249
583 Ga0105239_10028774
584 Ga0157373_10200834
585 Ga0157373_10287481
586 Ga0157371_10194164
587 Ga0157371_10387560
588 Ga0157369_11145931
589 Ga0157374_10000054
590 Ga0157374_10314556
591 Ga0157374_10823943
592 Ga0157378_10006322
593 Ga0157378_10106807
594 Ga0157378_10567790
595 Ga0157372_10131273
596 Ga0163163_10120628
597 Ga0163163_10149833
598 Ga0163163_10570349
599 Ga0157380_10000232
600 Ga0157380_10004357
601 Ga0157380_10028206
602 Ga0182008_10005505
603 Ga0157377_10154319
604 Ga0157379_10011981
605 Ga0157376_10001518
606 Ga0157376_10221988
607 Ga0157376_10344397
608 Ga0182006_1000062
609 Ga0182007_10002830
610 Ga0182005_1002353
611 Ga0213872_10002668
612 Ga0213876_10000518
613 Ga0213876_10002976
614 Ga0207697_10026812
615 Ga0207653_10000126
616 Ga0207642_10004506
617 Ga0207642_10255814
618 Ga0207688_10058532
619 Ga0207647_10010632
620 Ga0207685_10141613
621 Ga0207699_10052619
622 Ga0207684_10057398
623 Ga0207684_10102366
624 Ga0207684_10304362
625 Ga0207684_10442358
626 Ga0207707_10008072
627 Ga0207707_10170919
628 Ga0207693_10357331
629 Ga0207693_10910774
630 Ga0207660_10027839
631 Ga0207660_10153448
632 Ga0207660_10330281
633 Ga0207662_10241016
634 Ga0207646_10000234
635 Ga0207646_10129699
636 Ga0207646_10146547
637 Ga0207646_10269337
638 Ga0207646_10605380
639 Ga0207646_10654749
640 Ga0207659_10224023
641 Ga0207700_10234771
642 Ga0207664_10258891
643 Ga0207644_10427470
644 Ga0207690_10475912
645 Ga0207706_10079902
646 Ga0207686_10243871
647 Ga0207686_10618951
648 Ga0207670_10000317
649 Ga0207670_10063082
650 Ga0207670_10085511
651 Ga0207669_10109433
652 Ga0207665_10000027
653 Ga0207711_10004676
654 Ga0207711_10026832
655 Ga0207689_10016351
656 Ga0207661_10096252
657 Ga0207679_10238890
658 Ga0207640_10137880
659 Ga0207703_10164172
660 Ga0207678_10209337
661 Ga0207708_10001297
662 Ga0207708_10042180
663 Ga0207641_10147133
664 Ga0207648_10004223
665 Ga0207648_10034747
666 Ga0207648_10413385
667 Ga0207676_10038971
668 Ga0207674_10003602
669 Ga0207675_100056296
670 Ga0207675_100242857
671 Ga0207683_10224949
672 Ga0209588_1001697
673 Ga0209588_1002190
674 Ga0268266_10293613
675 Ga0268264_10066285
676 Ga0265318_10019198
677 Ga0307517_10167599
678 Ga0265338_10062295
679 Ga0373956_0162541
680 Ga0373957_0093319
681 Ga0373931_0226901
682 Ga0373931_0567571
683 Ga0373935_0483125
684 Ga0373933_0598019
685 Ga0436364_0235999
686 Ga0436364_0589569
687 Ga0436365_0073655
688 Ga0451577_0040376
689 Ga0453683_0028930
690 Ga0453684_0014533
691 Ga0451576_0001826
692 Ga0451576_0005833
693 Ga0451576_0015698
694 Ga0451576_0018693
695 Ga0451576_0095947
696 Ga0451576_0130842
697 Ga0451576_0279589
698 Ga0451576_0449643
699 Ga0451576_0470976
700 Ga0495641_0101125
701 Ga0495664_0206243
702 Ga0495585_0000131
703 Ga0495594_0292140
704 Ga0495628_0076664
705 Ga0495631_0000249
706 Ga0495648_0005506
707 Ga0495666_0065436
708 Ga0495642_0066938
709 Ga0495642_0176062
710 Ga0495586_0063202
711 Ga0495587_0187898
712 Ga0495645_0338460
713 Ga0495656_0175633
714 Ga0495668_0009540
715 Ga0495611_0000088
716 Ga0495661_0001009
717 Ga0495657_0006947
718 Ga0495647_0038190
719 Ga0495658_0165890
720 Ga0495669_0021354
721 Ga0495660_0000936
722 Ga0495674_0162910
723 Ga0495675_0132323
724 Ga0495673_0000072
725 Ga0495686_0000263
726 Ga0495686_0025745
727 Ga0495614_0096545
728 Ga0496100_0100120
729 Ga0496101_0370213
730 Ga0496103_0177379
731 Ga0496104_0284277
732 Ga0496104_0975487
733 Ga0496107_0109758
734 Ga0496108_0855422
735 Ga0496109_0125534
736 Ga0496113_0679385
737 Ga0496115_0055746
738 Ga0496116_0042673
739 Ga0496117_0216551
740 Ga0496121_0001210
741 Ga0496121_0075480
742 Ga0496126_0122104
743 Ga0495682_0001819
744 Ga0501034_0073360
745 Ga0501207_031031
746 Ga0501211_010674
747 Ga0501242_000144
748 Ga0501259_001171
749 Ga0501225_0009231
750 Ga0501044_0139959
751 nmdc:mga05p37_504400_c1
752 nmdc:mga05p37_528247_c1
753 nmdc:mga05p37_606870_c1
754 nmdc:mga09592_476994_c1
755 nmdc:mga06r32_172961_c1
756 nmdc:mga06r32_463222_c1
757 nmdc:mga08y16_203140_c1
758 nmdc:mga0n895_118540_c1
759 nmdc:mga0n895_148674_c1
760 nmdc:mga0n895_291789_c1
761 nmdc:mga0n895_37952_c1
762 nmdc:mga0n895_460031_c1
763 nmdc:mga0n895_555495_c1
764 nmdc:mga0n895_6939_c1
765 nmdc:mga0rr50_11484_c1
766 nmdc:mga0rr50_132458_c1
767 nmdc:mga0rr50_9600_c1
768 nmdc:mga08x19_15221_c1
769 nmdc:mga08x19_195605_c1
770 nmdc:mga08x19_40509_c1
771 nmdc:mga08x19_539407_c1
772 nmdc:mga08x19_718_c1
773 nmdc:mga0a205_151278_c1
774 nmdc:mga0a205_23866_c1
775 nmdc:mga0a205_24119_c1
776 nmdc:mga0a205_294463_c1
777 nmdc:mga0a205_3160_c1
778 nmdc:mga0a205_446559_c1
779 nmdc:mga0a205_52652_c1
780 Ga0500566_0230928
781 Ga0500616_0130981
782 Ga0500645_001021
783 Ga0590077_007903
784 2721028474

