F432091

General Info

Members Datasets Scaffolds Average Seq Length
391 244 782 207

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0021470|Ga0395905_0021470_3716_4483
Length 255
Sequence MRHLDRTALIIAKFKRLGLPQREPAHYMAGVVFSGGGDIMDIITPSAANIGLFVSAALVLLLIPGPAVLYLVGRSVEQGRLAGLYSILGIHTATLVHVAAASLGLSAILASSAVAFSIVKYAGAAYLIWLGLRKIFGRGANGEVEVTTSGHSHRRVFRDGFIVNLLNPKTALFFLAFLPQFVDLSRGHVAVQIAFLGTLFTAIGLLTDGCYAFAAGTAGGWLKRNKGYLRFERYISGVTFIGLGLTAAFAGNHRK

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
161 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
162 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
163 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
222 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
232 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
233 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
234 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
235 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
237 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
238 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
242 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
243 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
244 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0.26
Isolates 0.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11
Nodule 0
Rhizoplane 2.56
Rhizosphere 85.17
Stem 0
Stem Tuber 0
Unclassified 1.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0021470 3300037471 Bacteria 6104
2 JGI25406J46586_10026091 3300003203 Bacteria 2259
3 Ga0055529_1005647 3300003763 Bacteria 1792
4 JGI25405J52794_10045722 3300003911 Bacteria 932
5 Ga0065712_10091919 3300005290 Bacteria 2332
6 Ga0065712_10208646 3300005290 Bacteria 1062
7 Ga0070658_10139725 3300005327 Bacteria 2023
8 Ga0070658_10993943 3300005327 Bacteria 730
9 Ga0070676_10075537 3300005328 Bacteria 2032
10 Ga0070683_100016091 3300005329 Bacteria 6583
11 Ga0070683_100559964 3300005329 Bacteria 1093
12 Ga0070690_100021912 3300005330 Bacteria 3905
13 Ga0070670_100007682 3300005331 Bacteria 9165
14 Ga0070670_100075829 3300005331 Bacteria 2889
15 Ga0070677_10152492 3300005333 Bacteria 1077
16 Ga0068869_100054950 3300005334 Bacteria 2901
17 Ga0070666_10088016 3300005335 Bacteria 2130
18 Ga0070682_100455152 3300005337 Bacteria 981
19 Ga0070689_100105638 3300005340 Bacteria 2233
20 Ga0070691_10269496 3300005341 Bacteria 920
21 Ga0070661_100210071 3300005344 Bacteria 1490
22 Ga0070661_100273108 3300005344 Bacteria 1310
23 Ga0070668_100007206 3300005347 Bacteria 8247
24 Ga0070669_100011992 3300005353 Bacteria 6151
25 Ga0070669_100263805 3300005353 Bacteria 1375
26 Ga0070675_100010798 3300005354 Bacteria 7142
27 Ga0070673_100012531 3300005364 Bacteria 5825
28 Ga0070688_100096239 3300005365 Bacteria 1944
29 Ga0070659_100164166 3300005366 Bacteria 1817
30 Ga0070709_10472261 3300005434 Bacteria 948
31 Ga0070714_100176800 3300005435 Bacteria 1940
32 Ga0070714_101166771 3300005435 Bacteria 751
33 Ga0070713_100120362 3300005436 Bacteria 2301
34 Ga0070710_10697836 3300005437 Bacteria 716
35 Ga0070701_10043276 3300005438 Bacteria 2303
36 Ga0070700_100835593 3300005441 Bacteria 745
37 Ga0070694_100038064 3300005444 Bacteria 3194
38 Ga0070708_100930391 3300005445 Bacteria 816
39 Ga0070662_100040124 3300005457 Bacteria 3332
40 Ga0070681_10055103 3300005458 Bacteria 3960
41 Ga0070681_10220668 3300005458 Bacteria 1811
42 Ga0068867_100076705 3300005459 Bacteria 2510
43 Ga0068867_100118106 3300005459 Bacteria 2046
44 Ga0070685_10031008 3300005466 Bacteria 2983
45 Ga0070706_100189148 3300005467 Bacteria 1924
46 Ga0070679_100082947 3300005530 Bacteria 3195
47 Ga0070684_100017972 3300005535 Bacteria 5813
48 Ga0070684_100053821 3300005535 Bacteria 3505
49 Ga0070684_100116166 3300005535 Bacteria 2403
50 Ga0070697_100019776 3300005536 Bacteria 5319
