F432233
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 392 | 157 | 392 | 158 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100004440|Ga0070680_1000044409 |
| Length | 180 |
| Sequence | VFNISVTPAKAGVPLTLEWLKKSGIPAFAGMTMFIASPALAQEKQPPYWASIASGQAMTHTGPGRNYPNVWLYQRRDLPVRVVKKYETWRLIQDPDGAQGWMLVTMLSDRRTAIVKPGEPRPIRADPSDDAKVRYEAEGGVVGRIDKCKGNGWCRIAIGKKEGYVRTSDLWGVGADEVVD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 70 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 122 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 123 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 125 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 126 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 127 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 128 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 129 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 130 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 131 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 132 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 134 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 135 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 136 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 137 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 138 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 139 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 140 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 141 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 142 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 143 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 144 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 145 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 146 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 147 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 148 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 149 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 154 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 155 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 156 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.49 |
| Metatranscriptomes | 0.51 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.02 |
| Rhizosphere | 98.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1001147 | 3300001915 | Bacteria | 7834 |
| 2 | JGI24741J21665_1040731 | 3300001915 | Bacteria | 685 |
| 3 | JGI24740J21852_10024938 | 3300001979 | Bacteria | 2022 |
| 4 | JGI24740J21852_10025929 | 3300001979 | Bacteria | 1969 |
| 5 | JGI24740J21852_10030004 | 3300001979 | Bacteria | 1777 |
| 6 | JGI24740J21852_10087257 | 3300001979 | Bacteria | 809 |
| 7 | JGI24735J21928_10008416 | 3300002067 | Bacteria | 3335 |
| 8 | JGI24735J21928_10037000 | 3300002067 | Bacteria | 1431 |
| 9 | Ga0070658_10000653 | 3300005327 | Bacteria | 29964 |
| 10 | Ga0070658_10046953 | 3300005327 | Bacteria | 3494 |
| 11 | Ga0068869_100464117 | 3300005334 | Bacteria | 1052 |
| 12 | Ga0070666_10048290 | 3300005335 | Bacteria | 2859 |
| 13 | Ga0070680_100004440 | 3300005336 | Bacteria | 10563 |
| 14 | Ga0070680_100007665 | 3300005336 | Bacteria | 8235 |
| 15 | Ga0070680_100441909 | 3300005336 | Bacteria | 1110 |
| 16 | Ga0070680_100720553 | 3300005336 | Bacteria | 858 |
| 17 | Ga0070680_101256874 | 3300005336 | Bacteria | 641 |
| 18 | Ga0070682_100020131 | 3300005337 | Bacteria | 3923 |
| 19 | Ga0070682_100097440 | 3300005337 | Bacteria | 1936 |
| 20 | Ga0070682_100240394 | 3300005337 | Bacteria | 1299 |
| 21 | Ga0068868_100001541 | 3300005338 | Bacteria | 15738 |
| 22 | Ga0068868_100262471 | 3300005338 | Bacteria | 1457 |
| 23 | Ga0070660_100003749 | 3300005339 | Bacteria | 10506 |
| 24 | Ga0070660_100012089 | 3300005339 | Bacteria | 6162 |
| 25 | Ga0070661_100021082 | 3300005344 | Bacteria | 4653 |
| 26 | Ga0070661_100031573 | 3300005344 | Bacteria | 3831 |
| 27 | Ga0070661_100204040 | 3300005344 | Bacteria | 1511 |
| 28 | Ga0070661_100337149 | 3300005344 | Bacteria | 1180 |
| 29 | Ga0070661_100524988 | 3300005344 | Unclassified | 950 |
| 30 | Ga0070661_101169630 | 3300005344 | Bacteria | 642 |
| 31 | Ga0070692_10487099 | 3300005345 | Bacteria | 796 |
| 32 | Ga0070675_101212725 | 3300005354 | Bacteria | 695 |
| 33 | Ga0070671_100009051 | 3300005355 | Bacteria | 7992 |
| 34 | Ga0070674_100063683 | 3300005356 | Bacteria | 2582 |
| 35 | Ga0070674_100268104 | 3300005356 | Bacteria | 1348 |
| 36 | Ga0070674_100304323 | 3300005356 | Bacteria | 1272 |
| 37 | Ga0070673_100013491 | 3300005364 | Bacteria | 5656 |
| 38 | Ga0070673_100077241 | 3300005364 | Bacteria | 2691 |
| 39 | Ga0070673_100100108 | 3300005364 | Bacteria | 2385 |
| 40 | Ga0070659_100020150 | 3300005366 | Bacteria | 5064 |
| 41 | Ga0070659_100113760 | 3300005366 | Bacteria | 2186 |
| 42 | Ga0070667_100003268 | 3300005367 | Bacteria | 13855 |
| 43 | Ga0070667_100020258 | 3300005367 | Bacteria | 5522 |
| 44 | Ga0070714_100062689 | 3300005435 | Bacteria | 3195 |
| 45 | Ga0070713_100040618 | 3300005436 | Bacteria | 3783 |
| 46 | Ga0070713_100254909 | 3300005436 | Bacteria | 1601 |
| 47 | Ga0070713_100414860 | 3300005436 | Bacteria | 1259 |
| 48 | Ga0070663_100016621 | 3300005455 | Bacteria | 4785 |
| 49 | Ga0070663_100035172 | 3300005455 | Bacteria | 3474 |
| 50 | Ga0070663_100040431 | 3300005455 | Bacteria | 3264 |
| 51 | Ga0070663_100063745 | 3300005455 | Bacteria | 2662 |
| 52 | Ga0070662_100001441 | 3300005457 | Bacteria | 14657 |
| 53 | Ga0070681_10115179 | 3300005458 | Bacteria | 2626 |
| 54 | Ga0068867_100108089 | 3300005459 | Bacteria | 2133 |
| 55 | Ga0070679_100047356 | 3300005530 | Bacteria | 4285 |
| 56 | Ga0070679_100066072 | 3300005530 | Bacteria | 3605 |
| 57 | Ga0070684_100013787 | 3300005535 | Bacteria | 6525 |
| 58 | Ga0070684_100097370 | 3300005535 | Bacteria | 2623 |
| 59 | Ga0070684_100744523 | 3300005535 | Bacteria | 915 |
| 60 | Ga0068853_100036691 | 3300005539 | Bacteria | 4169 |
| 61 | Ga0068853_100048822 | 3300005539 | Bacteria | 3636 |
| 62 | Ga0068853_100111141 | 3300005539 | Bacteria | 2434 |
| 63 | Ga0070665_100223883 | 3300005548 | Bacteria | 1882 |
| 64 | Ga0068855_100044199 | 3300005563 | Bacteria | 5273 |
| 65 | Ga0068855_100157695 | 3300005563 | Bacteria | 2578 |
| 66 | Ga0068855_100411006 | 3300005563 | Bacteria | 1481 |
| 67 | Ga0070664_100067429 | 3300005564 | Bacteria | 3058 |
| 68 | Ga0070664_100097566 | 3300005564 | Bacteria | 2551 |
| 69 | Ga0068857_100032087 | 3300005577 | Bacteria | 4643 |
| 70 | Ga0068857_100340378 | 3300005577 | Bacteria | 1388 |
| 71 | Ga0068854_100015325 | 3300005578 | Bacteria | 5075 |
| 72 | Ga0068854_100046561 | 3300005578 | Bacteria | 3088 |
| 73 | Ga0068854_100087281 | 3300005578 | Bacteria | 2314 |
| 74 | Ga0068854_100164046 | 3300005578 | Bacteria | 1723 |