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

176

232

0.98

PF00072

Response_reg

Response regulator receiver domain

33

145

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cz5-assembly2.cif.gz_B crystal structure of two-component response regulator, luxr family, from aurantimonas sp. si85-9a1 0.9618 10 138
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9523 153 213
3eul-assembly2.cif.gz_B structure of the signal receiver domain of the putative response regulator narl from mycobacterium tuberculosis 0.9432 10 131
6ekh-assembly1.cif.gz_Y crystal structure of activated chey from methanoccocus maripaludis 0.9417 10 122
4wul-assembly1.cif.gz_B crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9405 153 213
ID Description Score Start End Superfamily
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9753 155 211 1.10.10.10
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9752 155 211 1.10.10.10
1zn2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.973 155 211 1.10.10.10
3cz5B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9618 10 138 3.40.50.2300
4if4D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9435 12 138 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A0F9FFZ2-F1-model_v4 Response regulatory domain-containing protein 0.9796 11 138 GO:0000160
GO:0003677
AF-A0A6V8NDC5-F1-model_v4 Response regulatory domain-containing protein 0.9772 11 138 GO:0000160
GO:0003677
AF-A0A0S8EZD3-F1-model_v4 LuxR family transcriptional regulator 0.9763 11 138 GO:0000160
GO:0003677
GO:0006355
AF-A0A532CJ51-F1-model_v4 Response regulator transcription factor 0.9733 9 128 GO:0000160
AF-A0A1F8M0R8-F1-model_v4 DNA-binding response regulator 0.9709 10 138 GO:0000160
GO:0003677

Map