51 Ga0070672_100055840 3300005543 Bacteria 3095
52 Ga0070686_100123567 3300005544 Bacteria 1780
53 Ga0070665_100108632 3300005548 Bacteria 2776
54 Ga0070665_100310670 3300005548 Bacteria 1580
55 Ga0070704_100455770 3300005549 Bacteria 1102
56 Ga0070664_100005964 3300005564 Bacteria 9847
57 Ga0068857_100014244 3300005577 Bacteria 6927
58 Ga0068857_100064326 3300005577 Bacteria 3261
59 Ga0068857_100179300 3300005577 Bacteria 1928
60 Ga0068857_100213198 3300005577 Bacteria 1762
61 Ga0070702_100005880 3300005615 Bacteria 5758
62 Ga0068859_100057720 3300005617 Bacteria 3909
63 Ga0068859_100202375 3300005617 Bacteria 2070
64 Ga0068864_100007518 3300005618 Bacteria 8975
65 Ga0068866_10184796 3300005718 Bacteria 1234
66 Ga0068861_100000653 3300005719 Bacteria 20575
67 Ga0068861_100002604 3300005719 Bacteria 11806
68 Ga0068861_100078078 3300005719 Bacteria 2584
69 Ga0068870_10043379 3300005840 Bacteria 2346
70 Ga0068870_10091462 3300005840 Bacteria 1702
71 Ga0068858_100283250 3300005842 Bacteria 1578
72 Ga0068860_100215339 3300005843 Bacteria 1864
73 Ga0068862_100005245 3300005844 Bacteria 10867
74 Ga0068862_100006391 3300005844 Bacteria 9798
75 Ga0068862_100339110 3300005844 Bacteria 1392
76 Ga0081455_10000710 3300005937 Bacteria 43255
77 Ga0081455_10001070 3300005937 Bacteria 34466
78 Ga0081540_1011528 3300005983 Bacteria 5905
79 Ga0081539_10003935 3300005985 Bacteria 17233
80 Ga0081539_10013534 3300005985 Bacteria 6138
81 Ga0081539_10096400 3300005985 Bacteria 1517
82 Ga0070717_10010838 3300006028 Bacteria 6899
83 Ga0070717_10727581 3300006028 Bacteria 902
84 Ga0075365_10266942 3300006038 Bacteria 1204
85 Ga0075368_10012580 3300006042 Bacteria 3096
86 Ga0075368_10012742 3300006042 Bacteria 3079
87 Ga0075363_100004655 3300006048 Bacteria 6034
88 Ga0075363_100082102 3300006048 Bacteria 1764
89 Ga0075363_100150772 3300006048 Bacteria 1312
90 Ga0075364_10154645 3300006051 Bacteria 1547
91 Ga0070716_100699621 3300006173 Bacteria 774
92 Ga0075362_10172296 3300006177 Bacteria 1046
93 Ga0075367_10002921 3300006178 Bacteria 7970
94 Ga0075367_10008807 3300006178 Bacteria 5248
95 Ga0075367_10090660 3300006178 Bacteria 1859
96 Ga0075367_10231985 3300006178 Bacteria 1156
97 Ga0075369_10007590 3300006186 Bacteria 4142
98 Ga0075369_10062426 3300006186 Bacteria 1628
99 Ga0075370_10103493 3300006353 Bacteria 1649
100 Ga0075370_10291543 3300006353 Bacteria 970
101 Ga0068871_100035790 3300006358 Bacteria 3948
102 Ga0075428_100001926 3300006844 Bacteria 22264
103 Ga0075430_100263569 3300006846 Bacteria 1427
104 Ga0075431_100088929 3300006847 Bacteria 3188
105 Ga0075431_100146360 3300006847 Bacteria 2435
106 Ga0075433_10009664 3300006852 Bacteria 7719
107 Ga0075434_100188236 3300006871 Bacteria 2084
108 Ga0068865_100262905 3300006881 Bacteria 1367
109 Ga0075436_100002412 3300006914 Bacteria 12895
110 Ga0097620_100057719 3300006931 Bacteria 3909
111 Ga0097620_100202378 3300006931 Bacteria 2070
112 Ga0075435_100180084 3300007076 Unclassified 1786
113 Ga0075435_100263302 3300007076 Bacteria 1469
114 Ga0099794_10023189 3300007265 Bacteria 2836
115 Ga0105250_10160936 3300009092 Bacteria 937
116 Ga0111539_10041345 3300009094 Bacteria 5543
117 Ga0111539_10974239 3300009094 Bacteria 986
118 Ga0111539_11020101 3300009094 Bacteria 962
119 Ga0105245_10382078 3300009098 Bacteria 1403
120 Ga0114129_10001383 3300009147 Bacteria 32649
121 Ga0105242_10666631 3300009176 Bacteria 1014
122 Ga0105248_10031677 3300009177 Bacteria 5907
123 Ga0105237_10527023 3300009545 Bacteria 1188
124 Ga0105238_11112622 3300009551 Bacteria 813
125 Ga0105249_10008895 3300009553 Bacteria 8771
126 Ga0105249_10016221 3300009553 Bacteria 6606
127 Ga0105035_103223 3300009988 Bacteria 1244
128 Ga0105239_10225552 3300010375 Bacteria 2102
129 Ga0105239_10428508 3300010375 Bacteria 1499
130 Ga0105246_10279251 3300011119 Bacteria 1339