| 75 | Ga0068856_100014649 | 3300005614 | Bacteria | 7573 |
| 76 | Ga0068856_100021369 | 3300005614 | Bacteria | 6291 |
| 77 | Ga0068856_100122424 | 3300005614 | Bacteria | 2603 |
| 78 | Ga0068856_100126288 | 3300005614 | Bacteria | 2561 |
| 79 | Ga0068856_100254575 | 3300005614 | Bacteria | 1771 |
| 80 | Ga0068856_101118063 | 3300005614 | Bacteria | 805 |
| 81 | Ga0068856_101545823 | 3300005614 | Bacteria | 677 |
| 82 | Ga0068852_100004075 | 3300005616 | Bacteria | 10281 |
| 83 | Ga0068852_100321591 | 3300005616 | Bacteria | 1503 |
| 84 | Ga0068852_100340024 | 3300005616 | Bacteria | 1462 |
| 85 | Ga0068852_100642100 | 3300005616 | Bacteria | 1068 |
| 86 | Ga0068852_100851216 | 3300005616 | Bacteria | 927 |
| 87 | Ga0068859_100089335 | 3300005617 | Bacteria | 3131 |
| 88 | Ga0068864_100012913 | 3300005618 | Bacteria | 6910 |
| 89 | Ga0068866_10015235 | 3300005718 | Bacteria | 3412 |
| 90 | Ga0068851_10131736 | 3300005834 | Bacteria | 1353 |
| 91 | Ga0068870_10092898 | 3300005840 | Bacteria | 1691 |
| 92 | Ga0068863_100031536 | 3300005841 | Bacteria | 5056 |
| 93 | Ga0068863_101166126 | 3300005841 | Bacteria | 776 |
| 94 | Ga0068858_100008274 | 3300005842 | Bacteria | 9999 |
| 95 | Ga0068860_100005315 | 3300005843 | Bacteria | 13069 |
| 96 | Ga0068860_100114234 | 3300005843 | Bacteria | 2582 |
| 97 | Ga0068860_100191901 | 3300005843 | Bacteria | 1977 |
| 98 | Ga0068862_100008095 | 3300005844 | Bacteria | 8699 |
| 99 | Ga0081539_10010498 | 3300005985 | Bacteria | 7512 |
| 100 | Ga0070717_10006409 | 3300006028 | Bacteria | 8653 |
| 101 | Ga0070712_100219938 | 3300006175 | Bacteria | 1503 |
| 102 | Ga0070712_100799434 | 3300006175 | Bacteria | 809 |
| 103 | Ga0097621_100006933 | 3300006237 | Bacteria | 8065 |
| 104 | Ga0097621_100044034 | 3300006237 | Bacteria | 3600 |
| 105 | Ga0097621_100827995 | 3300006237 | Unclassified | 859 |
| 106 | Ga0068871_100024044 | 3300006358 | Bacteria | 4721 |
| 107 | Ga0068871_100332358 | 3300006358 | Bacteria | 1340 |
| 108 | Ga0097620_100089332 | 3300006931 | Bacteria | 3131 |
| 109 | Ga0105240_10592920 | 3300009093 | Bacteria | 1221 |
| 110 | Ga0105240_10653777 | 3300009093 | Bacteria | 1152 |
| 111 | Ga0105240_11549264 | 3300009093 | Bacteria | 694 |
| 112 | Ga0105243_10679192 | 3300009148 | Unclassified | 1001 |
| 113 | Ga0105241_10260769 | 3300009174 | Bacteria | 1473 |
| 114 | Ga0105242_10066310 | 3300009176 | Bacteria | 2980 |
| 115 | Ga0105248_10001470 | 3300009177 | Bacteria | 26223 |
| 116 | Ga0105248_10465069 | 3300009177 | Bacteria | 1426 |
| 117 | Ga0105237_10662541 | 3300009545 | Bacteria | 1050 |
| 118 | Ga0105238_10198520 | 3300009551 | Bacteria | 1981 |
| 119 | Ga0105238_11134897 | 3300009551 | Bacteria | 805 |
| 120 | Ga0105249_10548984 | 3300009553 | Bacteria | 1206 |
| 121 | Ga0105239_10065787 | 3300010375 | Unclassified | 3982 |
| 122 | Ga0105239_10786062 | 3300010375 | Bacteria | 1090 |
| 123 | Ga0157373_10020213 | 3300013100 | Bacteria | 4843 |
| 124 | Ga0157373_10063396 | 3300013100 | Bacteria | 2617 |
| 125 | Ga0157373_10134914 | 3300013100 | Bacteria | 1736 |
| 126 | Ga0157373_10728465 | 3300013100 | Bacteria | 728 |
| 127 | Ga0157371_10006632 | 3300013102 | Bacteria | 9492 |
| 128 | Ga0157371_10054801 | 3300013102 | Bacteria | 2831 |
| 129 | Ga0157371_10147955 | 3300013102 | Bacteria | 1674 |
| 130 | Ga0157371_10200421 | 3300013102 | Bacteria | 1431 |
| 131 | Ga0157370_10372425 | 3300013104 | Bacteria | 1316 |
| 132 | Ga0157370_10488485 | 3300013104 | Bacteria | 1131 |
| 133 | Ga0157369_10000141 | 3300013105 | Bacteria | 102055 |
| 134 | Ga0157369_10004026 | 3300013105 | Bacteria | 17420 |
| 135 | Ga0157369_10071147 | 3300013105 | Bacteria | 3735 |
| 136 | Ga0157369_10082554 | 3300013105 | Bacteria | 3438 |
| 137 | Ga0157369_10188621 | 3300013105 | Bacteria | 2167 |
| 138 | Ga0157369_10551639 | 3300013105 | Bacteria | 1191 |
| 139 | Ga0157369_10621933 | 3300013105 | Bacteria | 1114 |
| 140 | Ga0157369_10651512 | 3300013105 | Bacteria | 1086 |
| 141 | Ga0157378_10177916 | 3300013297 | Bacteria | 1999 |
| 142 | Ga0157378_11275193 | 3300013297 | Unclassified | 775 |
| 143 | Ga0163162_10385889 | 3300013306 | Bacteria | 1534 |
| 144 | Ga0157372_10042440 | 3300013307 | Bacteria | 5031 |
| 145 | Ga0157372_10161152 | 3300013307 | Bacteria | 2593 |
| 146 | Ga0157372_10719107 | 3300013307 | Bacteria | 1162 |
| 147 | Ga0157372_11267597 | 3300013307 | Bacteria | 851 |
| 148 | Ga0157375_10087702 | 3300013308 | Bacteria | 3164 |
| 149 | Ga0157375_10308145 | 3300013308 | Bacteria | 1747 |
| 150 | Ga0157379_10157346 | 3300014968 | Bacteria | 2050 |
| 151 | Ga0157379_10225296 | 3300014968 | Bacteria | 1699 |
| 152 | Ga0206353_10214899 | 3300020082 | Bacteria | 1593 |
| 153 | Ga0154015_1380812 | 3300020610 | Bacteria | 838 |
| 154 | Ga0207673_1008752 | 3300025290 | Bacteria | 1286 |
| 155 | Ga0207697_10039732 | 3300025315 | Bacteria | 1931 |
| 156 | Ga0207682_10011290 | 3300025893 | Bacteria | 3490 |
| 157 | Ga0207688_10115387 | 3300025901 | Bacteria | 1563 |
| 158 | Ga0207680_10001155 | 3300025903 | Bacteria | 12443 |
| 159 | Ga0207680_10226292 | 3300025903 | Bacteria | 1284 |
| 160 | Ga0207647_10001359 | 3300025904 | Bacteria | 18789 |
| 161 | Ga0207647_10061465 | 3300025904 | Bacteria | 2292 |
| 162 | Ga0207647_10064670 | 3300025904 | Bacteria | 2222 |
| 163 | Ga0207647_10099823 | 3300025904 | Bacteria | 1724 |
| 164 | Ga0207647_10536703 | 3300025904 | Bacteria | 650 |
| 165 | Ga0207647_10579872 | 3300025904 | Bacteria | 620 |
| 166 | Ga0207699_10048535 | 3300025906 | Bacteria | 2494 |
| 167 | Ga0207645_10046374 | 3300025907 | Bacteria | 2776 |
| 168 | Ga0207643_10064382 | 3300025908 | Bacteria | 2098 |
| 169 | Ga0207643_10302477 | 3300025908 | Bacteria | 996 |
| 170 | Ga0207705_10000003 | 3300025909 | Bacteria | 709270 |
| 171 | Ga0207705_10000979 | 3300025909 | Bacteria | 23328 |
| 172 | Ga0207705_10008706 | 3300025909 | Bacteria | 7395 |
| 173 | Ga0207705_10011741 | 3300025909 | Bacteria | 6328 |
| 174 | Ga0207705_10044575 | 3300025909 | Bacteria | 3187 |
| 175 | Ga0207705_10443812 | 3300025909 | Bacteria | 1006 |
| 176 | Ga0207705_10654314 | 3300025909 | Bacteria | 817 |
| 177 | Ga0207705_10842348 | 3300025909 | Bacteria | 711 |
| 178 | Ga0207705_10960832 | 3300025909 | Bacteria | 661 |
| 179 | Ga0207654_10348058 | 3300025911 | Bacteria | 1020 |
| 180 | Ga0207707_10032900 | 3300025912 | Bacteria | 4538 |
| 181 | Ga0207695_10390456 | 3300025913 | Bacteria | 1277 |
| 182 | Ga0207693_10319061 | 3300025915 | Bacteria | 1216 |
| 183 | Ga0207660_10002945 | 3300025917 | Bacteria | 11128 |
| 184 | Ga0207660_10257423 | 3300025917 | Bacteria | 1379 |
| 185 | Ga0207657_10001033 | 3300025919 | Bacteria | 29450 |
| 186 | Ga0207657_10003076 | 3300025919 | Bacteria | 17847 |
