F432233

General Info

Members Datasets Scaffolds Average Seq Length
392 157 392 158

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100004440|Ga0070680_1000044409
Length 180
Sequence VFNISVTPAKAGVPLTLEWLKKSGIPAFAGMTMFIASPALAQEKQPPYWASIASGQAMTHTGPGRNYPNVWLYQRRDLPVRVVKKYETWRLIQDPDGAQGWMLVTMLSDRRTAIVKPGEPRPIRADPSDDAKVRYEAEGGVVGRIDKCKGNGWCRIAIGKKEGYVRTSDLWGVGADEVVD

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
122 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
123 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.02
Rhizosphere 98.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001147 3300001915 Bacteria 7834
2 JGI24741J21665_1040731 3300001915 Bacteria 685
3 JGI24740J21852_10024938 3300001979 Bacteria 2022
4 JGI24740J21852_10025929 3300001979 Bacteria 1969
5 JGI24740J21852_10030004 3300001979 Bacteria 1777
6 JGI24740J21852_10087257 3300001979 Bacteria 809
7 JGI24735J21928_10008416 3300002067 Bacteria 3335
8 JGI24735J21928_10037000 3300002067 Bacteria 1431
9 Ga0070658_10000653 3300005327 Bacteria 29964
10 Ga0070658_10046953 3300005327 Bacteria 3494
11 Ga0068869_100464117 3300005334 Bacteria 1052
12 Ga0070666_10048290 3300005335 Bacteria 2859
13 Ga0070680_100004440 3300005336 Bacteria 10563
14 Ga0070680_100007665 3300005336 Bacteria 8235
15 Ga0070680_100441909 3300005336 Bacteria 1110
16 Ga0070680_100720553 3300005336 Bacteria 858
17 Ga0070680_101256874 3300005336 Bacteria 641
18 Ga0070682_100020131 3300005337 Bacteria 3923
19 Ga0070682_100097440 3300005337 Bacteria 1936
20 Ga0070682_100240394 3300005337 Bacteria 1299
21 Ga0068868_100001541 3300005338 Bacteria 15738
22 Ga0068868_100262471 3300005338 Bacteria 1457
23 Ga0070660_100003749 3300005339 Bacteria 10506
24 Ga0070660_100012089 3300005339 Bacteria 6162
25 Ga0070661_100021082 3300005344 Bacteria 4653
26 Ga0070661_100031573 3300005344 Bacteria 3831
27 Ga0070661_100204040 3300005344 Bacteria 1511
28 Ga0070661_100337149 3300005344 Bacteria 1180
29 Ga0070661_100524988 3300005344 Unclassified 950
30 Ga0070661_101169630 3300005344 Bacteria 642
31 Ga0070692_10487099 3300005345 Bacteria 796
32 Ga0070675_101212725 3300005354 Bacteria 695
33 Ga0070671_100009051 3300005355 Bacteria 7992
34 Ga0070674_100063683 3300005356 Bacteria 2582
35 Ga0070674_100268104 3300005356 Bacteria 1348
36 Ga0070674_100304323 3300005356 Bacteria 1272
37 Ga0070673_100013491 3300005364 Bacteria 5656
38 Ga0070673_100077241 3300005364 Bacteria 2691
39 Ga0070673_100100108 3300005364 Bacteria 2385
40 Ga0070659_100020150 3300005366 Bacteria 5064
41 Ga0070659_100113760 3300005366 Bacteria 2186
42 Ga0070667_100003268 3300005367 Bacteria 13855
43 Ga0070667_100020258 3300005367 Bacteria 5522
44 Ga0070714_100062689 3300005435 Bacteria 3195
45 Ga0070713_100040618 3300005436 Bacteria 3783
46 Ga0070713_100254909 3300005436 Bacteria 1601
47 Ga0070713_100414860 3300005436 Bacteria 1259
48 Ga0070663_100016621 3300005455 Bacteria 4785
49 Ga0070663_100035172 3300005455 Bacteria 3474
50 Ga0070663_100040431 3300005455 Bacteria 3264
51 Ga0070663_100063745 3300005455 Bacteria 2662
52 Ga0070662_100001441 3300005457 Bacteria 14657
53 Ga0070681_10115179 3300005458 Bacteria 2626
54 Ga0068867_100108089 3300005459 Bacteria 2133
55 Ga0070679_100047356 3300005530 Bacteria 4285
56 Ga0070679_100066072 3300005530 Bacteria 3605
57 Ga0070684_100013787 3300005535 Bacteria 6525
58 Ga0070684_100097370 3300005535 Bacteria 2623
59 Ga0070684_100744523 3300005535 Bacteria 915
60 Ga0068853_100036691 3300005539 Bacteria 4169
61 Ga0068853_100048822 3300005539 Bacteria 3636
62 Ga0068853_100111141 3300005539 Bacteria 2434
63 Ga0070665_100223883 3300005548 Bacteria 1882
64 Ga0068855_100044199 3300005563 Bacteria 5273
65 Ga0068855_100157695 3300005563 Bacteria 2578
66 Ga0068855_100411006 3300005563 Bacteria 1481
67 Ga0070664_100067429 3300005564 Bacteria 3058
68 Ga0070664_100097566 3300005564 Bacteria 2551
69 Ga0068857_100032087 3300005577 Bacteria 4643
70 Ga0068857_100340378 3300005577 Bacteria 1388
71 Ga0068854_100015325 3300005578 Bacteria 5075
72 Ga0068854_100046561 3300005578 Bacteria 3088
73 Ga0068854_100087281 3300005578 Bacteria 2314
74 Ga0068854_100164046 3300005578 Bacteria 1723
75 Ga0068856_100014649 3300005614 Bacteria 7573
76 Ga0068856_100021369 3300005614 Bacteria 6291
77 Ga0068856_100122424 3300005614 Bacteria 2603
78 Ga0068856_100126288 3300005614 Bacteria 2561
79 Ga0068856_100254575 3300005614 Bacteria 1771
80 Ga0068856_101118063 3300005614 Bacteria 805
81 Ga0068856_101545823 3300005614 Bacteria 677
82 Ga0068852_100004075 3300005616 Bacteria 10281
83 Ga0068852_100321591 3300005616 Bacteria 1503
84 Ga0068852_100340024 3300005616 Bacteria 1462
85 Ga0068852_100642100 3300005616 Bacteria 1068
86 Ga0068852_100851216 3300005616 Bacteria 927
87 Ga0068859_100089335 3300005617 Bacteria 3131
88 Ga0068864_100012913 3300005618 Bacteria 6910