131 Ga0157378_10164739 3300013297 Bacteria 2076
132 Ga0157378_10166586 3300013297 Bacteria 2064
133 Ga0163162_10010239 3300013306 Bacteria 9109
134 Ga0157372_10557569 3300013307 Bacteria 1336
135 Ga0157372_11045234 3300013307 Bacteria 945
136 Ga0157375_10051877 3300013308 Bacteria 4030
137 Ga0157515_114679 3300013875 Bacteria 743
138 Ga0163163_10276525 3300014325 Bacteria 1730
139 Ga0157380_10230820 3300014326 Bacteria 1662
140 Ga0182008_10001010 3300014497 Bacteria 19546
141 Ga0182008_10063258 3300014497 Bacteria 1823
142 Ga0157377_10085514 3300014745 Bacteria 1852
143 Ga0157379_10667343 3300014968 Bacteria 974
144 Ga0182006_1025762 3300015261 Bacteria 2413
145 Ga0182007_10011692 3300015262 Bacteria 3409
146 Ga0163161_10056863 3300017792 Bacteria 2842
147 Ga0206353_10911557 3300020082 Bacteria 8669
148 Ga0213874_10133478 3300021377 Bacteria 854
149 Ga0209148_1001594 3300025254 Bacteria 10675
150 Ga0209455_1005720 3300025272 Bacteria 3787
151 Ga0207688_10018757 3300025901 Bacteria 3762
152 Ga0207688_10275159 3300025901 Bacteria 1025
153 Ga0207680_10222918 3300025903 Bacteria 1293
154 Ga0207645_10033891 3300025907 Bacteria 3282
155 Ga0207643_10050800 3300025908 Bacteria 2352
156 Ga0207643_10081553 3300025908 Bacteria 1875
157 Ga0207705_10216169 3300025909 Bacteria 1455
158 Ga0207684_10057418 3300025910 Bacteria 3303
159 Ga0207707_10047509 3300025912 Bacteria 3738
160 Ga0207707_10208884 3300025912 Bacteria 1701
161 Ga0207662_10058690 3300025918 Bacteria 2304
162 Ga0207649_10259932 3300025920 Bacteria 1254
163 Ga0207650_10114694 3300025925 Bacteria 2090
164 Ga0207659_10006093 3300025926 Bacteria 7365
165 Ga0207659_10122509 3300025926 Bacteria 1995
166 Ga0207687_10271830 3300025927 Bacteria 1355
167 Ga0207700_10390560 3300025928 Bacteria 1218
168 Ga0207664_10098976 3300025929 Bacteria 2405
169 Ga0207664_10223345 3300025929 Bacteria 1635
170 Ga0207664_10457187 3300025929 Bacteria 1140
171 Ga0207690_10091513 3300025932 Bacteria 2150
172 Ga0207706_10016703 3300025933 Bacteria 6624
173 Ga0207670_10153884 3300025936 Bacteria 1709
174 Ga0207670_10760392 3300025936 Bacteria 805
175 Ga0207669_10584030 3300025937 Bacteria 906
176 Ga0207704_10047257 3300025938 Bacteria 2571
177 Ga0207704_10119335 3300025938 Bacteria 1801
178 Ga0207665_10139492 3300025939 Bacteria 1727
179 Ga0207691_10098791 3300025940 Bacteria 2607
180 Ga0207689_10064141 3300025942 Bacteria 3023
181 Ga0207661_10040634 3300025944 Bacteria 3657
182 Ga0207679_10024597 3300025945 Bacteria 4130
183 Ga0207712_10031485 3300025961 Bacteria 3574
184 Ga0207668_10014564 3300025972 Bacteria 4868
185 Ga0207658_11034928 3300025986 Bacteria 749
186 Ga0207703_10304255 3300026035 Bacteria 1455
187 Ga0207708_10080308 3300026075 Bacteria 2506
188 Ga0207708_10165796 3300026075 Bacteria 1747
189 Ga0207641_10159560 3300026088 Bacteria 2049
190 Ga0207641_11333602 3300026088 Bacteria 718
191 Ga0207648_10009377 3300026089 Bacteria 9376
192 Ga0207648_10101580 3300026089 Bacteria 2520
193 Ga0207648_10793496 3300026089 Bacteria 881
194 Ga0207676_11089261 3300026095 Bacteria 789
195 Ga0207676_11351281 3300026095 Bacteria 708
196 Ga0207674_10052000 3300026116 Bacteria 4178
197 Ga0207674_10110523 3300026116 Bacteria 2724
198 Ga0207675_100001666 3300026118 Bacteria 22229
199 Ga0207675_100039071 3300026118 Bacteria 4429
200 Ga0207675_100098337 3300026118 Bacteria 2756
201 Ga0207675_100540403 3300026118 Bacteria 1164
202 Ga0209813_10001793 3300027866 Bacteria 4836
203 Ga0207428_10107325 3300027907 Bacteria 2151
204 Ga0268266_10097500 3300028379 Bacteria 2585
205 Ga0268266_10123467 3300028379 Bacteria 2307
206 Ga0268266_10189703 3300028379 Bacteria 1876
207 Ga0268265_10001743 3300028380 Bacteria 17499
208 Ga0268265_10052167 3300028380 Bacteria 3091
209 Ga0268264_10122248 3300028381 Bacteria 2296