| 187 | Ga0207657_10003256 | 3300025919 | Bacteria | 17382 |
| 188 | Ga0207657_10073310 | 3300025919 | Bacteria | 2894 |
| 189 | Ga0207657_10574735 | 3300025919 | Bacteria | 880 |
| 190 | Ga0207649_10000637 | 3300025920 | Bacteria | 23398 |
| 191 | Ga0207649_10013479 | 3300025920 | Bacteria | 4564 |
| 192 | Ga0207649_10017514 | 3300025920 | Bacteria | 4061 |
| 193 | Ga0207649_10269344 | 3300025920 | Bacteria | 1234 |
| 194 | Ga0207649_10615262 | 3300025920 | Bacteria | 836 |
| 195 | Ga0207652_10005462 | 3300025921 | Bacteria | 10315 |
| 196 | Ga0207652_10994964 | 3300025921 | Bacteria | 737 |
| 197 | Ga0207681_10019078 | 3300025923 | Bacteria | 4330 |
| 198 | Ga0207681_10103415 | 3300025923 | Bacteria | 2058 |
| 199 | Ga0207681_10244536 | 3300025923 | Bacteria | 1398 |
| 200 | Ga0207694_10153919 | 3300025924 | Bacteria | 1853 |
| 201 | Ga0207694_10925402 | 3300025924 | Bacteria | 737 |
| 202 | Ga0207650_10149568 | 3300025925 | Bacteria | 1842 |
| 203 | Ga0207700_10526106 | 3300025928 | Bacteria | 1048 |
| 204 | Ga0207664_10031244 | 3300025929 | Bacteria | 4073 |
| 205 | Ga0207664_10460947 | 3300025929 | Bacteria | 1135 |
| 206 | Ga0207644_10009851 | 3300025931 | Bacteria | 6286 |
| 207 | Ga0207644_10671623 | 3300025931 | Bacteria | 863 |
| 208 | Ga0207690_10015267 | 3300025932 | Bacteria | 4650 |
| 209 | Ga0207706_10019691 | 3300025933 | Bacteria | 6071 |
| 210 | Ga0207706_10114958 | 3300025933 | Bacteria | 2366 |
| 211 | Ga0207669_10031509 | 3300025937 | Bacteria | 2964 |
| 212 | Ga0207669_10056154 | 3300025937 | Bacteria | 2389 |
| 213 | Ga0207669_10165032 | 3300025937 | Bacteria | 1569 |
| 214 | Ga0207704_10016891 | 3300025938 | Bacteria | 3766 |
| 215 | Ga0207704_10192829 | 3300025938 | Bacteria | 1484 |
| 216 | Ga0207691_10186959 | 3300025940 | Bacteria | 1808 |
| 217 | Ga0207711_10001129 | 3300025941 | Bacteria | 25496 |
| 218 | Ga0207711_10040953 | 3300025941 | Bacteria | 3942 |
| 219 | Ga0207689_10225065 | 3300025942 | Bacteria | 1550 |
| 220 | Ga0207661_10096753 | 3300025944 | Bacteria | 2470 |
| 221 | Ga0207679_10059162 | 3300025945 | Bacteria | 2842 |
| 222 | Ga0207679_10517599 | 3300025945 | Bacteria | 1067 |
| 223 | Ga0207667_10004903 | 3300025949 | Bacteria | 16345 |
| 224 | Ga0207667_10130525 | 3300025949 | Bacteria | 2588 |
| 225 | Ga0207667_10147792 | 3300025949 | Bacteria | 2419 |
| 226 | Ga0207667_10156543 | 3300025949 | Bacteria | 2344 |
| 227 | Ga0207667_11782731 | 3300025949 | Bacteria | 580 |
| 228 | Ga0207651_10043603 | 3300025960 | Bacteria | 2995 |
| 229 | Ga0207651_10074837 | 3300025960 | Bacteria | 2413 |
| 230 | Ga0207651_10097163 | 3300025960 | Bacteria | 2174 |
| 231 | Ga0207668_10001971 | 3300025972 | Bacteria | 12010 |
| 232 | Ga0207668_10155679 | 3300025972 | Bacteria | 1775 |
| 233 | Ga0207640_10084425 | 3300025981 | Bacteria | 2180 |
| 234 | Ga0207640_10505664 | 3300025981 | Bacteria | 1007 |
| 235 | Ga0207658_10001726 | 3300025986 | Bacteria | 16505 |
| 236 | Ga0207658_10009316 | 3300025986 | Bacteria | 6658 |
| 237 | Ga0207658_10830072 | 3300025986 | Bacteria | 840 |
| 238 | Ga0207677_10001650 | 3300026023 | Bacteria | 11816 |
| 239 | Ga0207677_10128235 | 3300026023 | Bacteria | 1921 |
| 240 | Ga0207677_10514343 | 3300026023 | Bacteria | 1037 |
| 241 | Ga0207703_10005317 | 3300026035 | Bacteria | 10376 |
| 242 | Ga0207639_10000669 | 3300026041 | Bacteria | 23668 |
| 243 | Ga0207639_10226369 | 3300026041 | Bacteria | 1618 |
| 244 | Ga0207639_10613772 | 3300026041 | Bacteria | 1004 |
| 245 | Ga0207639_10663011 | 3300026041 | Bacteria | 966 |
| 246 | Ga0207678_10010795 | 3300026067 | Bacteria | 8024 |
| 247 | Ga0207678_10025197 | 3300026067 | Bacteria | 5192 |
| 248 | Ga0207678_10025448 | 3300026067 | Bacteria | 5165 |
| 249 | Ga0207678_10059230 | 3300026067 | Bacteria | 3295 |
| 250 | Ga0207702_10007451 | 3300026078 | Bacteria | 9337 |
| 251 | Ga0207702_10031548 | 3300026078 | Bacteria | 4416 |
| 252 | Ga0207702_10136118 | 3300026078 | Bacteria | 2216 |
| 253 | Ga0207702_10191232 | 3300026078 | Bacteria | 1891 |
| 254 | Ga0207702_10196754 | 3300026078 | Bacteria | 1866 |
| 255 | Ga0207702_10334452 | 3300026078 | Bacteria | 1445 |
| 256 | Ga0207702_10478693 | 3300026078 | Bacteria | 1211 |
| 257 | Ga0207702_10636462 | 3300026078 | Bacteria | 1048 |
| 258 | Ga0207702_11360950 | 3300026078 | Bacteria | 704 |
| 259 | Ga0207641_11138088 | 3300026088 | Bacteria | 779 |
| 260 | Ga0207648_10042723 | 3300026089 | Bacteria | 3980 |
| 261 | Ga0207648_10660393 | 3300026089 | Unclassified | 967 |
| 262 | Ga0207674_10005540 | 3300026116 | Bacteria | 14989 |
| 263 | Ga0207674_10017726 | 3300026116 | Bacteria | 7760 |
| 264 | Ga0207674_10079659 | 3300026116 | Bacteria | 3279 |
| 265 | Ga0207674_10481541 | 3300026116 | Bacteria | 1199 |
| 266 | Ga0207683_10357531 | 3300026121 | Bacteria | 1341 |
| 267 | Ga0207698_10001543 | 3300026142 | Bacteria | 13422 |
| 268 | Ga0207698_10025634 | 3300026142 | Bacteria | 4157 |
| 269 | Ga0207698_10028228 | 3300026142 | Bacteria | 3999 |
| 270 | Ga0207698_10053934 | 3300026142 | Bacteria | 3090 |
| 271 | Ga0207698_10088293 | 3300026142 | Bacteria | 2528 |
| 272 | Ga0207698_10389774 | 3300026142 | Bacteria | 1328 |
| 273 | Ga0207698_10463126 | 3300026142 | Bacteria | 1226 |
| 274 | Ga0268266_10014081 | 3300028379 | Bacteria | 6885 |
| 275 | Ga0268265_10003714 | 3300028380 | Bacteria | 10858 |
| 276 | Ga0268264_10002703 | 3300028381 | Bacteria | 15474 |
| 277 | Ga0268264_10064018 | 3300028381 | Bacteria | 3094 |
| 278 | Ga0373928_0028409 | 3300035084 | Bacteria | 1224 |
| 279 | Ga0373929_0043441 | 3300035085 | Bacteria | 1006 |
| 280 | Ga0373932_0010470 | 3300035112 | Bacteria | 2245 |
| 281 | Ga0373954_0306984 | 3300035118 | Bacteria | 783 |
| 282 | Ga0373956_0251310 | 3300035119 | Bacteria | 840 |
| 283 | Ga0373960_0049230 | 3300035121 | Bacteria | 1246 |
| 284 | Ga0373943_0102196 | 3300035170 | Bacteria | 1501 |
| 285 | Ga0373946_0109070 | 3300035171 | Bacteria | 1251 |
| 286 | Ga0373955_0075232 | 3300035172 | Bacteria | 1897 |
| 287 | Ga0373931_0003388 | 3300035691 | Bacteria | 7153 |
| 288 | Ga0373935_0488909 | 3300035692 | Bacteria | 892 |
| 289 | Ga0373937_0014586 | 3300036401 | Bacteria | 6941 |
| 290 | Ga0395899_0005998 | 3300037312 | Bacteria | 9438 |
| 291 | Ga0395899_0006996 | 3300037312 | Bacteria | 8736 |
| 292 | Ga0395899_0022556 | 3300037312 | Bacteria | 4770 |
| 293 | Ga0395899_0107454 | 3300037312 | Bacteria | 2008 |
| 294 | Ga0395899_0121059 | 3300037312 | Unclassified | 1874 |
| 295 | Ga0395899_0537023 | 3300037312 | Bacteria | 753 |
| 296 | Ga0395899_0619064 | 3300037312 | Bacteria | 687 |
| 297 | Ga0395899_0958554 | 3300037312 | Bacteria | 518 |
| 298 | Ga0395900_0002824 | 3300037418 | Bacteria | 18957 |
| 299 | Ga0395900_0004328 | 3300037418 | Bacteria | 15058 |