89 Ga0068866_10015235 3300005718 Bacteria 3412
90 Ga0068851_10131736 3300005834 Bacteria 1353
91 Ga0068870_10092898 3300005840 Bacteria 1691
92 Ga0068863_100031536 3300005841 Bacteria 5056
93 Ga0068863_101166126 3300005841 Bacteria 776
94 Ga0068858_100008274 3300005842 Bacteria 9999
95 Ga0068860_100005315 3300005843 Bacteria 13069
96 Ga0068860_100114234 3300005843 Bacteria 2582
97 Ga0068860_100191901 3300005843 Bacteria 1977
98 Ga0068862_100008095 3300005844 Bacteria 8699
99 Ga0081539_10010498 3300005985 Bacteria 7512
100 Ga0070717_10006409 3300006028 Bacteria 8653
101 Ga0070712_100219938 3300006175 Bacteria 1503
102 Ga0070712_100799434 3300006175 Bacteria 809
103 Ga0097621_100006933 3300006237 Bacteria 8065
104 Ga0097621_100044034 3300006237 Bacteria 3600
105 Ga0097621_100827995 3300006237 Unclassified 859
106 Ga0068871_100024044 3300006358 Bacteria 4721
107 Ga0068871_100332358 3300006358 Bacteria 1340
108 Ga0097620_100089332 3300006931 Bacteria 3131
109 Ga0105240_10592920 3300009093 Bacteria 1221
110 Ga0105240_10653777 3300009093 Bacteria 1152
111 Ga0105240_11549264 3300009093 Bacteria 694
112 Ga0105243_10679192 3300009148 Unclassified 1001
113 Ga0105241_10260769 3300009174 Bacteria 1473
114 Ga0105242_10066310 3300009176 Bacteria 2980
115 Ga0105248_10001470 3300009177 Bacteria 26223
116 Ga0105248_10465069 3300009177 Bacteria 1426
117 Ga0105237_10662541 3300009545 Bacteria 1050
118 Ga0105238_10198520 3300009551 Bacteria 1981
119 Ga0105238_11134897 3300009551 Bacteria 805
120 Ga0105249_10548984 3300009553 Bacteria 1206
121 Ga0105239_10065787 3300010375 Unclassified 3982
122 Ga0105239_10786062 3300010375 Bacteria 1090
123 Ga0157373_10020213 3300013100 Bacteria 4843
124 Ga0157373_10063396 3300013100 Bacteria 2617
125 Ga0157373_10134914 3300013100 Bacteria 1736
126 Ga0157373_10728465 3300013100 Bacteria 728
127 Ga0157371_10006632 3300013102 Bacteria 9492
128 Ga0157371_10054801 3300013102 Bacteria 2831
129 Ga0157371_10147955 3300013102 Bacteria 1674
130 Ga0157371_10200421 3300013102 Bacteria 1431
131 Ga0157370_10372425 3300013104 Bacteria 1316
132 Ga0157370_10488485 3300013104 Bacteria 1131
133 Ga0157369_10000141 3300013105 Bacteria 102055
134 Ga0157369_10004026 3300013105 Bacteria 17420
135 Ga0157369_10071147 3300013105 Bacteria 3735
136 Ga0157369_10082554 3300013105 Bacteria 3438
137 Ga0157369_10188621 3300013105 Bacteria 2167
138 Ga0157369_10551639 3300013105 Bacteria 1191
139 Ga0157369_10621933 3300013105 Bacteria 1114
140 Ga0157369_10651512 3300013105 Bacteria 1086
141 Ga0157378_10177916 3300013297 Bacteria 1999
142 Ga0157378_11275193 3300013297 Unclassified 775
143 Ga0163162_10385889 3300013306 Bacteria 1534
144 Ga0157372_10042440 3300013307 Bacteria 5031
145 Ga0157372_10161152 3300013307 Bacteria 2593
146 Ga0157372_10719107 3300013307 Bacteria 1162
147 Ga0157372_11267597 3300013307 Bacteria 851
148 Ga0157375_10087702 3300013308 Bacteria 3164
149 Ga0157375_10308145 3300013308 Bacteria 1747
150 Ga0157379_10157346 3300014968 Bacteria 2050
151 Ga0157379_10225296 3300014968 Bacteria 1699
152 Ga0206353_10214899 3300020082 Bacteria 1593
153 Ga0154015_1380812 3300020610 Bacteria 838
154 Ga0207673_1008752 3300025290 Bacteria 1286
155 Ga0207697_10039732 3300025315 Bacteria 1931
156 Ga0207682_10011290 3300025893 Bacteria 3490
157 Ga0207688_10115387 3300025901 Bacteria 1563
158 Ga0207680_10001155 3300025903 Bacteria 12443
159 Ga0207680_10226292 3300025903 Bacteria 1284
160 Ga0207647_10001359 3300025904 Bacteria 18789
161 Ga0207647_10061465 3300025904 Bacteria 2292
162 Ga0207647_10064670 3300025904 Bacteria 2222
163 Ga0207647_10099823 3300025904 Bacteria 1724
164 Ga0207647_10536703 3300025904 Bacteria 650
165 Ga0207647_10579872 3300025904 Bacteria 620
166 Ga0207699_10048535 3300025906 Bacteria 2494
167 Ga0207645_10046374 3300025907 Bacteria 2776
168 Ga0207643_10064382 3300025908 Bacteria 2098
169 Ga0207643_10302477 3300025908 Bacteria 996
170 Ga0207705_10000003 3300025909 Bacteria 709270
171 Ga0207705_10000979 3300025909 Bacteria 23328
172 Ga0207705_10008706 3300025909 Bacteria 7395
173 Ga0207705_10011741 3300025909 Bacteria 6328
174 Ga0207705_10044575 3300025909 Bacteria 3187
175 Ga0207705_10443812 3300025909 Bacteria 1006
176 Ga0207705_10654314 3300025909 Bacteria 817
177 Ga0207705_10842348 3300025909 Bacteria 711
178 Ga0207705_10960832 3300025909 Bacteria 661
179 Ga0207654_10348058 3300025911 Bacteria 1020
180 Ga0207707_10032900 3300025912 Bacteria 4538
181 Ga0207695_10390456 3300025913 Bacteria 1277
182 Ga0207693_10319061 3300025915 Bacteria 1216
183 Ga0207660_10002945 3300025917 Bacteria 11128
184 Ga0207660_10257423 3300025917 Bacteria 1379
185 Ga0207657_10001033 3300025919 Bacteria 29450
186 Ga0207657_10003076 3300025919 Bacteria 17847
187 Ga0207657_10003256 3300025919 Bacteria 17382
188 Ga0207657_10073310 3300025919 Bacteria 2894