210 Ga0307408_100046737 3300031548 Bacteria 3097
211 Ga0307406_10148191 3300031901 Bacteria 1671
212 Ga0307406_10590894 3300031901 Bacteria 914
213 Ga0307412_10506872 3300031911 Bacteria 1006
214 Ga0373928_0035184 3300035084 Unclassified 1127
215 Ga0373936_0136757 3300035113 Bacteria 1056
216 Ga0373943_0230039 3300035170 Bacteria 1035
217 Ga0373925_0277897 3300037068 Bacteria 1348
218 Ga0395899_0000124 3300037312 Bacteria 122011
219 Ga0395900_0000086 3300037418 Bacteria 171749
220 Ga0395900_0092736 3300037418 Bacteria 3103
221 Ga0395900_0154821 3300037418 Bacteria 2341
222 Ga0395900_0281160 3300037418 Bacteria 1656
223 Ga0395898_0000285 3300037466 Bacteria 122279
224 Ga0395898_0123987 3300037466 Bacteria 2475
225 Ga0395898_0173358 3300037466 Bacteria 2062
226 Ga0395898_0217637 3300037466 Bacteria 1822
227 Ga0395905_0000133 3300037471 Bacteria 123500
228 Ga0395905_0001394 3300037471 Bacteria 29273
229 Ga0395905_0005250 3300037471 Bacteria 13256
230 Ga0395905_0075133 3300037471 Bacteria 3167
231 Ga0436364_1039162 3300037853 Bacteria 1080
232 Ga0395901_0000092 3300038443 Bacteria 121976
233 Ga0395901_0001686 3300038443 Bacteria 22797
234 Ga0395901_0059468 3300038443 Bacteria 3976
235 Ga0395901_0308062 3300038443 Bacteria 1641
236 Ga0395901_0392017 3300038443 Bacteria 1428
237 Ga0395901_1122232 3300038443 Bacteria 756
238 Ga0436363_1695094 3300039450 Bacteria 2696
239 Ga0439448_0005664 3300042005 Bacteria 3565
240 Ga0450920_014631 3300042122 Bacteria 1487
241 Ga0450907_011587 3300042146 Bacteria 1464
242 Ga0439458_0087351 3300042157 Bacteria 800
243 Ga0451577_0461044 3300042876 Unclassified 1154
244 Ga0466969_0160307 3300044656 Bacteria 1034
245 Ga0466966_0020708 3300044684 Bacteria 4322
246 Ga0466966_0034435 3300044684 Bacteria 3274
247 Ga0466966_0368949 3300044684 Bacteria 862
248 Ga0466961_0240527 3300044693 Bacteria 1113
249 Ga0466963_0001624 3300044694 Bacteria 12234
250 Ga0466963_0021949 3300044694 Bacteria 4035
251 Ga0466963_0050413 3300044694 Bacteria 2755
252 Ga0466963_0092552 3300044694 Bacteria 2060
253 Ga0466963_0304225 3300044694 Bacteria 1122
254 Ga0466963_0470435 3300044694 Bacteria 887
255 Ga0466963_0732510 3300044694 Bacteria 697
256 Ga0466957_0108272 3300044842 Bacteria 1760
257 Ga0466957_0501411 3300044842 Bacteria 842
258 Ga0466960_0448525 3300044901 Bacteria 750
259 Ga0466959_0010766 3300045049 Bacteria 6553
260 Ga0466959_0044298 3300045049 Bacteria 3279
261 Ga0466959_0139437 3300045049 Bacteria 1715
262 Ga0466959_0244717 3300045049 Bacteria 1238
263 Ga0466959_0252762 3300045049 Bacteria 1215
264 Ga0451576_0072489 3300045051 Bacteria 3584
265 Ga0451576_0133167 3300045051 Bacteria 2591
266 Ga0466958_0016899 3300045836 Bacteria 4210
267 Ga0466958_0042493 3300045836 Bacteria 2737
268 Ga0466958_0167008 3300045836 Bacteria 1392
269 Ga0466958_0222226 3300045836 Bacteria 1205
270 Ga0466967_0001444 3300045976 Bacteria 13785
271 Ga0466967_0016115 3300045976 Bacteria 5882
272 Ga0466967_0022763 3300045976 Bacteria 5122
273 Ga0466967_0082628 3300045976 Bacteria 2903
274 Ga0466967_0091887 3300045976 Bacteria 2759
275 Ga0466967_0448774 3300045976 Bacteria 1260
276 Ga0466967_0589745 3300045976 Bacteria 1096
277 Ga0495582_0002512 3300046473 Bacteria 10215
278 Ga0495586_0023867 3300046535 Bacteria 3266
279 Ga0495581_0199685 3300047315 Bacteria 1170
280 Ga0496101_0292646 3300048904 Bacteria 1274
281 Ga0496102_0521585 3300048905 Bacteria 1111
282 Ga0496103_0083502 3300048906 Bacteria 2011
283 Ga0496108_0152705 3300048911 Bacteria 1993
284 Ga0496109_0009402 3300048912 Bacteria 8330
285 Ga0496109_0268902 3300048912 Bacteria 1606
286 Ga0496110_0147511 3300048913 Bacteria 2129
287 Ga0496112_0358699 3300048915 Bacteria 1400
288 Ga0496113_0124941 3300048916 Bacteria 2014
289 Ga0496114_0533032 3300048917 Bacteria 1038
290 Ga0501031_0036683 3300049568 Bacteria 3198