| 300 | Ga0395900_0055081 | 3300037418 | Bacteria | 4094 |
| 301 | Ga0395900_0098649 | 3300037418 | Bacteria | 3001 |
| 302 | Ga0395900_0156474 | 3300037418 | Bacteria | 2327 |
| 303 | Ga0395900_0186039 | 3300037418 | Bacteria | 2108 |
| 304 | Ga0395900_0241566 | 3300037418 | Bacteria | 1811 |
| 305 | Ga0395900_0303934 | 3300037418 | Bacteria | 1580 |
| 306 | Ga0395900_0544332 | 3300037418 | Bacteria | 1106 |
| 307 | Ga0395900_0672457 | 3300037418 | Bacteria | 970 |
| 308 | Ga0395900_0678158 | 3300037418 | Bacteria | 965 |
| 309 | Ga0395900_0780679 | 3300037418 | Bacteria | 884 |
| 310 | Ga0395900_0892830 | 3300037418 | Bacteria | 812 |
| 311 | Ga0395900_1149916 | 3300037418 | Bacteria | 692 |
| 312 | Ga0395898_0043104 | 3300037466 | Bacteria | 4447 |
| 313 | Ga0395898_0060351 | 3300037466 | Bacteria | 3686 |
| 314 | Ga0395898_0078590 | 3300037466 | Bacteria | 3183 |
| 315 | Ga0395898_0078988 | 3300037466 | Bacteria | 3174 |
| 316 | Ga0395898_0094647 | 3300037466 | Bacteria | 2871 |
| 317 | Ga0395898_0126964 | 3300037466 | Bacteria | 2443 |
| 318 | Ga0395898_0170196 | 3300037466 | Bacteria | 2082 |
| 319 | Ga0395898_0221980 | 3300037466 | Bacteria | 1802 |
| 320 | Ga0395898_0294497 | 3300037466 | Bacteria | 1548 |
| 321 | Ga0395898_0477432 | 3300037466 | Bacteria | 1186 |
| 322 | Ga0395898_0721409 | 3300037466 | Bacteria | 938 |
| 323 | Ga0395898_0982436 | 3300037466 | Bacteria | 780 |
| 324 | Ga0395898_1084575 | 3300037466 | Bacteria | 734 |
| 325 | Ga0395898_1207000 | 3300037466 | Bacteria | 687 |
| 326 | Ga0395905_0001380 | 3300037471 | Bacteria | 29411 |
| 327 | Ga0395905_0003068 | 3300037471 | Bacteria | 18077 |
| 328 | Ga0395905_0003989 | 3300037471 | Bacteria | 15517 |
| 329 | Ga0395905_0005068 | 3300037471 | Bacteria | 13555 |
| 330 | Ga0395905_0070685 | 3300037471 | Bacteria | 3271 |
| 331 | Ga0395905_0302769 | 3300037471 | Bacteria | 1486 |
| 332 | Ga0395905_0337926 | 3300037471 | Bacteria | 1397 |
| 333 | Ga0395905_0511412 | 3300037471 | Bacteria | 1101 |
| 334 | Ga0395901_0028526 | 3300038443 | Bacteria | 5740 |
| 335 | Ga0395901_0043549 | 3300038443 | Bacteria | 4656 |
| 336 | Ga0395901_0049381 | 3300038443 | Bacteria | 4371 |
| 337 | Ga0395901_0061165 | 3300038443 | Bacteria | 3918 |
| 338 | Ga0395901_0075024 | 3300038443 | Bacteria | 3528 |
| 339 | Ga0395901_0106797 | 3300038443 | Bacteria | 2938 |
| 340 | Ga0395901_0123347 | 3300038443 | Bacteria | 2722 |
| 341 | Ga0395901_0186157 | 3300038443 | Bacteria | 2178 |
| 342 | Ga0395901_0479555 | 3300038443 | Unclassified | 1269 |
| 343 | Ga0395901_0831062 | 3300038443 | Bacteria | 910 |
| 344 | Ga0395901_1018972 | 3300038443 | Bacteria | 803 |
| 345 | Ga0395901_1182564 | 3300038443 | Bacteria | 731 |
| 346 | Ga0395901_1494657 | 3300038443 | Unclassified | 631 |
| 347 | Ga0466969_0011814 | 3300044656 | Bacteria | 4618 |
| 348 | Ga0466966_0012917 | 3300044684 | Bacteria | 5530 |
| 349 | Ga0466966_0488407 | 3300044684 | Unclassified | 740 |
| 350 | Ga0466961_0454665 | 3300044693 | Bacteria | 775 |
| 351 | Ga0466963_0033867 | 3300044694 | Bacteria | 3320 |
| 352 | Ga0466963_0052409 | 3300044694 | Bacteria | 2707 |
| 353 | Ga0466963_0478656 | 3300044694 | Bacteria | 879 |
| 354 | Ga0466964_0297138 | 3300044706 | Bacteria | 813 |
| 355 | Ga0466964_0312411 | 3300044706 | Bacteria | 796 |
| 356 | Ga0466971_0003765 | 3300044719 | Bacteria | 6493 |
| 357 | Ga0466970_0014649 | 3300044765 | Bacteria | 4027 |
| 358 | Ga0466957_0010769 | 3300044842 | Bacteria | 5258 |
| 359 | Ga0466957_0095741 | 3300044842 | Bacteria | 1865 |
| 360 | Ga0466957_0116315 | 3300044842 | Bacteria | 1701 |
| 361 | Ga0466957_0188346 | 3300044842 | Bacteria | 1351 |
| 362 | Ga0466957_0383134 | 3300044842 | Bacteria | 959 |
| 363 | Ga0466957_0638805 | 3300044842 | Bacteria | 748 |
| 364 | Ga0466957_0739463 | 3300044842 | Unclassified | 696 |
| 365 | Ga0466959_0104813 | 3300045049 | Bacteria | 2022 |
| 366 | Ga0466958_0000609 | 3300045836 | Bacteria | 15283 |
| 367 | Ga0466958_0028223 | 3300045836 | Bacteria | 3326 |
| 368 | Ga0466958_0105001 | 3300045836 | Bacteria | 1760 |
| 369 | Ga0466958_0115666 | 3300045836 | Bacteria | 1676 |
| 370 | Ga0466958_0121711 | 3300045836 | Bacteria | 1634 |
| 371 | Ga0466958_0390329 | 3300045836 | Bacteria | 898 |
| 372 | Ga0466967_0010893 | 3300045976 | Bacteria | 6851 |
| 373 | Ga0466967_0012647 | 3300045976 | Bacteria | 6472 |
| 374 | Ga0466967_0169428 | 3300045976 | Bacteria | 2054 |
| 375 | Ga0466967_0231753 | 3300045976 | Bacteria | 1758 |
| 376 | Ga0466967_0424372 | 3300045976 | Bacteria | 1296 |
| 377 | Ga0466967_0765835 | 3300045976 | Bacteria | 958 |
| 378 | Ga0466967_0790801 | 3300045976 | Bacteria | 942 |
| 379 | Ga0466967_1368106 | 3300045976 | Bacteria | 705 |
| 380 | Ga0466967_1751968 | 3300045976 | Bacteria | 618 |
| 381 | Ga0495621_0001932 | 3300046539 | Bacteria | 5452 |
| 382 | Ga0495633_0065617 | 3300046558 | Bacteria | 1696 |
| 383 | Ga0495669_0010391 | 3300046684 | Bacteria | 3933 |
| 384 | Ga0495670_0007679 | 3300046691 | Bacteria | 5301 |
| 385 | Ga0496107_0197689 | 3300048910 | Bacteria | 1494 |
| 386 | Ga0496107_0910560 | 3300048910 | Bacteria | 641 |
| 387 | Ga0496111_0887709 | 3300048914 | Bacteria | 642 |
| 388 | Ga0496114_0000381 | 3300048917 | Bacteria | 32736 |
| 389 | Ga0501069_0164363 | 3300049585 | Bacteria | 1279 |
| 390 | Ga0466962_0005083 | 3300061719 | Bacteria | 6327 |
| 391 | Ga0466962_0240635 | 3300061719 | Bacteria | 888 |
| 392 | Ga0466962_0670273 | 3300061719 | Bacteria | 531 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005344 | Ga0070661_100204040 | Ga0070661_1002040402 | 142 |
| 2 | 3300005356 | Ga0070674_100063683 | Ga0070674_1000636834 | 142 |
| 3 | 3300005457 | Ga0070662_100001441 | Ga0070662_10000144117 | 142 |
| 4 | 3300005618 | Ga0068864_100012913 | Ga0068864_1000129136 | 142 |
| 5 | 3300005718 | Ga0068866_10015235 | Ga0068866_100152353 | 142 |
| 6 | 3300005841 | Ga0068863_100031536 | Ga0068863_1000315363 | 142 |
| 7 | 3300005843 | Ga0068860_100191901 | Ga0068860_1001919013 | 142 |
| 8 | 3300006237 | Ga0097621_100044034 | Ga0097621_1000440342 | 142 |
| 9 | 3300006358 | Ga0068871_100332358 | Ga0068871_1003323582 | 142 |
| 10 | 3300009176 | Ga0105242_10066310 | Ga0105242_100663102 | 142 |
| 11 | 3300013297 | Ga0157378_10177916 | Ga0157378_101779162 | 142 |
| 12 | 3300013308 | Ga0157375_10308145 | Ga0157375_103081452 | 142 |
| 13 | 3300014968 | Ga0157379_10225296 | Ga0157379_102252962 | 142 |
| 14 | 3300001979 | JGI24740J21852_10087257 | JGI24740J21852_100872572 | 144 |
| 15 | 3300005336 | Ga0070680_101256874 | Ga0070680_1012568741 | 144 |
| 16 | 3300005436 | Ga0070713_100040618 | Ga0070713_1000406182 | 144 |
| 17 | 3300005455 | Ga0070663_100035172 | Ga0070663_1000351723 | 144 |
| 18 | 3300005535 | Ga0070684_100013787 | Ga0070684_1000137875 | 144 |