189 Ga0207657_10574735 3300025919 Bacteria 880
190 Ga0207649_10000637 3300025920 Bacteria 23398
191 Ga0207649_10013479 3300025920 Bacteria 4564
192 Ga0207649_10017514 3300025920 Bacteria 4061
193 Ga0207649_10269344 3300025920 Bacteria 1234
194 Ga0207649_10615262 3300025920 Bacteria 836
195 Ga0207652_10005462 3300025921 Bacteria 10315
196 Ga0207652_10994964 3300025921 Bacteria 737
197 Ga0207681_10019078 3300025923 Bacteria 4330
198 Ga0207681_10103415 3300025923 Bacteria 2058
199 Ga0207681_10244536 3300025923 Bacteria 1398
200 Ga0207694_10153919 3300025924 Bacteria 1853
201 Ga0207694_10925402 3300025924 Bacteria 737
202 Ga0207650_10149568 3300025925 Bacteria 1842
203 Ga0207700_10526106 3300025928 Bacteria 1048
204 Ga0207664_10031244 3300025929 Bacteria 4073
205 Ga0207664_10460947 3300025929 Bacteria 1135
206 Ga0207644_10009851 3300025931 Bacteria 6286
207 Ga0207644_10671623 3300025931 Bacteria 863
208 Ga0207690_10015267 3300025932 Bacteria 4650
209 Ga0207706_10019691 3300025933 Bacteria 6071
210 Ga0207706_10114958 3300025933 Bacteria 2366
211 Ga0207669_10031509 3300025937 Bacteria 2964
212 Ga0207669_10056154 3300025937 Bacteria 2389
213 Ga0207669_10165032 3300025937 Bacteria 1569
214 Ga0207704_10016891 3300025938 Bacteria 3766
215 Ga0207704_10192829 3300025938 Bacteria 1484
216 Ga0207691_10186959 3300025940 Bacteria 1808
217 Ga0207711_10001129 3300025941 Bacteria 25496
218 Ga0207711_10040953 3300025941 Bacteria 3942
219 Ga0207689_10225065 3300025942 Bacteria 1550
220 Ga0207661_10096753 3300025944 Bacteria 2470
221 Ga0207679_10059162 3300025945 Bacteria 2842
222 Ga0207679_10517599 3300025945 Bacteria 1067
223 Ga0207667_10004903 3300025949 Bacteria 16345
224 Ga0207667_10130525 3300025949 Bacteria 2588
225 Ga0207667_10147792 3300025949 Bacteria 2419
226 Ga0207667_10156543 3300025949 Bacteria 2344
227 Ga0207667_11782731 3300025949 Bacteria 580
228 Ga0207651_10043603 3300025960 Bacteria 2995
229 Ga0207651_10074837 3300025960 Bacteria 2413
230 Ga0207651_10097163 3300025960 Bacteria 2174
231 Ga0207668_10001971 3300025972 Bacteria 12010
232 Ga0207668_10155679 3300025972 Bacteria 1775
233 Ga0207640_10084425 3300025981 Bacteria 2180
234 Ga0207640_10505664 3300025981 Bacteria 1007
235 Ga0207658_10001726 3300025986 Bacteria 16505
236 Ga0207658_10009316 3300025986 Bacteria 6658
237 Ga0207658_10830072 3300025986 Bacteria 840
238 Ga0207677_10001650 3300026023 Bacteria 11816
239 Ga0207677_10128235 3300026023 Bacteria 1921
240 Ga0207677_10514343 3300026023 Bacteria 1037
241 Ga0207703_10005317 3300026035 Bacteria 10376
242 Ga0207639_10000669 3300026041 Bacteria 23668
243 Ga0207639_10226369 3300026041 Bacteria 1618
244 Ga0207639_10613772 3300026041 Bacteria 1004
245 Ga0207639_10663011 3300026041 Bacteria 966
246 Ga0207678_10010795 3300026067 Bacteria 8024
247 Ga0207678_10025197 3300026067 Bacteria 5192
248 Ga0207678_10025448 3300026067 Bacteria 5165
249 Ga0207678_10059230 3300026067 Bacteria 3295
250 Ga0207702_10007451 3300026078 Bacteria 9337
251 Ga0207702_10031548 3300026078 Bacteria 4416
252 Ga0207702_10136118 3300026078 Bacteria 2216
253 Ga0207702_10191232 3300026078 Bacteria 1891
254 Ga0207702_10196754 3300026078 Bacteria 1866
255 Ga0207702_10334452 3300026078 Bacteria 1445
256 Ga0207702_10478693 3300026078 Bacteria 1211
257 Ga0207702_10636462 3300026078 Bacteria 1048
258 Ga0207702_11360950 3300026078 Bacteria 704
259 Ga0207641_11138088 3300026088 Bacteria 779
260 Ga0207648_10042723 3300026089 Bacteria 3980
261 Ga0207648_10660393 3300026089 Unclassified 967
262 Ga0207674_10005540 3300026116 Bacteria 14989
263 Ga0207674_10017726 3300026116 Bacteria 7760
264 Ga0207674_10079659 3300026116 Bacteria 3279
265 Ga0207674_10481541 3300026116 Bacteria 1199
266 Ga0207683_10357531 3300026121 Bacteria 1341
267 Ga0207698_10001543 3300026142 Bacteria 13422
268 Ga0207698_10025634 3300026142 Bacteria 4157
269 Ga0207698_10028228 3300026142 Bacteria 3999
270 Ga0207698_10053934 3300026142 Bacteria 3090
271 Ga0207698_10088293 3300026142 Bacteria 2528
272 Ga0207698_10389774 3300026142 Bacteria 1328
273 Ga0207698_10463126 3300026142 Bacteria 1226
274 Ga0268266_10014081 3300028379 Bacteria 6885
275 Ga0268265_10003714 3300028380 Bacteria 10858
276 Ga0268264_10002703 3300028381 Bacteria 15474
277 Ga0268264_10064018 3300028381 Bacteria 3094
278 Ga0373928_0028409 3300035084 Bacteria 1224
279 Ga0373929_0043441 3300035085 Bacteria 1006
280 Ga0373932_0010470 3300035112 Bacteria 2245
281 Ga0373954_0306984 3300035118 Bacteria 783
282 Ga0373956_0251310 3300035119 Bacteria 840
283 Ga0373960_0049230 3300035121 Bacteria 1246
284 Ga0373943_0102196 3300035170 Bacteria 1501
285 Ga0373946_0109070 3300035171 Bacteria 1251
286 Ga0373955_0075232 3300035172 Bacteria 1897
287 Ga0373931_0003388 3300035691 Bacteria 7153
288 Ga0373935_0488909 3300035692 Bacteria 892
289 Ga0373937_0014586 3300036401 Bacteria 6941