291 Ga0501033_0004172 3300049570 Bacteria 11633
292 Ga0501033_0146666 3300049570 Bacteria 1704
293 Ga0501034_0040796 3300049571 Bacteria 4696
294 Ga0501034_0542666 3300049571 Bacteria 1073
295 Ga0501036_0080327 3300049572 Bacteria 2757
296 Ga0501036_0592359 3300049572 Bacteria 920
297 Ga0501038_0079785 3300049574 Bacteria 2759
298 Ga0501038_0298844 3300049574 Bacteria 1264
299 Ga0501039_0024816 3300049575 Bacteria 4605
300 Ga0501039_0246765 3300049575 Bacteria 1404
301 Ga0501040_0448483 3300049576 Bacteria 929
302 Ga0501041_0008651 3300049577 Bacteria 5997
303 Ga0501041_0210798 3300049577 Bacteria 1218
304 Ga0501042_0093485 3300049578 Bacteria 2159
305 Ga0501042_0497509 3300049578 Bacteria 885
306 Ga0501043_0041968 3300049579 Bacteria 3594
307 Ga0501043_0370342 3300049579 Bacteria 1086
308 Ga0501043_0510479 3300049579 Bacteria 897
309 Ga0501046_0534305 3300049580 Bacteria 837
310 Ga0501048_0021914 3300049582 Bacteria 4676
311 Ga0501048_0167268 3300049582 Bacteria 1557
312 Ga0501067_0007883 3300049583 Bacteria 5918
313 Ga0501068_0474879 3300049584 Bacteria 810
314 Ga0501070_0004833 3300049586 Bacteria 11512
315 Ga0501070_0027808 3300049586 Bacteria 4743
316 Ga0501070_0243129 3300049586 Bacteria 1473
317 Ga0501071_0199523 3300049587 Bacteria 1502
318 Ga0501071_0253576 3300049587 Bacteria 1328
319 Ga0501072_0001940 3300049588 Bacteria 15418
320 Ga0501072_0011652 3300049588 Bacteria 6716
321 Ga0501072_0183236 3300049588 Bacteria 1670
322 Ga0501073_0010788 3300049589 Bacteria 6691
323 Ga0501073_0021828 3300049589 Bacteria 4612
324 Ga0501074_0066151 3300049590 Bacteria 2600
325 Ga0501074_0092337 3300049590 Bacteria 2168
326 Ga0501074_0107578 3300049590 Bacteria 1996
327 Ga0501074_0145153 3300049590 Bacteria 1697
328 Ga0501075_0012564 3300049591 Bacteria 6023
329 Ga0501075_0564618 3300049591 Bacteria 868
330 Ga0501076_0008016 3300049592 Bacteria 7716
331 Ga0501076_0177003 3300049592 Bacteria 1738
332 Ga0501077_0065874 3300049593 Bacteria 2298
333 Ga0501079_0015142 3300049741 Bacteria 5881
334 Ga0501079_0111779 3300049741 Bacteria 2123
335 Ga0501079_0326418 3300049741 Bacteria 1201
336 Ga0501079_0724776 3300049741 Bacteria 783
337 Ga0501080_0000499 3300049742 Bacteria 30720
338 Ga0501080_0117012 3300049742 Bacteria 2470
339 Ga0501080_0186668 3300049742 Bacteria 1906
340 Ga0501081_0033157 3300049743 Bacteria 3507
341 Ga0501083_0039779 3300049744 Bacteria 3193
342 Ga0501083_0155616 3300049744 Bacteria 1496
343 Ga0501035_0009486 3300049822 Bacteria 9049
344 Ga0501044_0014905 3300049823 Bacteria 8380
345 Ga0501045_0019225 3300049824 Bacteria 4867
346 nmdc:mga03n38_17719_c1 3300050490 Bacteria 2795
347 nmdc:mga03n38_306345_c1 3300050490 Bacteria 854
348 nmdc:mga03n38_47063_c1 3300050490 Bacteria 1907
349 nmdc:mga03n38_69798_c1 3300050490 Bacteria 1623
350 nmdc:mga00v17_164389_c1 3300050491 Bacteria 1430
351 nmdc:mga00v17_33896_c1 3300050491 Bacteria 3029
352 nmdc:mga0yw44_500591_c1 3300050492 Bacteria 824
353 nmdc:mga0k408_261202_c1 3300050493 Bacteria 1034
354 nmdc:mga06z11_1138_c1 3300050494 Bacteria 9700
355 nmdc:mga06z11_1950_c2 3300050494 Bacteria 5703
356 nmdc:mga06z11_8737_c1 3300050494 Bacteria 4242
357 nmdc:mga06z11_98204_c1 3300050494 Bacteria 1602
358 nmdc:mga04h51_2079_c1 3300050495 Bacteria 4697
359 nmdc:mga04h51_5851_c1 3300050495 Bacteria 3153
360 nmdc:mga07m45_87955_c1 3300050496 Bacteria 1778
361 nmdc:mga05p37_47802_c1 3300050507 Bacteria 5261
362 nmdc:mga05p37_5416_c1 3300050507 Bacteria 14996
363 nmdc:mga0qj67_233198_c1 3300050509 Bacteria 1493
364 nmdc:mga06r32_169168_c1 3300050510 Bacteria 2169
365 nmdc:mga08y16_205655_c1 3300050511 Bacteria 2040
366 nmdc:mga08y16_265421_c1 3300050511 Bacteria 1772
367 nmdc:mga0n895_175806_c1 3300050512 Bacteria 2172
368 nmdc:mga0n895_422108_c1 3300050512 Bacteria 1348
369 nmdc:mga0rr50_116350_c1 3300050513 Bacteria 2123