| 19 | 3300005539 | Ga0068853_100036691 | Ga0068853_1000366911 | 144 |
| 20 | 3300005564 | Ga0070664_100097566 | Ga0070664_1000975662 | 144 |
| 21 | 3300005577 | Ga0068857_100032087 | Ga0068857_1000320872 | 144 |
| 22 | 3300005578 | Ga0068854_100087281 | Ga0068854_1000872814 | 144 |
| 23 | 3300005578 | Ga0068854_100164046 | Ga0068854_1001640461 | 144 |
| 24 | 3300005834 | Ga0068851_10131736 | Ga0068851_101317362 | 144 |
| 25 | 3300006028 | Ga0070717_10006409 | Ga0070717_100064095 | 144 |
| 26 | 3300006175 | Ga0070712_100799434 | Ga0070712_1007994342 | 144 |
| 27 | 3300013100 | Ga0157373_10063396 | Ga0157373_100633964 | 144 |
| 28 | 3300025893 | Ga0207682_10011290 | Ga0207682_100112904 | 144 |
| 29 | 3300025904 | Ga0207647_10061465 | Ga0207647_100614653 | 144 |
| 30 | 3300025908 | Ga0207643_10302477 | Ga0207643_103024771 | 144 |
| 31 | 3300025909 | Ga0207705_10011741 | Ga0207705_100117412 | 144 |
| 32 | 3300025909 | Ga0207705_10443812 | Ga0207705_104438122 | 144 |
| 33 | 3300025911 | Ga0207654_10348058 | Ga0207654_103480581 | 144 |
| 34 | 3300025919 | Ga0207657_10003076 | Ga0207657_1000307611 | 144 |
| 35 | 3300025923 | Ga0207681_10244536 | Ga0207681_102445362 | 144 |
| 36 | 3300025933 | Ga0207706_10114958 | Ga0207706_101149582 | 144 |
| 37 | 3300025944 | Ga0207661_10096753 | Ga0207661_100967531 | 144 |
| 38 | 3300025981 | Ga0207640_10505664 | Ga0207640_105056642 | 144 |
| 39 | 3300026041 | Ga0207639_10226369 | Ga0207639_102263692 | 144 |
| 40 | 3300026067 | Ga0207678_10059230 | Ga0207678_100592302 | 144 |
| 41 | 3300026078 | Ga0207702_10031548 | Ga0207702_100315484 | 144 |
| 42 | 3300026116 | Ga0207674_10017726 | Ga0207674_100177266 | 144 |
| 43 | 3300026142 | Ga0207698_10053934 | Ga0207698_100539344 | 144 |
| 44 | 3300026142 | Ga0207698_10389774 | Ga0207698_103897742 | 144 |
| 45 | 3300005985 | Ga0081539_10010498 | Ga0081539_100104984 | 145 |
| 46 | 3300045976 | Ga0466967_0010893 | Ga0466967_0010893_1104_1544 | 145 |
| 47 | 3300046539 | Ga0495621_0001932 | Ga0495621_0001932_1150_1629 | 145 |
| 48 | 3300046558 | Ga0495633_0065617 | Ga0495633_0065617_356_835 | 145 |
| 49 | 3300046684 | Ga0495669_0010391 | Ga0495669_0010391_2711_3190 | 145 |
| 50 | 3300046691 | Ga0495670_0007679 | Ga0495670_0007679_3962_4441 | 145 |
| 51 | 3300005435 | Ga0070714_100062689 | Ga0070714_1000626893 | 146 |
| 52 | 3300005436 | Ga0070713_100414860 | Ga0070713_1004148601 | 146 |
| 53 | 3300005563 | Ga0068855_100157695 | Ga0068855_1001576953 | 146 |
| 54 | 3300025906 | Ga0207699_10048535 | Ga0207699_100485353 | 146 |
| 55 | 3300025928 | Ga0207700_10526106 | Ga0207700_105261062 | 146 |
| 56 | 3300025949 | Ga0207667_10147792 | Ga0207667_101477923 | 146 |
| 57 | 3300035170 | Ga0373943_0102196 | Ga0373943_0102196_874_1353 | 146 |
| 58 | 3300035171 | Ga0373946_0109070 | Ga0373946_0109070_693_1172 | 146 |
| 59 | 3300035692 | Ga0373935_0488909 | Ga0373935_0488909_35_514 | 146 |
| 60 | 3300037418 | Ga0395900_0892830 | Ga0395900_0892830_125_604 | 146 |
| 61 | 3300001979 | JGI24740J21852_10024938 | JGI24740J21852_100249382 | 147 |
| 62 | 3300005336 | Ga0070680_100007665 | Ga0070680_1000076652 | 147 |
| 63 | 3300005338 | Ga0068868_100001541 | Ga0068868_10000154111 | 147 |
| 64 | 3300005339 | Ga0070660_100003749 | Ga0070660_1000037498 | 147 |
| 65 | 3300005355 | Ga0070671_100009051 | Ga0070671_1000090518 | 147 |
| 66 | 3300005356 | Ga0070674_100268104 | Ga0070674_1002681042 | 147 |
| 67 | 3300005364 | Ga0070673_100077241 | Ga0070673_1000772414 | 147 |
| 68 | 3300005367 | Ga0070667_100003268 | Ga0070667_10000326814 | 147 |
| 69 | 3300005455 | Ga0070663_100040431 | Ga0070663_1000404311 | 147 |
| 70 | 3300005459 | Ga0068867_100108089 | Ga0068867_1001080894 | 147 |
| 71 | 3300005530 | Ga0070679_100066072 | Ga0070679_1000660724 | 147 |
| 72 | 3300005616 | Ga0068852_100321591 | Ga0068852_1003215912 | 147 |
| 73 | 3300005617 | Ga0068859_100089335 | Ga0068859_1000893351 | 147 |
| 74 | 3300005842 | Ga0068858_100008274 | Ga0068858_1000082748 | 147 |
| 75 | 3300005843 | Ga0068860_100114234 | Ga0068860_1001142344 | 147 |
| 76 | 3300006237 | Ga0097621_100827995 | Ga0097621_1008279952 | 147 |
| 77 | 3300006931 | Ga0097620_100089332 | Ga0097620_1000893321 | 147 |
| 78 | 3300009148 | Ga0105243_10679192 | Ga0105243_106791922 | 147 |
| 79 | 3300009177 | Ga0105248_10001470 | Ga0105248_1000147014 | 147 |
| 80 | 3300010375 | Ga0105239_10065787 | Ga0105239_100657875 | 147 |
| 81 | 3300013297 | Ga0157378_11275193 | Ga0157378_112751932 | 147 |
| 82 | 3300014968 | Ga0157379_10157346 | Ga0157379_101573462 | 147 |
| 83 | 3300025903 | Ga0207680_10001155 | Ga0207680_100011555 | 147 |
| 84 | 3300025904 | Ga0207647_10001359 | Ga0207647_1000135910 | 147 |
| 85 | 3300025915 | Ga0207693_10319061 | Ga0207693_103190612 | 147 |
| 86 | 3300025931 | Ga0207644_10009851 | Ga0207644_100098516 | 147 |
| 87 | 3300025937 | Ga0207669_10165032 | Ga0207669_101650322 | 147 |
| 88 | 3300025941 | Ga0207711_10001129 | Ga0207711_1000112914 | 147 |
| 89 | 3300025960 | Ga0207651_10043603 | Ga0207651_100436034 | 147 |
| 90 | 3300025986 | Ga0207658_10001726 | Ga0207658_1000172615 | 147 |
| 91 | 3300026023 | Ga0207677_10001650 | Ga0207677_100016506 | 147 |
| 92 | 3300026035 | Ga0207703_10005317 | Ga0207703_100053176 | 147 |
| 93 | 3300026089 | Ga0207648_10660393 | Ga0207648_106603932 | 147 |
| 94 | 3300026142 | Ga0207698_10028228 | Ga0207698_100282282 | 147 |
| 95 | 3300028381 | Ga0268264_10064018 | Ga0268264_100640184 | 147 |
| 96 | 3300044684 | Ga0466966_0488407 | Ga0466966_0488407_68_517 | 147 |
| 97 | 3300045836 | Ga0466958_0105001 | Ga0466958_0105001_180_629 | 147 |
| 98 | 3300045836 | Ga0466958_0115666 | Ga0466958_0115666_216_665 | 147 |
| 99 | 3300045836 | Ga0466958_0390329 | Ga0466958_0390329_170_619 | 147 |
| 100 | 3300005539 | Ga0068853_100048822 | Ga0068853_1000488224 | 148 |
| 101 | 3300009551 | Ga0105238_11134897 | Ga0105238_111348972 | 148 |
| 102 | 3300013105 | Ga0157369_10621933 | Ga0157369_106219332 | 148 |
| 103 | 3300013307 | Ga0157372_11267597 | Ga0157372_112675972 | 148 |
| 104 | 3300037312 | Ga0395899_0958554 | Ga0395899_0958554_50_499 | 148 |
| 105 | 3300037418 | Ga0395900_1149916 | Ga0395900_1149916_34_483 | 148 |
| 106 | 3300037466 | Ga0395898_0170196 | Ga0395898_0170196_304_753 | 148 |
| 107 | 3300037466 | Ga0395898_0982436 | Ga0395898_0982436_16_465 | 148 |
| 108 | 3300038443 | Ga0395901_0831062 | Ga0395901_0831062_305_754 | 148 |
| 109 | 3300038443 | Ga0395901_1182564 | Ga0395901_1182564_198_647 | 148 |
| 110 | 3300048914 | Ga0496111_0887709 | Ga0496111_0887709_35_484 | 148 |
| 111 | 3300048917 | Ga0496114_0000381 | Ga0496114_0000381_12346_12795 | 148 |
| 112 | 3300005337 | Ga0070682_100240394 | Ga0070682_1002403942 | 149 |
| 113 | 3300005356 | Ga0070674_100304323 | Ga0070674_1003043232 | 149 |