290 Ga0395899_0005998 3300037312 Bacteria 9438
291 Ga0395899_0006996 3300037312 Bacteria 8736
292 Ga0395899_0022556 3300037312 Bacteria 4770
293 Ga0395899_0107454 3300037312 Bacteria 2008
294 Ga0395899_0121059 3300037312 Unclassified 1874
295 Ga0395899_0537023 3300037312 Bacteria 753
296 Ga0395899_0619064 3300037312 Bacteria 687
297 Ga0395899_0958554 3300037312 Bacteria 518
298 Ga0395900_0002824 3300037418 Bacteria 18957
299 Ga0395900_0004328 3300037418 Bacteria 15058
300 Ga0395900_0055081 3300037418 Bacteria 4094
301 Ga0395900_0098649 3300037418 Bacteria 3001
302 Ga0395900_0156474 3300037418 Bacteria 2327
303 Ga0395900_0186039 3300037418 Bacteria 2108
304 Ga0395900_0241566 3300037418 Bacteria 1811
305 Ga0395900_0303934 3300037418 Bacteria 1580
306 Ga0395900_0544332 3300037418 Bacteria 1106
307 Ga0395900_0672457 3300037418 Bacteria 970
308 Ga0395900_0678158 3300037418 Bacteria 965
309 Ga0395900_0780679 3300037418 Bacteria 884
310 Ga0395900_0892830 3300037418 Bacteria 812
311 Ga0395900_1149916 3300037418 Bacteria 692
312 Ga0395898_0043104 3300037466 Bacteria 4447
313 Ga0395898_0060351 3300037466 Bacteria 3686
314 Ga0395898_0078590 3300037466 Bacteria 3183
315 Ga0395898_0078988 3300037466 Bacteria 3174
316 Ga0395898_0094647 3300037466 Bacteria 2871
317 Ga0395898_0126964 3300037466 Bacteria 2443
318 Ga0395898_0170196 3300037466 Bacteria 2082
319 Ga0395898_0221980 3300037466 Bacteria 1802
320 Ga0395898_0294497 3300037466 Bacteria 1548
321 Ga0395898_0477432 3300037466 Bacteria 1186
322 Ga0395898_0721409 3300037466 Bacteria 938
323 Ga0395898_0982436 3300037466 Bacteria 780
324 Ga0395898_1084575 3300037466 Bacteria 734
325 Ga0395898_1207000 3300037466 Bacteria 687
326 Ga0395905_0001380 3300037471 Bacteria 29411
327 Ga0395905_0003068 3300037471 Bacteria 18077
328 Ga0395905_0003989 3300037471 Bacteria 15517
329 Ga0395905_0005068 3300037471 Bacteria 13555
330 Ga0395905_0070685 3300037471 Bacteria 3271
331 Ga0395905_0302769 3300037471 Bacteria 1486
332 Ga0395905_0337926 3300037471 Bacteria 1397
333 Ga0395905_0511412 3300037471 Bacteria 1101
334 Ga0395901_0028526 3300038443 Bacteria 5740
335 Ga0395901_0043549 3300038443 Bacteria 4656
336 Ga0395901_0049381 3300038443 Bacteria 4371
337 Ga0395901_0061165 3300038443 Bacteria 3918
338 Ga0395901_0075024 3300038443 Bacteria 3528
339 Ga0395901_0106797 3300038443 Bacteria 2938
340 Ga0395901_0123347 3300038443 Bacteria 2722
341 Ga0395901_0186157 3300038443 Bacteria 2178
342 Ga0395901_0479555 3300038443 Unclassified 1269
343 Ga0395901_0831062 3300038443 Bacteria 910
344 Ga0395901_1018972 3300038443 Bacteria 803
345 Ga0395901_1182564 3300038443 Bacteria 731
346 Ga0395901_1494657 3300038443 Unclassified 631
347 Ga0466969_0011814 3300044656 Bacteria 4618
348 Ga0466966_0012917 3300044684 Bacteria 5530
349 Ga0466966_0488407 3300044684 Unclassified 740
350 Ga0466961_0454665 3300044693 Bacteria 775
351 Ga0466963_0033867 3300044694 Bacteria 3320
352 Ga0466963_0052409 3300044694 Bacteria 2707
353 Ga0466963_0478656 3300044694 Bacteria 879
354 Ga0466964_0297138 3300044706 Bacteria 813
355 Ga0466964_0312411 3300044706 Bacteria 796
356 Ga0466971_0003765 3300044719 Bacteria 6493
357 Ga0466970_0014649 3300044765 Bacteria 4027
358 Ga0466957_0010769 3300044842 Bacteria 5258
359 Ga0466957_0095741 3300044842 Bacteria 1865
360 Ga0466957_0116315 3300044842 Bacteria 1701
361 Ga0466957_0188346 3300044842 Bacteria 1351
362 Ga0466957_0383134 3300044842 Bacteria 959
363 Ga0466957_0638805 3300044842 Bacteria 748
364 Ga0466957_0739463 3300044842 Unclassified 696
365 Ga0466959_0104813 3300045049 Bacteria 2022
366 Ga0466958_0000609 3300045836 Bacteria 15283
367 Ga0466958_0028223 3300045836 Bacteria 3326
368 Ga0466958_0105001 3300045836 Bacteria 1760
369 Ga0466958_0115666 3300045836 Bacteria 1676
370 Ga0466958_0121711 3300045836 Bacteria 1634
371 Ga0466958_0390329 3300045836 Bacteria 898
372 Ga0466967_0010893 3300045976 Bacteria 6851
373 Ga0466967_0012647 3300045976 Bacteria 6472
374 Ga0466967_0169428 3300045976 Bacteria 2054
375 Ga0466967_0231753 3300045976 Bacteria 1758
376 Ga0466967_0424372 3300045976 Bacteria 1296
377 Ga0466967_0765835 3300045976 Bacteria 958
378 Ga0466967_0790801 3300045976 Bacteria 942
379 Ga0466967_1368106 3300045976 Bacteria 705
380 Ga0466967_1751968 3300045976 Bacteria 618
381 Ga0495621_0001932 3300046539 Bacteria 5452
382 Ga0495633_0065617 3300046558 Bacteria 1696
383 Ga0495669_0010391 3300046684 Bacteria 3933
384 Ga0495670_0007679 3300046691 Bacteria 5301
385 Ga0496107_0197689 3300048910 Bacteria 1494
386 Ga0496107_0910560 3300048910 Bacteria 641
387 Ga0496111_0887709 3300048914 Bacteria 642
388 Ga0496114_0000381 3300048917 Bacteria 32736
389 Ga0501069_0164363 3300049585 Bacteria 1279
390 Ga0466962_0005083 3300061719 Bacteria 6327
391 Ga0466962_0240635 3300061719 Bacteria 888
392 Ga0466962_0670273 3300061719 Bacteria 531