370 nmdc:mga0rr50_498709_c1 3300050513 Unclassified 1035
371 nmdc:mga08x19_173413_c1 3300050514 Bacteria 1470
372 nmdc:mga0a205_55586_c1 3300050515 Bacteria 3823
373 nmdc:mga0sz30_114_c1 3300050516 Bacteria 30491
374 Ga0500651_0064100 3300053093 Bacteria 2292
375 Ga0500555_029828 3300053103 Bacteria 1550
376 Ga0500642_0159684 3300053130 Bacteria 1057
377 Ga0500568_0000212 3300053139 Bacteria 50122
378 Ga0500616_0084882 3300053153 Bacteria 1583
379 Ga0500627_0068814 3300053158 Bacteria 1565
380 Ga0500611_125713 3300053727 Bacteria 687
381 Ga0501084_0519540 3300054114 Bacteria 1006
382 Ga0501084_0664759 3300054114 Bacteria 879
383 Ga0501082_0077205 3300060353 Bacteria 2872
384 Ga0501082_0359186 3300060353 Bacteria 1270
385 Ga0530510_0033291 3300061734 Bacteria 3711
386 Ga0530510_0126809 3300061734 Bacteria 1876
387 Ga0530510_0232404 3300061734 Bacteria 1372
388 Ga0530510_0418560 3300061734 Bacteria 1011
389 2834645481 2834641062 Bacteria 5559922
390 2857538275 2857537821 Bacteria 5248181
391 8003400696 8003400568 Bacteria 5535898
392 Ga0395905_0021470
393 JGI25406J46586_10026091
394 Ga0055529_1005647
395 JGI25405J52794_10045722
396 Ga0065712_10091919
397 Ga0065712_10208646
398 Ga0070658_10139725
399 Ga0070658_10993943
400 Ga0070676_10075537
401 Ga0070683_100016091
402 Ga0070683_100559964
403 Ga0070690_100021912
404 Ga0070670_100007682
405 Ga0070670_100075829
406 Ga0070677_10152492
407 Ga0068869_100054950
408 Ga0070666_10088016
409 Ga0070682_100455152
410 Ga0070689_100105638
411 Ga0070691_10269496
412 Ga0070661_100210071
413 Ga0070661_100273108
414 Ga0070668_100007206
415 Ga0070669_100011992
416 Ga0070669_100263805
417 Ga0070675_100010798
418 Ga0070673_100012531
419 Ga0070688_100096239
420 Ga0070659_100164166
421 Ga0070709_10472261
422 Ga0070714_100176800
423 Ga0070714_101166771
424 Ga0070713_100120362
425 Ga0070710_10697836
426 Ga0070701_10043276
427 Ga0070700_100835593
428 Ga0070694_100038064
429 Ga0070708_100930391
430 Ga0070662_100040124
431 Ga0070681_10055103
432 Ga0070681_10220668
433 Ga0068867_100076705
434 Ga0068867_100118106
435 Ga0070685_10031008
436 Ga0070706_100189148
437 Ga0070679_100082947
438 Ga0070684_100017972
439 Ga0070684_100053821
440 Ga0070684_100116166
441 Ga0070697_100019776
442 Ga0070672_100055840
443 Ga0070686_100123567
444 Ga0070665_100108632
445 Ga0070665_100310670
446 Ga0070704_100455770
447 Ga0070664_100005964
448 Ga0068857_100014244
449 Ga0068857_100064326
450 Ga0068857_100179300
451 Ga0068857_100213198
452 Ga0070702_100005880
453 Ga0068859_100057720
454 Ga0068859_100202375
455 Ga0068864_100007518
456 Ga0068866_10184796
457 Ga0068861_100000653
458 Ga0068861_100002604
459 Ga0068861_100078078
460 Ga0068870_10043379
461 Ga0068870_10091462
462 Ga0068858_100283250
463 Ga0068860_100215339
464 Ga0068862_100005245
465 Ga0068862_100006391
466 Ga0068862_100339110
467 Ga0081455_10000710
468 Ga0081455_10001070
469 Ga0081540_1011528
470 Ga0081539_10003935
471 Ga0081539_10013534
472 Ga0081539_10096400
473 Ga0070717_10010838
474 Ga0070717_10727581
475 Ga0075365_10266942
476 Ga0075368_10012580
477 Ga0075368_10012742
478 Ga0075363_100004655
479 Ga0075363_100082102
480 Ga0075363_100150772
481 Ga0075364_10154645
482 Ga0070716_100699621
483 Ga0075362_10172296
484 Ga0075367_10002921
485 Ga0075367_10008807
486 Ga0075367_10090660
487 Ga0075367_10231985
488 Ga0075369_10007590
489 Ga0075369_10062426
490 Ga0075370_10103493
491 Ga0075370_10291543
492 Ga0068871_100035790
493 Ga0075428_100001926
494 Ga0075430_100263569
495 Ga0075431_100088929
496 Ga0075431_100146360
497 Ga0075433_10009664
498 Ga0075434_100188236
499 Ga0068865_100262905
500 Ga0075436_100002412
501 Ga0097620_100057719
502 Ga0097620_100202378
503 Ga0075435_100180084
504 Ga0075435_100263302
505 Ga0099794_10023189
506 Ga0105250_10160936
507 Ga0111539_10041345