| 114 | 3300025904 | Ga0207647_10579872 | Ga0207647_105798722 | 149 |
| 115 | 3300025937 | Ga0207669_10031509 | Ga0207669_100315092 | 149 |
| 116 | 3300037312 | Ga0395899_0022556 | Ga0395899_0022556_3924_4376 | 149 |
| 117 | 3300037312 | Ga0395899_0537023 | Ga0395899_0537023_63_515 | 149 |
| 118 | 3300037312 | Ga0395899_0619064 | Ga0395899_0619064_173_625 | 149 |
| 119 | 3300037418 | Ga0395900_0002824 | Ga0395900_0002824_8348_8800 | 149 |
| 120 | 3300037466 | Ga0395898_0078988 | Ga0395898_0078988_2328_2780 | 149 |
| 121 | 3300037466 | Ga0395898_0221980 | Ga0395898_0221980_1141_1593 | 149 |
| 122 | 3300037466 | Ga0395898_1084575 | Ga0395898_1084575_63_515 | 149 |
| 123 | 3300037466 | Ga0395898_1207000 | Ga0395898_1207000_173_625 | 149 |
| 124 | 3300037471 | Ga0395905_0003068 | Ga0395905_0003068_13966_14418 | 149 |
| 125 | 3300037471 | Ga0395905_0511412 | Ga0395905_0511412_493_945 | 149 |
| 126 | 3300038443 | Ga0395901_0123347 | Ga0395901_0123347_73_525 | 149 |
| 127 | 3300038443 | Ga0395901_0479555 | Ga0395901_0479555_17_469 | 149 |
| 128 | 3300045976 | Ga0466967_0012647 | Ga0466967_0012647_14_466 | 149 |
| 129 | 3300045976 | Ga0466967_1751968 | Ga0466967_1751968_14_466 | 149 |
| 130 | 3300005327 | Ga0070658_10000653 | Ga0070658_1000065316 | 150 |
| 131 | 3300005337 | Ga0070682_100097440 | Ga0070682_1000974402 | 150 |
| 132 | 3300035084 | Ga0373928_0028409 | Ga0373928_0028409_395_850 | 150 |
| 133 | 3300035085 | Ga0373929_0043441 | Ga0373929_0043441_197_652 | 150 |
| 134 | 3300035112 | Ga0373932_0010470 | Ga0373932_0010470_180_635 | 150 |
| 135 | 3300035121 | Ga0373960_0049230 | Ga0373960_0049230_500_955 | 150 |
| 136 | 3300035691 | Ga0373931_0003388 | Ga0373931_0003388_4526_4981 | 150 |
| 137 | 3300044842 | Ga0466957_0383134 | Ga0466957_0383134_437_901 | 150 |
| 138 | 3300045976 | Ga0466967_0790801 | Ga0466967_0790801_352_807 | 150 |
| 139 | 3300045976 | Ga0466967_1368106 | Ga0466967_1368106_20_475 | 150 |
| 140 | 3300048910 | Ga0496107_0910560 | Ga0496107_0910560_50_505 | 150 |
| 141 | 3300009093 | Ga0105240_10592920 | Ga0105240_105929202 | 153 |
| 142 | 3300013105 | Ga0157369_10188621 | Ga0157369_101886212 | 153 |
| 143 | 3300044694 | Ga0466963_0033867 | Ga0466963_0033867_716_1192 | 153 |
| 144 | 3300045836 | Ga0466958_0028223 | Ga0466958_0028223_878_1354 | 153 |
| 145 | 3300045976 | Ga0466967_0424372 | Ga0466967_0424372_233_709 | 153 |
| 146 | 3300045976 | Ga0466967_0765835 | Ga0466967_0765835_250_783 | 153 |
| 147 | 3300061719 | Ga0466962_0240635 | Ga0466962_0240635_116_592 | 153 |
| 148 | 3300005366 | Ga0070659_100020150 | Ga0070659_1000201503 | 154 |
| 149 | 3300005577 | Ga0068857_100340378 | Ga0068857_1003403782 | 154 |
| 150 | 3300005614 | Ga0068856_100254575 | Ga0068856_1002545752 | 154 |
| 151 | 3300025932 | Ga0207690_10015267 | Ga0207690_100152673 | 154 |
| 152 | 3300026078 | Ga0207702_10334452 | Ga0207702_103344523 | 154 |
| 153 | 3300026116 | Ga0207674_10481541 | Ga0207674_104815412 | 154 |
| 154 | 3300037418 | Ga0395900_0678158 | Ga0395900_0678158_332_811 | 154 |
| 155 | 3300005334 | Ga0068869_100464117 | Ga0068869_1004641172 | 156 |
| 156 | 3300005338 | Ga0068868_100262471 | Ga0068868_1002624712 | 156 |
| 157 | 3300005354 | Ga0070675_101212725 | Ga0070675_1012127251 | 156 |
| 158 | 3300005364 | Ga0070673_100013491 | Ga0070673_1000134912 | 156 |
| 159 | 3300005367 | Ga0070667_100020258 | Ga0070667_1000202582 | 156 |
| 160 | 3300005548 | Ga0070665_100223883 | Ga0070665_1002238832 | 156 |
| 161 | 3300005840 | Ga0068870_10092898 | Ga0068870_100928982 | 156 |
| 162 | 3300005841 | Ga0068863_101166126 | Ga0068863_1011661261 | 156 |
| 163 | 3300005843 | Ga0068860_100005315 | Ga0068860_1000053158 | 156 |
| 164 | 3300005844 | Ga0068862_100008095 | Ga0068862_1000080957 | 156 |
| 165 | 3300006237 | Ga0097621_100006933 | Ga0097621_1000069335 | 156 |
| 166 | 3300006358 | Ga0068871_100024044 | Ga0068871_1000240442 | 156 |
| 167 | 3300009177 | Ga0105248_10465069 | Ga0105248_104650692 | 156 |
| 168 | 3300009553 | Ga0105249_10548984 | Ga0105249_105489842 | 156 |
| 169 | 3300013306 | Ga0163162_10385889 | Ga0163162_103858892 | 156 |
| 170 | 3300013308 | Ga0157375_10087702 | Ga0157375_100877022 | 156 |
| 171 | 3300025315 | Ga0207697_10039732 | Ga0207697_100397322 | 156 |
| 172 | 3300025901 | Ga0207688_10115387 | Ga0207688_101153872 | 156 |
| 173 | 3300025907 | Ga0207645_10046374 | Ga0207645_100463742 | 156 |
| 174 | 3300025908 | Ga0207643_10064382 | Ga0207643_100643822 | 156 |
| 175 | 3300025923 | Ga0207681_10019078 | Ga0207681_100190782 | 156 |
| 176 | 3300025923 | Ga0207681_10103415 | Ga0207681_101034152 | 156 |
| 177 | 3300025925 | Ga0207650_10149568 | Ga0207650_101495681 | 156 |
| 178 | 3300025931 | Ga0207644_10671623 | Ga0207644_106716231 | 156 |
| 179 | 3300025937 | Ga0207669_10056154 | Ga0207669_100561542 | 156 |
| 180 | 3300025938 | Ga0207704_10016891 | Ga0207704_100168912 | 156 |
| 181 | 3300025938 | Ga0207704_10192829 | Ga0207704_101928292 | 156 |
| 182 | 3300025940 | Ga0207691_10186959 | Ga0207691_101869592 | 156 |
| 183 | 3300025941 | Ga0207711_10040953 | Ga0207711_100409532 | 156 |
| 184 | 3300025942 | Ga0207689_10225065 | Ga0207689_102250651 | 156 |
| 185 | 3300025960 | Ga0207651_10074837 | Ga0207651_100748372 | 156 |
| 186 | 3300025960 | Ga0207651_10097163 | Ga0207651_100971631 | 156 |
| 187 | 3300025972 | Ga0207668_10001971 | Ga0207668_100019712 | 156 |
| 188 | 3300025972 | Ga0207668_10155679 | Ga0207668_101556792 | 156 |
| 189 | 3300025986 | Ga0207658_10009316 | Ga0207658_100093163 | 156 |
| 190 | 3300026023 | Ga0207677_10128235 | Ga0207677_101282352 | 156 |
| 191 | 3300026088 | Ga0207641_11138088 | Ga0207641_111380882 | 156 |
| 192 | 3300026089 | Ga0207648_10042723 | Ga0207648_100427234 | 156 |
| 193 | 3300026121 | Ga0207683_10357531 | Ga0207683_103575312 | 156 |
| 194 | 3300028379 | Ga0268266_10014081 | Ga0268266_100140812 | 156 |
| 195 | 3300028380 | Ga0268265_10003714 | Ga0268265_100037144 | 156 |
| 196 | 3300028381 | Ga0268264_10002703 | Ga0268264_100027038 | 156 |
| 197 | 3300005535 | Ga0070684_100744523 | Ga0070684_1007445232 | 157 |
| 198 | 3300005616 | Ga0068852_100642100 | Ga0068852_1006421002 | 157 |
| 199 | 3300025909 | Ga0207705_10960832 | Ga0207705_109608321 | 157 |
| 200 | 3300025920 | Ga0207649_10269344 | Ga0207649_102693442 | 157 |
| 201 | 3300025949 | Ga0207667_10156543 | Ga0207667_101565432 | 157 |
| 202 | 3300026023 | Ga0207677_10514343 | Ga0207677_105143432 | 157 |
| 203 | 3300005335 | Ga0070666_10048290 | Ga0070666_100482902 | 158 |
| 204 | 3300005364 | Ga0070673_100100108 | Ga0070673_1001001082 | 158 |
| 205 | 3300005436 | Ga0070713_100254909 | Ga0070713_1002549092 | 158 |
| 206 | 3300005614 | Ga0068856_100014649 | Ga0068856_1000146492 | 158 |
| 207 | 3300005614 | Ga0068856_100021369 | Ga0068856_1000213697 | 158 |