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005344 Ga0070661_100204040 Ga0070661_1002040402 142
2 3300005356 Ga0070674_100063683 Ga0070674_1000636834 142
3 3300005457 Ga0070662_100001441 Ga0070662_10000144117 142
4 3300005618 Ga0068864_100012913 Ga0068864_1000129136 142
5 3300005718 Ga0068866_10015235 Ga0068866_100152353 142
6 3300005841 Ga0068863_100031536 Ga0068863_1000315363 142
7 3300005843 Ga0068860_100191901 Ga0068860_1001919013 142
8 3300006237 Ga0097621_100044034 Ga0097621_1000440342 142
9 3300006358 Ga0068871_100332358 Ga0068871_1003323582 142
10 3300009176 Ga0105242_10066310 Ga0105242_100663102 142
11 3300013297 Ga0157378_10177916 Ga0157378_101779162 142
12 3300013308 Ga0157375_10308145 Ga0157375_103081452 142
13 3300014968 Ga0157379_10225296 Ga0157379_102252962 142
14 3300001979 JGI24740J21852_10087257 JGI24740J21852_100872572 144
15 3300005336 Ga0070680_101256874 Ga0070680_1012568741 144
16 3300005436 Ga0070713_100040618 Ga0070713_1000406182 144
17 3300005455 Ga0070663_100035172 Ga0070663_1000351723 144
18 3300005535 Ga0070684_100013787 Ga0070684_1000137875 144
19 3300005539 Ga0068853_100036691 Ga0068853_1000366911 144
20 3300005564 Ga0070664_100097566 Ga0070664_1000975662 144
21 3300005577 Ga0068857_100032087 Ga0068857_1000320872 144
22 3300005578 Ga0068854_100087281 Ga0068854_1000872814 144
23 3300005578 Ga0068854_100164046 Ga0068854_1001640461 144
24 3300005834 Ga0068851_10131736 Ga0068851_101317362 144
25 3300006028 Ga0070717_10006409 Ga0070717_100064095 144
26 3300006175 Ga0070712_100799434 Ga0070712_1007994342 144
27 3300013100 Ga0157373_10063396 Ga0157373_100633964 144
28 3300025893 Ga0207682_10011290 Ga0207682_100112904 144
29 3300025904 Ga0207647_10061465 Ga0207647_100614653 144
30 3300025908 Ga0207643_10302477 Ga0207643_103024771 144
31 3300025909 Ga0207705_10011741 Ga0207705_100117412 144
32 3300025909 Ga0207705_10443812 Ga0207705_104438122 144
33 3300025911 Ga0207654_10348058 Ga0207654_103480581 144
34 3300025919 Ga0207657_10003076 Ga0207657_1000307611 144
35 3300025923 Ga0207681_10244536 Ga0207681_102445362 144
36 3300025933 Ga0207706_10114958 Ga0207706_101149582 144
37 3300025944 Ga0207661_10096753 Ga0207661_100967531 144
38 3300025981 Ga0207640_10505664 Ga0207640_105056642 144
39 3300026041 Ga0207639_10226369 Ga0207639_102263692 144
40 3300026067 Ga0207678_10059230 Ga0207678_100592302 144
41 3300026078 Ga0207702_10031548 Ga0207702_100315484 144
42 3300026116 Ga0207674_10017726 Ga0207674_100177266 144
43 3300026142 Ga0207698_10053934 Ga0207698_100539344 144
44 3300026142 Ga0207698_10389774 Ga0207698_103897742 144
45 3300005985 Ga0081539_10010498 Ga0081539_100104984 145
46 3300045976 Ga0466967_0010893 Ga0466967_0010893_1104_1544 145
47 3300046539 Ga0495621_0001932 Ga0495621_0001932_1150_1629 145
48 3300046558 Ga0495633_0065617 Ga0495633_0065617_356_835 145
49 3300046684 Ga0495669_0010391 Ga0495669_0010391_2711_3190 145
50 3300046691 Ga0495670_0007679 Ga0495670_0007679_3962_4441 145
51 3300005435 Ga0070714_100062689 Ga0070714_1000626893 146
52 3300005436 Ga0070713_100414860 Ga0070713_1004148601 146
53 3300005563 Ga0068855_100157695 Ga0068855_1001576953 146
54 3300025906 Ga0207699_10048535 Ga0207699_100485353 146
55 3300025928 Ga0207700_10526106 Ga0207700_105261062 146
56 3300025949 Ga0207667_10147792 Ga0207667_101477923 146
57 3300035170 Ga0373943_0102196 Ga0373943_0102196_874_1353 146
58 3300035171 Ga0373946_0109070 Ga0373946_0109070_693_1172 146
59 3300035692 Ga0373935_0488909 Ga0373935_0488909_35_514 146
60 3300037418 Ga0395900_0892830 Ga0395900_0892830_125_604 146
61 3300001979 JGI24740J21852_10024938 JGI24740J21852_100249382 147
62 3300005336 Ga0070680_100007665 Ga0070680_1000076652 147
63 3300005338 Ga0068868_100001541 Ga0068868_10000154111 147
64 3300005339 Ga0070660_100003749 Ga0070660_1000037498 147
65 3300005355 Ga0070671_100009051 Ga0070671_1000090518 147
66 3300005356 Ga0070674_100268104 Ga0070674_1002681042 147
67 3300005364 Ga0070673_100077241 Ga0070673_1000772414 147
68 3300005367 Ga0070667_100003268 Ga0070667_10000326814 147
69 3300005455 Ga0070663_100040431 Ga0070663_1000404311 147
70 3300005459 Ga0068867_100108089 Ga0068867_1001080894 147
71 3300005530 Ga0070679_100066072 Ga0070679_1000660724 147
72 3300005616 Ga0068852_100321591 Ga0068852_1003215912 147
73 3300005617 Ga0068859_100089335 Ga0068859_1000893351 147
74 3300005842 Ga0068858_100008274 Ga0068858_1000082748 147
75 3300005843 Ga0068860_100114234 Ga0068860_1001142344 147
76 3300006237 Ga0097621_100827995 Ga0097621_1008279952 147
77 3300006931 Ga0097620_100089332 Ga0097620_1000893321 147
78 3300009148 Ga0105243_10679192 Ga0105243_106791922 147
79 3300009177 Ga0105248_10001470 Ga0105248_1000147014 147
80 3300010375 Ga0105239_10065787 Ga0105239_100657875 147
81 3300013297 Ga0157378_11275193 Ga0157378_112751932 147
82 3300014968 Ga0157379_10157346 Ga0157379_101573462 147
83 3300025903 Ga0207680_10001155 Ga0207680_100011555 147
84 3300025904 Ga0207647_10001359 Ga0207647_1000135910 147
85 3300025915 Ga0207693_10319061 Ga0207693_103190612 147
86 3300025931 Ga0207644_10009851 Ga0207644_100098516 147
87 3300025937 Ga0207669_10165032 Ga0207669_101650322 147
88 3300025941 Ga0207711_10001129 Ga0207711_1000112914 147
89 3300025960 Ga0207651_10043603 Ga0207651_100436034 147
90 3300025986 Ga0207658_10001726 Ga0207658_1000172615 147
91 3300026023 Ga0207677_10001650 Ga0207677_100016506 147
92 3300026035 Ga0207703_10005317 Ga0207703_100053176 147
93 3300026089 Ga0207648_10660393 Ga0207648_106603932 147
94 3300026142 Ga0207698_10028228 Ga0207698_100282282 147
95 3300028381 Ga0268264_10064018 Ga0268264_100640184 147
96 3300044684 Ga0466966_0488407 Ga0466966_0488407_68_517 147
97 3300045836 Ga0466958_0105001 Ga0466958_0105001_180_629 147
98 3300045836 Ga0466958_0115666 Ga0466958_0115666_216_665 147
99 3300045836 Ga0466958_0390329 Ga0466958_0390329_170_619 147
100 3300005539 Ga0068853_100048822 Ga0068853_1000488224 148
101 3300009551 Ga0105238_11134897 Ga0105238_111348972 148