508 Ga0111539_10974239
509 Ga0111539_11020101
510 Ga0105245_10382078
511 Ga0114129_10001383
512 Ga0105242_10666631
513 Ga0105248_10031677
514 Ga0105237_10527023
515 Ga0105238_11112622
516 Ga0105249_10008895
517 Ga0105249_10016221
518 Ga0105035_103223
519 Ga0105239_10225552
520 Ga0105239_10428508
521 Ga0105246_10279251
522 Ga0157378_10164739
523 Ga0157378_10166586
524 Ga0163162_10010239
525 Ga0157372_10557569
526 Ga0157372_11045234
527 Ga0157375_10051877
528 Ga0157515_114679
529 Ga0163163_10276525
530 Ga0157380_10230820
531 Ga0182008_10001010
532 Ga0182008_10063258
533 Ga0157377_10085514
534 Ga0157379_10667343
535 Ga0182006_1025762
536 Ga0182007_10011692
537 Ga0163161_10056863
538 Ga0206353_10911557
539 Ga0213874_10133478
540 Ga0209148_1001594
541 Ga0209455_1005720
542 Ga0207688_10018757
543 Ga0207688_10275159
544 Ga0207680_10222918
545 Ga0207645_10033891
546 Ga0207643_10050800
547 Ga0207643_10081553
548 Ga0207705_10216169
549 Ga0207684_10057418
550 Ga0207707_10047509
551 Ga0207707_10208884
552 Ga0207662_10058690
553 Ga0207649_10259932
554 Ga0207650_10114694
555 Ga0207659_10006093
556 Ga0207659_10122509
557 Ga0207687_10271830
558 Ga0207700_10390560
559 Ga0207664_10098976
560 Ga0207664_10223345
561 Ga0207664_10457187
562 Ga0207690_10091513
563 Ga0207706_10016703
564 Ga0207670_10153884
565 Ga0207670_10760392
566 Ga0207669_10584030
567 Ga0207704_10047257
568 Ga0207704_10119335
569 Ga0207665_10139492
570 Ga0207691_10098791
571 Ga0207689_10064141
572 Ga0207661_10040634
573 Ga0207679_10024597
574 Ga0207712_10031485
575 Ga0207668_10014564
576 Ga0207658_11034928
577 Ga0207703_10304255
578 Ga0207708_10080308
579 Ga0207708_10165796
580 Ga0207641_10159560
581 Ga0207641_11333602
582 Ga0207648_10009377
583 Ga0207648_10101580
584 Ga0207648_10793496
585 Ga0207676_11089261
586 Ga0207676_11351281
587 Ga0207674_10052000
588 Ga0207674_10110523
589 Ga0207675_100001666
590 Ga0207675_100039071
591 Ga0207675_100098337
592 Ga0207675_100540403
593 Ga0209813_10001793
594 Ga0207428_10107325
595 Ga0268266_10097500
596 Ga0268266_10123467
597 Ga0268266_10189703
598 Ga0268265_10001743
599 Ga0268265_10052167
600 Ga0268264_10122248
601 Ga0307408_100046737
602 Ga0307406_10148191
603 Ga0307406_10590894
604 Ga0307412_10506872
605 Ga0373928_0035184
606 Ga0373936_0136757
607 Ga0373943_0230039
608 Ga0373925_0277897
609 Ga0395899_0000124
610 Ga0395900_0000086
611 Ga0395900_0092736
612 Ga0395900_0154821
613 Ga0395900_0281160
614 Ga0395898_0000285
615 Ga0395898_0123987
616 Ga0395898_0173358
617 Ga0395898_0217637
618 Ga0395905_0000133
619 Ga0395905_0001394
620 Ga0395905_0005250
621 Ga0395905_0075133
622 Ga0436364_1039162
623 Ga0395901_0000092
624 Ga0395901_0001686
625 Ga0395901_0059468
626 Ga0395901_0308062
627 Ga0395901_0392017
628 Ga0395901_1122232
629 Ga0436363_1695094
630 Ga0439448_0005664
631 Ga0450920_014631
632 Ga0450907_011587
633 Ga0439458_0087351
634 Ga0451577_0461044
635 Ga0466969_0160307
636 Ga0466966_0020708
637 Ga0466966_0034435
638 Ga0466966_0368949
639 Ga0466961_0240527
640 Ga0466963_0001624
641 Ga0466963_0021949
642 Ga0466963_0050413
643 Ga0466963_0092552
644 Ga0466963_0304225
645 Ga0466963_0470435
646 Ga0466963_0732510
647 Ga0466957_0108272
648 Ga0466957_0501411
649 Ga0466960_0448525
650 Ga0466959_0010766
651 Ga0466959_0044298
652 Ga0466959_0139437
653 Ga0466959_0244717
654 Ga0466959_0252762
655 Ga0451576_0072489
656 Ga0451576_0133167
657 Ga0466958_0016899
658 Ga0466958_0042493
659 Ga0466958_0167008
660 Ga0466958_0222226
661 Ga0466967_0001444
662 Ga0466967_0016115
663 Ga0466967_0022763
664 Ga0466967_0082628
665 Ga0466967_0091887
666 Ga0466967_0448774
667 Ga0466967_0589745
668 Ga0495582_0002512
669 Ga0495586_0023867
670 Ga0495581_0199685
671 Ga0496101_0292646
672 Ga0496102_0521585
673 Ga0496103_0083502
674 Ga0496108_0152705
675 Ga0496109_0009402
676 Ga0496109_0268902