| 208 | 3300005614 | Ga0068856_100126288 | Ga0068856_1001262882 | 158 |
| 209 | 3300005616 | Ga0068852_100004075 | Ga0068852_10000407512 | 158 |
| 210 | 3300006175 | Ga0070712_100219938 | Ga0070712_1002199382 | 158 |
| 211 | 3300009093 | Ga0105240_11549264 | Ga0105240_115492642 | 158 |
| 212 | 3300009545 | Ga0105237_10662541 | Ga0105237_106625412 | 158 |
| 213 | 3300013100 | Ga0157373_10728465 | Ga0157373_107284651 | 158 |
| 214 | 3300013102 | Ga0157371_10006632 | Ga0157371_100066327 | 158 |
| 215 | 3300013104 | Ga0157370_10488485 | Ga0157370_104884852 | 158 |
| 216 | 3300013105 | Ga0157369_10000141 | Ga0157369_1000014146 | 158 |
| 217 | 3300013105 | Ga0157369_10004026 | Ga0157369_100040269 | 158 |
| 218 | 3300013105 | Ga0157369_10071147 | Ga0157369_100711472 | 158 |
| 219 | 3300013105 | Ga0157369_10082554 | Ga0157369_100825542 | 158 |
| 220 | 3300013307 | Ga0157372_10719107 | Ga0157372_107191073 | 158 |
| 221 | 3300020610 | Ga0154015_1380812 | Ga0154015_13808122 | 158 |
| 222 | 3300025290 | Ga0207673_1008752 | Ga0207673_10087522 | 158 |
| 223 | 3300025903 | Ga0207680_10226292 | Ga0207680_102262922 | 158 |
| 224 | 3300025919 | Ga0207657_10574735 | Ga0207657_105747352 | 158 |
| 225 | 3300025920 | Ga0207649_10017514 | Ga0207649_100175144 | 158 |
| 226 | 3300025929 | Ga0207664_10460947 | Ga0207664_104609471 | 158 |
| 227 | 3300025949 | Ga0207667_10004903 | Ga0207667_1000490311 | 158 |
| 228 | 3300025986 | Ga0207658_10830072 | Ga0207658_108300722 | 158 |
| 229 | 3300026041 | Ga0207639_10663011 | Ga0207639_106630112 | 158 |
| 230 | 3300026067 | Ga0207678_10010795 | Ga0207678_100107952 | 158 |
| 231 | 3300026078 | Ga0207702_10007451 | Ga0207702_100074516 | 158 |
| 232 | 3300026078 | Ga0207702_10136118 | Ga0207702_101361182 | 158 |
| 233 | 3300026078 | Ga0207702_10196754 | Ga0207702_101967543 | 158 |
| 234 | 3300026142 | Ga0207698_10001543 | Ga0207698_1000154313 | 158 |
| 235 | 3300037312 | Ga0395899_0005998 | Ga0395899_0005998_7539_8018 | 158 |
| 236 | 3300037312 | Ga0395899_0006996 | Ga0395899_0006996_7008_7487 | 158 |
| 237 | 3300037418 | Ga0395900_0098649 | Ga0395900_0098649_12_491 | 158 |
| 238 | 3300037418 | Ga0395900_0156474 | Ga0395900_0156474_450_929 | 158 |
| 239 | 3300037418 | Ga0395900_0303934 | Ga0395900_0303934_229_708 | 158 |
| 240 | 3300037418 | Ga0395900_0544332 | Ga0395900_0544332_97_576 | 158 |
| 241 | 3300037466 | Ga0395898_0043104 | Ga0395898_0043104_729_1208 | 158 |
| 242 | 3300037466 | Ga0395898_0477432 | Ga0395898_0477432_92_571 | 158 |
| 243 | 3300037471 | Ga0395905_0005068 | Ga0395905_0005068_9348_9827 | 158 |
| 244 | 3300038443 | Ga0395901_0043549 | Ga0395901_0043549_3152_3631 | 158 |
| 245 | 3300038443 | Ga0395901_0049381 | Ga0395901_0049381_2472_2951 | 158 |
| 246 | 3300038443 | Ga0395901_1494657 | Ga0395901_1494657_71_550 | 158 |
| 247 | 3300044842 | Ga0466957_0095741 | Ga0466957_0095741_1292_1771 | 158 |
| 248 | 3300044842 | Ga0466957_0739463 | Ga0466957_0739463_206_685 | 158 |
| 249 | 3300045836 | Ga0466958_0121711 | Ga0466958_0121711_976_1455 | 158 |
| 250 | 3300045976 | Ga0466967_0169428 | Ga0466967_0169428_1018_1497 | 158 |
| 251 | 3300048910 | Ga0496107_0197689 | Ga0496107_0197689_480_959 | 158 |
| 252 | 3300002067 | JGI24735J21928_10037000 | JGI24735J21928_100370003 | 159 |
| 253 | 3300005327 | Ga0070658_10046953 | Ga0070658_100469533 | 159 |
| 254 | 3300005336 | Ga0070680_100441909 | Ga0070680_1004419092 | 159 |
| 255 | 3300005344 | Ga0070661_101169630 | Ga0070661_1011696302 | 159 |
| 256 | 3300005539 | Ga0068853_100111141 | Ga0068853_1001111412 | 159 |
| 257 | 3300005563 | Ga0068855_100411006 | Ga0068855_1004110062 | 159 |
| 258 | 3300005614 | Ga0068856_100122424 | Ga0068856_1001224244 | 159 |
| 259 | 3300005614 | Ga0068856_101545823 | Ga0068856_1015458232 | 159 |
| 260 | 3300005616 | Ga0068852_100340024 | Ga0068852_1003400243 | 159 |
| 261 | 3300010375 | Ga0105239_10786062 | Ga0105239_107860622 | 159 |
| 262 | 3300013102 | Ga0157371_10054801 | Ga0157371_100548012 | 159 |
| 263 | 3300013102 | Ga0157371_10147955 | Ga0157371_101479552 | 159 |
| 264 | 3300013105 | Ga0157369_10551639 | Ga0157369_105516392 | 159 |
| 265 | 3300013105 | Ga0157369_10651512 | Ga0157369_106515121 | 159 |
| 266 | 3300013307 | Ga0157372_10161152 | Ga0157372_101611524 | 159 |
| 267 | 3300020082 | Ga0206353_10214899 | Ga0206353_102148993 | 159 |
| 268 | 3300025904 | Ga0207647_10064670 | Ga0207647_100646702 | 159 |
| 269 | 3300025904 | Ga0207647_10536703 | Ga0207647_105367032 | 159 |
| 270 | 3300025909 | Ga0207705_10654314 | Ga0207705_106543141 | 159 |
| 271 | 3300025909 | Ga0207705_10842348 | Ga0207705_108423482 | 159 |
| 272 | 3300025917 | Ga0207660_10257423 | Ga0207660_102574233 | 159 |
| 273 | 3300025929 | Ga0207664_10031244 | Ga0207664_100312444 | 159 |
| 274 | 3300025945 | Ga0207679_10517599 | Ga0207679_105175992 | 159 |
| 275 | 3300025949 | Ga0207667_11782731 | Ga0207667_117827312 | 159 |
| 276 | 3300026041 | Ga0207639_10000669 | Ga0207639_100006693 | 159 |
| 277 | 3300026078 | Ga0207702_10191232 | Ga0207702_101912323 | 159 |
| 278 | 3300026078 | Ga0207702_11360950 | Ga0207702_113609502 | 159 |
| 279 | 3300026116 | Ga0207674_10079659 | Ga0207674_100796596 | 159 |
| 280 | 3300026142 | Ga0207698_10025634 | Ga0207698_100256345 | 159 |
| 281 | 3300035118 | Ga0373954_0306984 | Ga0373954_0306984_114_596 | 159 |
| 282 | 3300035119 | Ga0373956_0251310 | Ga0373956_0251310_112_594 | 159 |
| 283 | 3300035172 | Ga0373955_0075232 | Ga0373955_0075232_1348_1830 | 159 |
| 284 | 3300036401 | Ga0373937_0014586 | Ga0373937_0014586_4257_4739 | 159 |
| 285 | 3300037312 | Ga0395899_0121059 | Ga0395899_0121059_1370_1852 | 159 |
| 286 | 3300037418 | Ga0395900_0004328 | Ga0395900_0004328_134_616 | 159 |
| 287 | 3300037418 | Ga0395900_0672457 | Ga0395900_0672457_258_740 | 159 |
| 288 | 3300037418 | Ga0395900_0780679 | Ga0395900_0780679_297_779 | 159 |
| 289 | 3300037466 | Ga0395898_0060351 | Ga0395898_0060351_1894_2376 | 159 |
| 290 | 3300037466 | Ga0395898_0078590 | Ga0395898_0078590_987_1469 | 159 |
| 291 | 3300037466 | Ga0395898_0721409 | Ga0395898_0721409_199_681 | 159 |
| 292 | 3300037471 | Ga0395905_0001380 | Ga0395905_0001380_10460_10942 | 159 |
| 293 | 3300037471 | Ga0395905_0070685 | Ga0395905_0070685_598_1080 | 159 |
| 294 | 3300037471 | Ga0395905_0337926 | Ga0395905_0337926_786_1268 | 159 |
| 295 | 3300038443 | Ga0395901_0061165 | Ga0395901_0061165_1367_1849 | 159 |
| 296 | 3300038443 | Ga0395901_1018972 | Ga0395901_1018972_245_727 | 159 |
| 297 | 3300044656 | Ga0466969_0011814 | Ga0466969_0011814_1799_2281 | 159 |
| 298 | 3300044684 | Ga0466966_0012917 | Ga0466966_0012917_3815_4297 | 159 |
| 299 | 3300044693 | Ga0466961_0454665 | Ga0466961_0454665_237_719 | 159 |
| 300 | 3300044694 | Ga0466963_0052409 | Ga0466963_0052409_1698_2180 | 159 |