102 3300013105 Ga0157369_10621933 Ga0157369_106219332 148
103 3300013307 Ga0157372_11267597 Ga0157372_112675972 148
104 3300037312 Ga0395899_0958554 Ga0395899_0958554_50_499 148
105 3300037418 Ga0395900_1149916 Ga0395900_1149916_34_483 148
106 3300037466 Ga0395898_0170196 Ga0395898_0170196_304_753 148
107 3300037466 Ga0395898_0982436 Ga0395898_0982436_16_465 148
108 3300038443 Ga0395901_0831062 Ga0395901_0831062_305_754 148
109 3300038443 Ga0395901_1182564 Ga0395901_1182564_198_647 148
110 3300048914 Ga0496111_0887709 Ga0496111_0887709_35_484 148
111 3300048917 Ga0496114_0000381 Ga0496114_0000381_12346_12795 148
112 3300005337 Ga0070682_100240394 Ga0070682_1002403942 149
113 3300005356 Ga0070674_100304323 Ga0070674_1003043232 149
114 3300025904 Ga0207647_10579872 Ga0207647_105798722 149
115 3300025937 Ga0207669_10031509 Ga0207669_100315092 149
116 3300037312 Ga0395899_0022556 Ga0395899_0022556_3924_4376 149
117 3300037312 Ga0395899_0537023 Ga0395899_0537023_63_515 149
118 3300037312 Ga0395899_0619064 Ga0395899_0619064_173_625 149
119 3300037418 Ga0395900_0002824 Ga0395900_0002824_8348_8800 149
120 3300037466 Ga0395898_0078988 Ga0395898_0078988_2328_2780 149
121 3300037466 Ga0395898_0221980 Ga0395898_0221980_1141_1593 149
122 3300037466 Ga0395898_1084575 Ga0395898_1084575_63_515 149
123 3300037466 Ga0395898_1207000 Ga0395898_1207000_173_625 149
124 3300037471 Ga0395905_0003068 Ga0395905_0003068_13966_14418 149
125 3300037471 Ga0395905_0511412 Ga0395905_0511412_493_945 149
126 3300038443 Ga0395901_0123347 Ga0395901_0123347_73_525 149
127 3300038443 Ga0395901_0479555 Ga0395901_0479555_17_469 149
128 3300045976 Ga0466967_0012647 Ga0466967_0012647_14_466 149
129 3300045976 Ga0466967_1751968 Ga0466967_1751968_14_466 149
130 3300005327 Ga0070658_10000653 Ga0070658_1000065316 150
131 3300005337 Ga0070682_100097440 Ga0070682_1000974402 150
132 3300035084 Ga0373928_0028409 Ga0373928_0028409_395_850 150
133 3300035085 Ga0373929_0043441 Ga0373929_0043441_197_652 150
134 3300035112 Ga0373932_0010470 Ga0373932_0010470_180_635 150
135 3300035121 Ga0373960_0049230 Ga0373960_0049230_500_955 150
136 3300035691 Ga0373931_0003388 Ga0373931_0003388_4526_4981 150
137 3300044842 Ga0466957_0383134 Ga0466957_0383134_437_901 150
138 3300045976 Ga0466967_0790801 Ga0466967_0790801_352_807 150
139 3300045976 Ga0466967_1368106 Ga0466967_1368106_20_475 150
140 3300048910 Ga0496107_0910560 Ga0496107_0910560_50_505 150
141 3300009093 Ga0105240_10592920 Ga0105240_105929202 153
142 3300013105 Ga0157369_10188621 Ga0157369_101886212 153
143 3300044694 Ga0466963_0033867 Ga0466963_0033867_716_1192 153
144 3300045836 Ga0466958_0028223 Ga0466958_0028223_878_1354 153
145 3300045976 Ga0466967_0424372 Ga0466967_0424372_233_709 153
146 3300045976 Ga0466967_0765835 Ga0466967_0765835_250_783 153
147 3300061719 Ga0466962_0240635 Ga0466962_0240635_116_592 153
148 3300005366 Ga0070659_100020150 Ga0070659_1000201503 154
149 3300005577 Ga0068857_100340378 Ga0068857_1003403782 154
150 3300005614 Ga0068856_100254575 Ga0068856_1002545752 154
151 3300025932 Ga0207690_10015267 Ga0207690_100152673 154
152 3300026078 Ga0207702_10334452 Ga0207702_103344523 154
153 3300026116 Ga0207674_10481541 Ga0207674_104815412 154
154 3300037418 Ga0395900_0678158 Ga0395900_0678158_332_811 154
155 3300005334 Ga0068869_100464117 Ga0068869_1004641172 156
156 3300005338 Ga0068868_100262471 Ga0068868_1002624712 156
157 3300005354 Ga0070675_101212725 Ga0070675_1012127251 156
158 3300005364 Ga0070673_100013491 Ga0070673_1000134912 156
159 3300005367 Ga0070667_100020258 Ga0070667_1000202582 156
160 3300005548 Ga0070665_100223883 Ga0070665_1002238832 156
161 3300005840 Ga0068870_10092898 Ga0068870_100928982 156
162 3300005841 Ga0068863_101166126 Ga0068863_1011661261 156
163 3300005843 Ga0068860_100005315 Ga0068860_1000053158 156
164 3300005844 Ga0068862_100008095 Ga0068862_1000080957 156
165 3300006237 Ga0097621_100006933 Ga0097621_1000069335 156
166 3300006358 Ga0068871_100024044 Ga0068871_1000240442 156
167 3300009177 Ga0105248_10465069 Ga0105248_104650692 156
168 3300009553 Ga0105249_10548984 Ga0105249_105489842 156
169 3300013306 Ga0163162_10385889 Ga0163162_103858892 156
170 3300013308 Ga0157375_10087702 Ga0157375_100877022 156
171 3300025315 Ga0207697_10039732 Ga0207697_100397322 156
172 3300025901 Ga0207688_10115387 Ga0207688_101153872 156
173 3300025907 Ga0207645_10046374 Ga0207645_100463742 156
174 3300025908 Ga0207643_10064382 Ga0207643_100643822 156
175 3300025923 Ga0207681_10019078 Ga0207681_100190782 156
176 3300025923 Ga0207681_10103415 Ga0207681_101034152 156
177 3300025925 Ga0207650_10149568 Ga0207650_101495681 156
178 3300025931 Ga0207644_10671623 Ga0207644_106716231 156
179 3300025937 Ga0207669_10056154 Ga0207669_100561542 156
180 3300025938 Ga0207704_10016891 Ga0207704_100168912 156
181 3300025938 Ga0207704_10192829 Ga0207704_101928292 156
182 3300025940 Ga0207691_10186959 Ga0207691_101869592 156
183 3300025941 Ga0207711_10040953 Ga0207711_100409532 156
184 3300025942 Ga0207689_10225065 Ga0207689_102250651 156
185 3300025960 Ga0207651_10074837 Ga0207651_100748372 156
186 3300025960 Ga0207651_10097163 Ga0207651_100971631 156
187 3300025972 Ga0207668_10001971 Ga0207668_100019712 156
188 3300025972 Ga0207668_10155679 Ga0207668_101556792 156
189 3300025986 Ga0207658_10009316 Ga0207658_100093163 156
190 3300026023 Ga0207677_10128235 Ga0207677_101282352 156
191 3300026088 Ga0207641_11138088 Ga0207641_111380882 156
192 3300026089 Ga0207648_10042723 Ga0207648_100427234 156
193 3300026121 Ga0207683_10357531 Ga0207683_103575312 156
194 3300028379 Ga0268266_10014081 Ga0268266_100140812 156
195 3300028380 Ga0268265_10003714 Ga0268265_100037144 156
196 3300028381 Ga0268264_10002703 Ga0268264_100027038 156
197 3300005535 Ga0070684_100744523 Ga0070684_1007445232 157
198 3300005616 Ga0068852_100642100 Ga0068852_1006421002 157
199 3300025909 Ga0207705_10960832 Ga0207705_109608321 157
200 3300025920 Ga0207649_10269344 Ga0207649_102693442 157
201 3300025949 Ga0207667_10156543 Ga0207667_101565432 157
202 3300026023 Ga0207677_10514343 Ga0207677_105143432 157
203 3300005335 Ga0070666_10048290 Ga0070666_100482902 158
204 3300005364 Ga0070673_100100108 Ga0070673_1001001082 158
205 3300005436 Ga0070713_100254909 Ga0070713_1002549092 158
206 3300005614 Ga0068856_100014649 Ga0068856_1000146492 158
207 3300005614 Ga0068856_100021369 Ga0068856_1000213697 158
208 3300005614 Ga0068856_100126288 Ga0068856_1001262882 158
209 3300005616 Ga0068852_100004075 Ga0068852_10000407512 158
210 3300006175 Ga0070712_100219938 Ga0070712_1002199382 158
211 3300009093 Ga0105240_11549264 Ga0105240_115492642 158
212 3300009545 Ga0105237_10662541 Ga0105237_106625412 158
213 3300013100 Ga0157373_10728465 Ga0157373_107284651 158
214 3300013102 Ga0157371_10006632 Ga0157371_100066327 158
215 3300013104 Ga0157370_10488485 Ga0157370_104884852 158
216 3300013105 Ga0157369_10000141 Ga0157369_1000014146 158
217 3300013105 Ga0157369_10004026 Ga0157369_100040269 158
218 3300013105 Ga0157369_10071147 Ga0157369_100711472 158
219 3300013105 Ga0157369_10082554 Ga0157369_100825542 158
220 3300013307 Ga0157372_10719107 Ga0157372_107191073 158
221 3300020610 Ga0154015_1380812 Ga0154015_13808122 158
222 3300025290 Ga0207673_1008752 Ga0207673_10087522 158
223 3300025903 Ga0207680_10226292 Ga0207680_102262922 158
224 3300025919 Ga0207657_10574735 Ga0207657_105747352 158
225 3300025920 Ga0207649_10017514 Ga0207649_100175144 158
226 3300025929 Ga0207664_10460947 Ga0207664_104609471 158
227 3300025949 Ga0207667_10004903 Ga0207667_1000490311 158
228 3300025986 Ga0207658_10830072 Ga0207658_108300722 158
229 3300026041 Ga0207639_10663011 Ga0207639_106630112 158
230 3300026067 Ga0207678_10010795 Ga0207678_100107952 158
231 3300026078 Ga0207702_10007451 Ga0207702_100074516 158
232 3300026078 Ga0207702_10136118 Ga0207702_101361182 158
233 3300026078 Ga0207702_10196754 Ga0207702_101967543 158
234 3300026142 Ga0207698_10001543 Ga0207698_1000154313 158
235 3300037312 Ga0395899_0005998 Ga0395899_0005998_7539_8018 158
236 3300037312 Ga0395899_0006996 Ga0395899_0006996_7008_7487 158
237 3300037418 Ga0395900_0098649 Ga0395900_0098649_12_491 158
238 3300037418 Ga0395900_0156474 Ga0395900_0156474_450_929 158
239 3300037418 Ga0395900_0303934 Ga0395900_0303934_229_708 158
240 3300037418 Ga0395900_0544332 Ga0395900_0544332_97_576 158
241 3300037466 Ga0395898_0043104 Ga0395898_0043104_729_1208 158
242 3300037466 Ga0395898_0477432 Ga0395898_0477432_92_571 158
243 3300037471 Ga0395905_0005068 Ga0395905_0005068_9348_9827 158
244 3300038443 Ga0395901_0043549 Ga0395901_0043549_3152_3631 158
245 3300038443 Ga0395901_0049381 Ga0395901_0049381_2472_2951 158
246 3300038443 Ga0395901_1494657 Ga0395901_1494657_71_550 158
247 3300044842 Ga0466957_0095741 Ga0466957_0095741_1292_1771 158
248 3300044842 Ga0466957_0739463 Ga0466957_0739463_206_685 158
249 3300045836 Ga0466958_0121711 Ga0466958_0121711_976_1455 158
250 3300045976 Ga0466967_0169428 Ga0466967_0169428_1018_1497 158
251 3300048910 Ga0496107_0197689 Ga0496107_0197689_480_959 158
252 3300002067 JGI24735J21928_10037000 JGI24735J21928_100370003 159
253 3300005327 Ga0070658_10046953 Ga0070658_100469533 159
254 3300005336 Ga0070680_100441909 Ga0070680_1004419092 159
255 3300005344 Ga0070661_101169630 Ga0070661_1011696302 159
256 3300005539 Ga0068853_100111141 Ga0068853_1001111412 159
257 3300005563 Ga0068855_100411006 Ga0068855_1004110062 159
258 3300005614 Ga0068856_100122424 Ga0068856_1001224244 159
259 3300005614 Ga0068856_101545823 Ga0068856_1015458232 159
260 3300005616 Ga0068852_100340024 Ga0068852_1003400243 159
261 3300010375 Ga0105239_10786062 Ga0105239_107860622 159
262 3300013102 Ga0157371_10054801 Ga0157371_100548012 159
263 3300013102 Ga0157371_10147955 Ga0157371_101479552 159
264 3300013105 Ga0157369_10551639 Ga0157369_105516392 159
265 3300013105 Ga0157369_10651512 Ga0157369_106515121 159
266 3300013307 Ga0157372_10161152 Ga0157372_101611524 159
267 3300020082 Ga0206353_10214899 Ga0206353_102148993 159
268 3300025904 Ga0207647_10064670 Ga0207647_100646702 159
269 3300025904 Ga0207647_10536703 Ga0207647_105367032 159
270 3300025909 Ga0207705_10654314 Ga0207705_106543141 159
271 3300025909 Ga0207705_10842348 Ga0207705_108423482 159
272 3300025917 Ga0207660_10257423 Ga0207660_102574233 159
273 3300025929 Ga0207664_10031244 Ga0207664_100312444 159
274 3300025945 Ga0207679_10517599 Ga0207679_105175992 159
275 3300025949 Ga0207667_11782731 Ga0207667_117827312 159
276 3300026041 Ga0207639_10000669 Ga0207639_100006693 159
277 3300026078 Ga0207702_10191232 Ga0207702_101912323 159
278 3300026078 Ga0207702_11360950 Ga0207702_113609502 159
279 3300026116 Ga0207674_10079659 Ga0207674_100796596 159
280 3300026142 Ga0207698_10025634 Ga0207698_100256345 159
281 3300035118 Ga0373954_0306984 Ga0373954_0306984_114_596 159
282 3300035119 Ga0373956_0251310 Ga0373956_0251310_112_594 159
283 3300035172 Ga0373955_0075232 Ga0373955_0075232_1348_1830 159
284 3300036401 Ga0373937_0014586 Ga0373937_0014586_4257_4739 159
285 3300037312 Ga0395899_0121059 Ga0395899_0121059_1370_1852 159
286 3300037418 Ga0395900_0004328 Ga0395900_0004328_134_616 159
287 3300037418 Ga0395900_0672457 Ga0395900_0672457_258_740 159
288 3300037418 Ga0395900_0780679 Ga0395900_0780679_297_779 159
289 3300037466 Ga0395898_0060351 Ga0395898_0060351_1894_2376 159
290 3300037466 Ga0395898_0078590 Ga0395898_0078590_987_1469 159
291 3300037466 Ga0395898_0721409 Ga0395898_0721409_199_681 159
292 3300037471 Ga0395905_0001380 Ga0395905_0001380_10460_10942 159
293 3300037471 Ga0395905_0070685 Ga0395905_0070685_598_1080 159
294 3300037471 Ga0395905_0337926 Ga0395905_0337926_786_1268 159
295 3300038443 Ga0395901_0061165 Ga0395901_0061165_1367_1849 159
296 3300038443 Ga0395901_1018972 Ga0395901_1018972_245_727 159
297 3300044656 Ga0466969_0011814 Ga0466969_0011814_1799_2281 159
298 3300044684 Ga0466966_0012917 Ga0466966_0012917_3815_4297 159
299 3300044693 Ga0466961_0454665 Ga0466961_0454665_237_719 159
300 3300044694 Ga0466963_0052409 Ga0466963_0052409_1698_2180 159
301 3300044694 Ga0466963_0478656 Ga0466963_0478656_146_628 159
302 3300044706 Ga0466964_0297138 Ga0466964_0297138_125_607 159
303 3300044706 Ga0466964_0312411 Ga0466964_0312411_140_622 159
304 3300044719 Ga0466971_0003765 Ga0466971_0003765_1434_1916 159
305 3300044765 Ga0466970_0014649 Ga0466970_0014649_1034_1516 159
306 3300044842 Ga0466957_0010769 Ga0466957_0010769_3831_4313 159
307 3300044842 Ga0466957_0116315 Ga0466957_0116315_490_972 159
308 3300044842 Ga0466957_0188346 Ga0466957_0188346_262_744 159
309 3300044842 Ga0466957_0638805 Ga0466957_0638805_184_666 159
310 3300045049 Ga0466959_0104813 Ga0466959_0104813_308_790 159
311 3300045836 Ga0466958_0000609 Ga0466958_0000609_12427_12909 159
312 3300045976 Ga0466967_0231753 Ga0466967_0231753_1229_1711 159
313 3300061719 Ga0466962_0005083 Ga0466962_0005083_2557_3039 159
314 3300061719 Ga0466962_0670273 Ga0466962_0670273_28_513 159
315 3300005344 Ga0070661_100524988 Ga0070661_1005249881 160
316 3300005614 Ga0068856_101118063 Ga0068856_1011180632 160
317 3300025920 Ga0207649_10615262 Ga0207649_106152622 160
318 3300038443 Ga0395901_0186157 Ga0395901_0186157_1339_1830 160
319 3300049585 Ga0501069_0164363 Ga0501069_0164363_144_674 162
320 3300001915 JGI24741J21665_1040731 JGI24741J21665_10407311 163
321 3300001979 JGI24740J21852_10030004 JGI24740J21852_100300042 163
322 3300005339 Ga0070660_100012089 Ga0070660_1000120893 163
323 3300005344 Ga0070661_100031573 Ga0070661_1000315733 163
324 3300005455 Ga0070663_100063745 Ga0070663_1000637452 163
325 3300005578 Ga0068854_100046561 Ga0068854_1000465612 163
326 3300005616 Ga0068852_100851216 Ga0068852_1008512161 163
327 3300009093 Ga0105240_10653777 Ga0105240_106537772 163
328 3300009174 Ga0105241_10260769 Ga0105241_102607692 163
329 3300013100 Ga0157373_10134914 Ga0157373_101349142 163
330 3300013104 Ga0157370_10372425 Ga0157370_103724252 163
331 3300025904 Ga0207647_10099823 Ga0207647_100998233 163
332 3300025909 Ga0207705_10000003 Ga0207705_10000003719 163
333 3300025909 Ga0207705_10000979 Ga0207705_1000097916 163
334 3300025913 Ga0207695_10390456 Ga0207695_103904562 163
335 3300025919 Ga0207657_10003256 Ga0207657_100032564 163
336 3300025920 Ga0207649_10000637 Ga0207649_100006376 163
337 3300025924 Ga0207694_10925402 Ga0207694_109254021 163
338 3300025981 Ga0207640_10084425 Ga0207640_100844251 163
339 3300026041 Ga0207639_10613772 Ga0207639_106137721 163
340 3300026067 Ga0207678_10025448 Ga0207678_100254484 163
341 3300026078 Ga0207702_10478693 Ga0207702_104786932 163
342 3300026078 Ga0207702_10636462 Ga0207702_106364622 163
343 3300026142 Ga0207698_10463126 Ga0207698_104631262 163
344 3300037312 Ga0395899_0107454 Ga0395899_0107454_185_715 163
345 3300037418 Ga0395900_0241566 Ga0395900_0241566_973_1503 163
346 3300037466 Ga0395898_0126964 Ga0395898_0126964_887_1417 163
347 3300037471 Ga0395905_0302769 Ga0395905_0302769_852_1382 163
348 3300005336 Ga0070680_100004440 Ga0070680_1000044409 166
349 3300005458 Ga0070681_10115179 Ga0070681_101151794 166
350 3300005530 Ga0070679_100047356 Ga0070679_1000473564 166
351 3300013100 Ga0157373_10020213 Ga0157373_100202135 166
352 3300025909 Ga0207705_10044575 Ga0207705_100445754 166
353 3300025919 Ga0207657_10001033 Ga0207657_1000103337 166
354 3300025921 Ga0207652_10994964 Ga0207652_109949641 166
355 3300005366 Ga0070659_100113760 Ga0070659_1001137602 169
356 3300025924 Ga0207694_10153919 Ga0207694_101539192 169
357 3300026142 Ga0207698_10088293 Ga0207698_100882931 169
358 3300005344 Ga0070661_100337149 Ga0070661_1003371492 174
359 3300009551 Ga0105238_10198520 Ga0105238_101985202 174
360 3300037418 Ga0395900_0055081 Ga0395900_0055081_267_800 174
361 3300037418 Ga0395900_0186039 Ga0395900_0186039_1397_1930 174
362 3300037466 Ga0395898_0094647 Ga0395898_0094647_2282_2815 174
363 3300037466 Ga0395898_0294497 Ga0395898_0294497_325_858 174
364 3300037471 Ga0395905_0003989 Ga0395905_0003989_4088_4618 174
365 3300038443 Ga0395901_0028526 Ga0395901_0028526_852_1385 174
366 3300038443 Ga0395901_0075024 Ga0395901_0075024_2062_2592 174
367 3300038443 Ga0395901_0106797 Ga0395901_0106797_858_1391 174
368 3300001915 JGI24741J21665_1001147 JGI24741J21665_10011473 175
369 3300001979 JGI24740J21852_10025929 JGI24740J21852_100259292 175
370 3300002067 JGI24735J21928_10008416 JGI24735J21928_100084162 175
371 3300005336 Ga0070680_100720553 Ga0070680_1007205531 175
372 3300005337 Ga0070682_100020131 Ga0070682_1000201312 175
373 3300005344 Ga0070661_100021082 Ga0070661_1000210824 175
374 3300005345 Ga0070692_10487099 Ga0070692_104870992 175
375 3300005455 Ga0070663_100016621 Ga0070663_1000166214 175
376 3300005535 Ga0070684_100097370 Ga0070684_1000973701 175
377 3300005563 Ga0068855_100044199 Ga0068855_1000441994 175
378 3300005564 Ga0070664_100067429 Ga0070664_1000674291 175
379 3300005578 Ga0068854_100015325 Ga0068854_1000153254 175
380 3300013102 Ga0157371_10200421 Ga0157371_102004211 175
381 3300013307 Ga0157372_10042440 Ga0157372_100424405 175
382 3300025909 Ga0207705_10008706 Ga0207705_100087066 175
383 3300025912 Ga0207707_10032900 Ga0207707_100329003 175
384 3300025917 Ga0207660_10002945 Ga0207660_100029458 175
385 3300025919 Ga0207657_10073310 Ga0207657_100733102 175
386 3300025920 Ga0207649_10013479 Ga0207649_100134795 175
387 3300025921 Ga0207652_10005462 Ga0207652_100054627 175
388 3300025933 Ga0207706_10019691 Ga0207706_100196913 175
389 3300025945 Ga0207679_10059162 Ga0207679_100591623 175
390 3300025949 Ga0207667_10130525 Ga0207667_101305252 175
391 3300026067 Ga0207678_10025197 Ga0207678_100251975 175
392 3300026116 Ga0207674_10005540 Ga0207674_1000554012 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06347

SH3_4

Bacterial SH3 domain

117

172

0.93

PF06347

SH3_4

Bacterial SH3 domain

53

109

0.9

Feature Viewer

pLDDT pTM Quality
65.79 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map