677 Ga0496110_0147511
678 Ga0496112_0358699
679 Ga0496113_0124941
680 Ga0496114_0533032
681 Ga0501031_0036683
682 Ga0501033_0004172
683 Ga0501033_0146666
684 Ga0501034_0040796
685 Ga0501034_0542666
686 Ga0501036_0080327
687 Ga0501036_0592359
688 Ga0501038_0079785
689 Ga0501038_0298844
690 Ga0501039_0024816
691 Ga0501039_0246765
692 Ga0501040_0448483
693 Ga0501041_0008651
694 Ga0501041_0210798
695 Ga0501042_0093485
696 Ga0501042_0497509
697 Ga0501043_0041968
698 Ga0501043_0370342
699 Ga0501043_0510479
700 Ga0501046_0534305
701 Ga0501048_0021914
702 Ga0501048_0167268
703 Ga0501067_0007883
704 Ga0501068_0474879
705 Ga0501070_0004833
706 Ga0501070_0027808
707 Ga0501070_0243129
708 Ga0501071_0199523
709 Ga0501071_0253576
710 Ga0501072_0001940
711 Ga0501072_0011652
712 Ga0501072_0183236
713 Ga0501073_0010788
714 Ga0501073_0021828
715 Ga0501074_0066151
716 Ga0501074_0092337
717 Ga0501074_0107578
718 Ga0501074_0145153
719 Ga0501075_0012564
720 Ga0501075_0564618
721 Ga0501076_0008016
722 Ga0501076_0177003
723 Ga0501077_0065874
724 Ga0501079_0015142
725 Ga0501079_0111779
726 Ga0501079_0326418
727 Ga0501079_0724776
728 Ga0501080_0000499
729 Ga0501080_0117012
730 Ga0501080_0186668
731 Ga0501081_0033157
732 Ga0501083_0039779
733 Ga0501083_0155616
734 Ga0501035_0009486
735 Ga0501044_0014905
736 Ga0501045_0019225
737 nmdc:mga03n38_17719_c1
738 nmdc:mga03n38_306345_c1
739 nmdc:mga03n38_47063_c1
740 nmdc:mga03n38_69798_c1
741 nmdc:mga00v17_164389_c1
742 nmdc:mga00v17_33896_c1
743 nmdc:mga0yw44_500591_c1
744 nmdc:mga0k408_261202_c1
745 nmdc:mga06z11_1138_c1
746 nmdc:mga06z11_1950_c2
747 nmdc:mga06z11_8737_c1
748 nmdc:mga06z11_98204_c1
749 nmdc:mga04h51_2079_c1
750 nmdc:mga04h51_5851_c1
751 nmdc:mga07m45_87955_c1
752 nmdc:mga05p37_47802_c1
753 nmdc:mga05p37_5416_c1
754 nmdc:mga0qj67_233198_c1
755 nmdc:mga06r32_169168_c1
756 nmdc:mga08y16_205655_c1
757 nmdc:mga08y16_265421_c1
758 nmdc:mga0n895_175806_c1
759 nmdc:mga0n895_422108_c1
760 nmdc:mga0rr50_116350_c1
761 nmdc:mga0rr50_498709_c1
762 nmdc:mga08x19_173413_c1
763 nmdc:mga0a205_55586_c1
764 nmdc:mga0sz30_114_c1
765 Ga0500651_0064100
766 Ga0500555_029828
767 Ga0500642_0159684
768 Ga0500568_0000212
769 Ga0500616_0084882
770 Ga0500627_0068814
771 Ga0500611_125713
772 Ga0501084_0519540
773 Ga0501084_0664759
774 Ga0501082_0077205
775 Ga0501082_0359186
776 Ga0530510_0033291
777 Ga0530510_0126809
778 Ga0530510_0232404
779 Ga0530510_0418560
780 2834645481
781 2857538275
782 8003400696

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

58

251

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ob6-assembly2.cif.gz_B human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.5012 10 212
6ob6-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.4752 10 212
7yuf-assembly1.cif.gz_R apo human spns2 0.4704 16 208
8thr-assembly1.cif.gz_A structure of the human vesicular monoamine transporter 2 (vmat2) bound to tetrabenazine in an occluded conformation 0.4678 10 216
8ex6-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1*) 0.4578 14 209
ID Description Score Start End Superfamily
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6485 7 212 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.621 7 212 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5862 8 212 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5838 8 212 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5682 41 208 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V8VTN2-F1-model_v4 RhtB family transporter 0.9476 6 216 GO:0005886
GO:0015171
AF-A0A2S8VT55-F1-model_v4 LysE family translocator 0.946 10 210 GO:0005886
GO:0015171
AF-A0A6C1B1M2-F1-model_v4 LysE family translocator 0.9451 5 212 GO:0005886
GO:0015171
AF-A0A7Y3YY78-F1-model_v4 deleted 0.9448 5 211
AF-A0A7K1BCG1-F1-model_v4 LysE family translocator 0.9438 12 211 GO:0005886
GO:0015171

Map