| 301 | 3300044694 | Ga0466963_0478656 | Ga0466963_0478656_146_628 | 159 |
| 302 | 3300044706 | Ga0466964_0297138 | Ga0466964_0297138_125_607 | 159 |
| 303 | 3300044706 | Ga0466964_0312411 | Ga0466964_0312411_140_622 | 159 |
| 304 | 3300044719 | Ga0466971_0003765 | Ga0466971_0003765_1434_1916 | 159 |
| 305 | 3300044765 | Ga0466970_0014649 | Ga0466970_0014649_1034_1516 | 159 |
| 306 | 3300044842 | Ga0466957_0010769 | Ga0466957_0010769_3831_4313 | 159 |
| 307 | 3300044842 | Ga0466957_0116315 | Ga0466957_0116315_490_972 | 159 |
| 308 | 3300044842 | Ga0466957_0188346 | Ga0466957_0188346_262_744 | 159 |
| 309 | 3300044842 | Ga0466957_0638805 | Ga0466957_0638805_184_666 | 159 |
| 310 | 3300045049 | Ga0466959_0104813 | Ga0466959_0104813_308_790 | 159 |
| 311 | 3300045836 | Ga0466958_0000609 | Ga0466958_0000609_12427_12909 | 159 |
| 312 | 3300045976 | Ga0466967_0231753 | Ga0466967_0231753_1229_1711 | 159 |
| 313 | 3300061719 | Ga0466962_0005083 | Ga0466962_0005083_2557_3039 | 159 |
| 314 | 3300061719 | Ga0466962_0670273 | Ga0466962_0670273_28_513 | 159 |
| 315 | 3300005344 | Ga0070661_100524988 | Ga0070661_1005249881 | 160 |
| 316 | 3300005614 | Ga0068856_101118063 | Ga0068856_1011180632 | 160 |
| 317 | 3300025920 | Ga0207649_10615262 | Ga0207649_106152622 | 160 |
| 318 | 3300038443 | Ga0395901_0186157 | Ga0395901_0186157_1339_1830 | 160 |
| 319 | 3300049585 | Ga0501069_0164363 | Ga0501069_0164363_144_674 | 162 |
| 320 | 3300001915 | JGI24741J21665_1040731 | JGI24741J21665_10407311 | 163 |
| 321 | 3300001979 | JGI24740J21852_10030004 | JGI24740J21852_100300042 | 163 |
| 322 | 3300005339 | Ga0070660_100012089 | Ga0070660_1000120893 | 163 |
| 323 | 3300005344 | Ga0070661_100031573 | Ga0070661_1000315733 | 163 |
| 324 | 3300005455 | Ga0070663_100063745 | Ga0070663_1000637452 | 163 |
| 325 | 3300005578 | Ga0068854_100046561 | Ga0068854_1000465612 | 163 |
| 326 | 3300005616 | Ga0068852_100851216 | Ga0068852_1008512161 | 163 |
| 327 | 3300009093 | Ga0105240_10653777 | Ga0105240_106537772 | 163 |
| 328 | 3300009174 | Ga0105241_10260769 | Ga0105241_102607692 | 163 |
| 329 | 3300013100 | Ga0157373_10134914 | Ga0157373_101349142 | 163 |
| 330 | 3300013104 | Ga0157370_10372425 | Ga0157370_103724252 | 163 |
| 331 | 3300025904 | Ga0207647_10099823 | Ga0207647_100998233 | 163 |
| 332 | 3300025909 | Ga0207705_10000003 | Ga0207705_10000003719 | 163 |
| 333 | 3300025909 | Ga0207705_10000979 | Ga0207705_1000097916 | 163 |
| 334 | 3300025913 | Ga0207695_10390456 | Ga0207695_103904562 | 163 |
| 335 | 3300025919 | Ga0207657_10003256 | Ga0207657_100032564 | 163 |
| 336 | 3300025920 | Ga0207649_10000637 | Ga0207649_100006376 | 163 |
| 337 | 3300025924 | Ga0207694_10925402 | Ga0207694_109254021 | 163 |
| 338 | 3300025981 | Ga0207640_10084425 | Ga0207640_100844251 | 163 |
| 339 | 3300026041 | Ga0207639_10613772 | Ga0207639_106137721 | 163 |
| 340 | 3300026067 | Ga0207678_10025448 | Ga0207678_100254484 | 163 |
| 341 | 3300026078 | Ga0207702_10478693 | Ga0207702_104786932 | 163 |
| 342 | 3300026078 | Ga0207702_10636462 | Ga0207702_106364622 | 163 |
| 343 | 3300026142 | Ga0207698_10463126 | Ga0207698_104631262 | 163 |
| 344 | 3300037312 | Ga0395899_0107454 | Ga0395899_0107454_185_715 | 163 |
| 345 | 3300037418 | Ga0395900_0241566 | Ga0395900_0241566_973_1503 | 163 |
| 346 | 3300037466 | Ga0395898_0126964 | Ga0395898_0126964_887_1417 | 163 |
| 347 | 3300037471 | Ga0395905_0302769 | Ga0395905_0302769_852_1382 | 163 |
| 348 | 3300005336 | Ga0070680_100004440 | Ga0070680_1000044409 | 166 |
| 349 | 3300005458 | Ga0070681_10115179 | Ga0070681_101151794 | 166 |
| 350 | 3300005530 | Ga0070679_100047356 | Ga0070679_1000473564 | 166 |
| 351 | 3300013100 | Ga0157373_10020213 | Ga0157373_100202135 | 166 |
| 352 | 3300025909 | Ga0207705_10044575 | Ga0207705_100445754 | 166 |
| 353 | 3300025919 | Ga0207657_10001033 | Ga0207657_1000103337 | 166 |
| 354 | 3300025921 | Ga0207652_10994964 | Ga0207652_109949641 | 166 |
| 355 | 3300005366 | Ga0070659_100113760 | Ga0070659_1001137602 | 169 |
| 356 | 3300025924 | Ga0207694_10153919 | Ga0207694_101539192 | 169 |
| 357 | 3300026142 | Ga0207698_10088293 | Ga0207698_100882931 | 169 |
| 358 | 3300005344 | Ga0070661_100337149 | Ga0070661_1003371492 | 174 |
| 359 | 3300009551 | Ga0105238_10198520 | Ga0105238_101985202 | 174 |
| 360 | 3300037418 | Ga0395900_0055081 | Ga0395900_0055081_267_800 | 174 |
| 361 | 3300037418 | Ga0395900_0186039 | Ga0395900_0186039_1397_1930 | 174 |
| 362 | 3300037466 | Ga0395898_0094647 | Ga0395898_0094647_2282_2815 | 174 |
| 363 | 3300037466 | Ga0395898_0294497 | Ga0395898_0294497_325_858 | 174 |
| 364 | 3300037471 | Ga0395905_0003989 | Ga0395905_0003989_4088_4618 | 174 |
| 365 | 3300038443 | Ga0395901_0028526 | Ga0395901_0028526_852_1385 | 174 |
| 366 | 3300038443 | Ga0395901_0075024 | Ga0395901_0075024_2062_2592 | 174 |
| 367 | 3300038443 | Ga0395901_0106797 | Ga0395901_0106797_858_1391 | 174 |
| 368 | 3300001915 | JGI24741J21665_1001147 | JGI24741J21665_10011473 | 175 |
| 369 | 3300001979 | JGI24740J21852_10025929 | JGI24740J21852_100259292 | 175 |
| 370 | 3300002067 | JGI24735J21928_10008416 | JGI24735J21928_100084162 | 175 |
| 371 | 3300005336 | Ga0070680_100720553 | Ga0070680_1007205531 | 175 |
| 372 | 3300005337 | Ga0070682_100020131 | Ga0070682_1000201312 | 175 |
| 373 | 3300005344 | Ga0070661_100021082 | Ga0070661_1000210824 | 175 |
| 374 | 3300005345 | Ga0070692_10487099 | Ga0070692_104870992 | 175 |
| 375 | 3300005455 | Ga0070663_100016621 | Ga0070663_1000166214 | 175 |
| 376 | 3300005535 | Ga0070684_100097370 | Ga0070684_1000973701 | 175 |
| 377 | 3300005563 | Ga0068855_100044199 | Ga0068855_1000441994 | 175 |
| 378 | 3300005564 | Ga0070664_100067429 | Ga0070664_1000674291 | 175 |
| 379 | 3300005578 | Ga0068854_100015325 | Ga0068854_1000153254 | 175 |
| 380 | 3300013102 | Ga0157371_10200421 | Ga0157371_102004211 | 175 |
| 381 | 3300013307 | Ga0157372_10042440 | Ga0157372_100424405 | 175 |
| 382 | 3300025909 | Ga0207705_10008706 | Ga0207705_100087066 | 175 |
| 383 | 3300025912 | Ga0207707_10032900 | Ga0207707_100329003 | 175 |
| 384 | 3300025917 | Ga0207660_10002945 | Ga0207660_100029458 | 175 |
| 385 | 3300025919 | Ga0207657_10073310 | Ga0207657_100733102 | 175 |
| 386 | 3300025920 | Ga0207649_10013479 | Ga0207649_100134795 | 175 |
| 387 | 3300025921 | Ga0207652_10005462 | Ga0207652_100054627 | 175 |
| 388 | 3300025933 | Ga0207706_10019691 | Ga0207706_100196913 | 175 |
| 389 | 3300025945 | Ga0207679_10059162 | Ga0207679_100591623 | 175 |
| 390 | 3300025949 | Ga0207667_10130525 | Ga0207667_101305252 | 175 |
| 391 | 3300026067 | Ga0207678_10025197 | Ga0207678_100251975 | 175 |
| 392 | 3300026116 | Ga0207674_10005540 | Ga0207674_1000554012 | 175 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar