F432077

General Info

Members Datasets Scaffolds Average Seq Length
391 242 782 357

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0027691|Ga0373936_0027691_240_1592
Length 433
Sequence MREPRNRVVQVSHFGGPEGLEVVDAPLPTAGRGEVRVRVLASSLNYTDVLIRRHLYPQTASRRPPFVLGYDVVGEIDQVGDGVRDFQVGDLVADMTVVGSNAAYRTLRADDVTRVPAGVDAAEAATLILSWTTAYQLLHRAARVQRGQRVLVHGAAGAVGQAQLALGKLAGLELWGAARGEHTTLIRELGATPIDYQREDFARVLPGGFDVVFDGIGEDGYRRSFAALKRGGLLCAIGYSAGVQAQRSMLSILMWIARFVSLEWLPGGKRARFYSINVMRARHPAWFKEDLGRLLGLLASGAIRPRVAGRISFDEVAEAHRRLEAGGLEGKLVLCPELTSRGNRAVVSVGSYFSRAVADDEAGRPVRYTAARISGLRTCVDAALYRRGKDHRLRGHGAAPRRTLSRMPGIGMVHGGEGNGVRQNNPFDFRPAG

Samples

Sample ID Description Type Environment
1 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
96 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
97 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
109 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
110 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
111 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
124 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
135 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
155 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
171 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
234 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
235 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
236 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
237 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
238 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
239 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
242 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.86
Nodule 0.77
Rhizoplane 9.46
Rhizosphere 81.33
Stem 0
Stem Tuber 0
Unclassified 0.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373936_0027691 3300035113 Bacteria 2224
2 JGI25153J46596_10042973 3300003215 Bacteria 1374
3 Ga0070670_100014538 3300005331 Bacteria 6759
4 Ga0068869_100027791 3300005334 Bacteria 3947
5 Ga0068869_100401877 3300005334 Bacteria 1127
6 Ga0070680_100010012 3300005336 Bacteria 7304
7 Ga0068868_100266616 3300005338 Bacteria 1446
8 Ga0070671_100275765 3300005355 Bacteria 1430
9 Ga0070688_100053830 3300005365 Bacteria 2519
10 Ga0070659_100044389 3300005366 Bacteria 3480
11 Ga0070714_100011210 3300005435 Bacteria 7108
12 Ga0070714_100017471 3300005435 Bacteria 5811
13 Ga0070714_100026989 3300005435 Bacteria 4751
14 Ga0070714_100033173 3300005435 Bacteria 4315
15 Ga0070714_100145418 3300005435 Bacteria 2132
16 Ga0070714_100305274 3300005435 Bacteria 1484
17 Ga0070713_100004109 3300005436 Bacteria 9702
18 Ga0070713_100011759 3300005436 Bacteria 6391
19 Ga0070713_100087351 3300005436 Bacteria 2674
20 Ga0070713_100125760 3300005436 Bacteria 2255
21 Ga0070713_100344342 3300005436 Bacteria 1382
22 Ga0070710_10004864 3300005437 Bacteria 6353
23 Ga0070710_10006904 3300005437 Bacteria 5477
24 Ga0070711_100114220 3300005439 Bacteria 1987
25 Ga0070694_100003481 3300005444 Bacteria 9423
26 Ga0070708_100161598 3300005445 Bacteria 2087
27 Ga0070663_100040740 3300005455 Bacteria 3254
28 Ga0070663_100106606 3300005455 Bacteria 2099
29 Ga0068867_100039359 3300005459 Bacteria 3447
30 Ga0068867_100108134 3300005459 Bacteria 2132
31 Ga0070706_100025538 3300005467 Bacteria 5438
32 Ga0070698_100179162 3300005471 Bacteria 2058
33 Ga0070699_100150912 3300005518 Bacteria 2055
34 Ga0070699_100249188 3300005518 Bacteria 1586
35 Ga0070679_100011744 3300005530 Bacteria 8347
36 Ga0070684_100030279 3300005535 Bacteria 4597
37 Ga0070697_100209698 3300005536 Bacteria 1658
38 Ga0070704_100290776 3300005549 Bacteria 1358
39 Ga0068857_100144103 3300005577 Bacteria 2155
40 Ga0068856_100209987 3300005614 Bacteria 1962
41 Ga0068859_100145124 3300005617 Bacteria 2448
42 Ga0068858_100324497 3300005842 Bacteria 1472
43 Ga0068860_100137846 3300005843 Bacteria 2344
44 Ga0068860_100179362 3300005843 Unclassified 2047
45 Ga0068860_100600587 3300005843 Bacteria 1106
46 Ga0068862_100297053 3300005844 Unclassified 1485
47 Ga0081540_1035137 3300005983 Bacteria 2691
48 Ga0070717_10077808 3300006028 Bacteria 2778
49 Ga0075365_10052304 3300006038 Bacteria 2701
50 Ga0070715_10054118 3300006163 Bacteria 1737
51 Ga0070716_100001837 3300006173 Bacteria 9616
52 Ga0070716_100020787 3300006173 Bacteria 3450
53 Ga0070712_100125688 3300006175 Bacteria 1937
54 Ga0070712_100232914 3300006175 Bacteria 1463
55 Ga0075367_10036665 3300006178 Bacteria 2845
56 Ga0075369_10032925 3300006186 Bacteria 2195
57 Ga0097621_100153015 3300006237 Bacteria 1978
58 Ga0075370_10070196 3300006353 Bacteria 2003
59 Ga0075428_100125356 3300006844 Bacteria 2795
60 Ga0075430_100020676 3300006846 Bacteria 5599
61 Ga0075430_100032844 3300006846 Bacteria 4404
62 Ga0075431_100072175 3300006847 Bacteria 3562
63 Ga0075431_100219209 3300006847 Bacteria 1941
64 Ga0075433_10007134 3300006852 Bacteria 8849
65 Ga0075433_10116296 3300006852 Bacteria 2373
66 Ga0075434_100365513 3300006871 Bacteria 1464
67 Ga0075429_100002082 3300006880 Bacteria 16690
68 Ga0075436_100001745 3300006914 Bacteria 14892
69 Ga0075436_100053691 3300006914 Bacteria 2782
70 Ga0097620_100145126 3300006931 Bacteria 2448
71 Ga0099794_10045533 3300007265 Bacteria 2100
72 Ga0111539_10023204 3300009094 Bacteria 7621
73 Ga0111539_10127558 3300009094 Bacteria 2980
74 Ga0105245_10116174 3300009098 Bacteria 2495
75 Ga0114129_10041693 3300009147 Bacteria 6465
76 Ga0114129_10054459 3300009147 Bacteria 5608
77 Ga0114129_10447276 3300009147 Bacteria 1695
78 Ga0105241_10032494 3300009174 Bacteria 3912
79 Ga0105248_10103837 3300009177 Bacteria 3204
80 Ga0105237_10029332 3300009545 Bacteria 5594
81 Ga0105237_10049065 3300009545 Bacteria 4244
82 Ga0105237_10054530 3300009545 Bacteria 4006
83 Ga0105239_10056301 3300010375 Bacteria 4314
84 Ga0105239_10147022 3300010375 Bacteria 2629
85 Ga0157369_10018670 3300013105 Bacteria 7774
86 Ga0157372_10021498 3300013307 Bacteria 6971
87 Ga0157375_10167899 3300013308 Bacteria 2340
88 Ga0163163_10040799 3300014325 Bacteria 4535
89 Ga0163163_10096955 3300014325 Bacteria 2969
90 Ga0157377_10050832 3300014745 Bacteria 2336
91 Ga0157379_10030857 3300014968 Bacteria 4773
92 Ga0157379_10136399 3300014968 Bacteria 2211
93 Ga0157376_10002150 3300014969 Bacteria 13272
94 Ga0209677_101971 3300025253 Bacteria 8167
95 Ga0209758_1002469 3300025297 Bacteria 18814
96 Ga0207692_10001042 3300025898 Bacteria 10127
97 Ga0207692_10004230 3300025898 Bacteria 5675
98 Ga0207685_10075936 3300025905 Bacteria 1376
99 Ga0207699_10001653 3300025906 Bacteria 10562
100 Ga0207684_10018455 3300025910 Bacteria 5973
101 Ga0207684_10053421 3300025910 Bacteria 3429
102 Ga0207671_10161771 3300025914 Bacteria 1734
103 Ga0207693_10026715 3300025915 Bacteria 4567
104 Ga0207693_10038989 3300025915 Bacteria 3740
105 Ga0207693_10105756 3300025915 Bacteria 2207
106 Ga0207663_10094856 3300025916 Bacteria 1989
107 Ga0207681_10042466 3300025923 Bacteria 3038
108 Ga0207650_10007484 3300025925 Bacteria 7444
109 Ga0207700_10008559 3300025928 Bacteria 6348
110 Ga0207700_10068917 3300025928 Bacteria 2713
111 Ga0207700_10120940 3300025928 Bacteria 2123
112 Ga0207700_10330799 3300025928 Bacteria 1322
113 Ga0207664_10001495 3300025929 Bacteria 15324
114 Ga0207664_10024015 3300025929 Bacteria 4576
115 Ga0207664_10088139 3300025929 Bacteria 2539
116 Ga0207644_10025066 3300025931 Bacteria 4098
117 Ga0207644_10114648 3300025931 Bacteria 2042
118 Ga0207706_10079827 3300025933 Bacteria 2877
119 Ga0207670_10009744 3300025936 Bacteria 5497
120 Ga0207665_10004573 3300025939 Bacteria 9184
121 Ga0207665_10048032 3300025939 Bacteria 2863
122 Ga0207665_10072350 3300025939 Bacteria 2355
123 Ga0207711_10162829 3300025941 Bacteria 2021
124 Ga0207689_10004185 3300025942 Bacteria 13119
125 Ga0207679_10363245 3300025945 Bacteria 1265
126 Ga0207667_10276133 3300025949 Bacteria 1718
127 Ga0207651_10007389 3300025960 Bacteria 5852
128 Ga0207668_10131867 3300025972 Bacteria 1909
129 Ga0207658_10199640 3300025986 Bacteria 1669
130 Ga0207677_10122412 3300026023 Bacteria 1959
131 Ga0207703_10241308 3300026035 Bacteria 1625
132 Ga0207678_10132450 3300026067 Bacteria 2127
133 Ga0207678_10174933 3300026067 Bacteria 1833
134 Ga0207678_10195927 3300026067 Bacteria 1727
135 Ga0207702_10164945 3300026078 Bacteria 2026
136 Ga0207648_10369822 3300026089 Bacteria 1295
137 Ga0207676_10063837 3300026095 Bacteria 2926
138 Ga0207675_100221265 3300026118 Bacteria 1824
139 Ga0209389_1021611 3300027296 Bacteria 5724
140 Ga0209489_114763 3300027361 Bacteria 5245
141 Ga0209700_100030 3300027363 Bacteria 212982
142 Ga0207428_10007288 3300027907 Bacteria 10112
143 Ga0268265_10034102 3300028380 Bacteria 3708
144 Ga0268264_10239754 3300028381 Bacteria 1679
145 Ga0307405_10044303 3300031731 Bacteria 2721
146 Ga0307413_10122611 3300031824 Bacteria 1763
147 Ga0307410_10042692 3300031852 Bacteria 2999
148 Ga0307407_10042741 3300031903 Bacteria 2543
149 Ga0307416_100224294 3300032002 Bacteria 1805
150 Ga0307414_10065770 3300032004 Bacteria 2588
151 Ga0307414_10106389 3300032004 Bacteria 2123
152 Ga0307415_100334439 3300032126 Bacteria 1268
153 Ga0307507_10040938 3300033179 Bacteria 4646
154 Ga0307510_10136730 3300033180 Bacteria 2106
155 Ga0373940_0004085 3300035088 Bacteria 3055
156 Ga0373954_0072996 3300035118 Bacteria 1632
157 Ga0373956_0028211 3300035119 Bacteria 2441
158 Ga0373946_0008637 3300035171 Bacteria 3740
159 Ga0373955_0016522 3300035172 Bacteria 3635
160 Ga0373955_0032083 3300035172 Bacteria 2754
161 Ga0373927_0014087 3300035695 Bacteria 5303
162 Ga0373927_0058227 3300035695 Bacteria 2499
163 Ga0373927_0113187 3300035695 Bacteria 1768
164 Ga0373927_0171204 3300035695 Bacteria 1423
165 Ga0373927_0224167 3300035695 Bacteria 1235
166 Ga0373933_0083873 3300035724 Bacteria 1957
167 Ga0373933_0113466 3300035724 Bacteria 1692
168 Ga0373947_0000556 3300035725 Bacteria 21796
169 Ga0373947_0071483 3300035725 Bacteria 2128
170 Ga0373937_0039256 3300036401 Bacteria 4315
171 Ga0373937_0124196 3300036401 Bacteria 2407
172 Ga0373937_0141574 3300036401 Bacteria 2250
173 Ga0373937_0285401 3300036401 Bacteria 1559
174 Ga0373925_0004569 3300037068 Bacteria 10458
175 Ga0373925_0068617 3300037068 Bacteria 2677
176 Ga0395900_0215127 3300037418 Bacteria 1940
177 Ga0395898_0103364 3300037466 Unclassified 2734
178 Ga0395905_0037659 3300037471 Bacteria 4539
179 Ga0439435_0007694 3300042436 Bacteria 2476
180 Ga0453683_0016406 3300044673 Bacteria 4778
181 Ga0451576_0177848 3300045051 Bacteria 2221
182 Ga0451576_0527885 3300045051 Bacteria 1240
183 Ga0495592_0097721 3300046454 Bacteria 2096
184 Ga0495603_0000032 3300046455 Bacteria 59469
185 Ga0495603_0001437 3300046455 Bacteria 13846
186 Ga0495603_0018041 3300046455 Bacteria 4269
187 Ga0495603_0025450 3300046455 Bacteria 3579
188 Ga0495629_0000094 3300046459 Bacteria 77297
189 Ga0495629_0000108 3300046459 Bacteria 73826
190 Ga0495629_0000401 3300046459 Bacteria 36430
191 Ga0495629_0105923 3300046459 Bacteria 1961
192 Ga0495641_0002902 3300046461 Bacteria 13224
193 Ga0495641_0031902 3300046461 Bacteria 2513
194 Ga0495651_0045265 3300046462 Bacteria 3409
195 Ga0495653_0138757 3300046463 Bacteria 1712
196 Ga0495580_0003216 3300046472 Bacteria 13979
197 Ga0495580_0006937 3300046472 Bacteria 9137
198 Ga0495582_0000030 3300046473 Bacteria 77594
199 Ga0495582_0030661 3300046473 Bacteria 2953
200 Ga0495639_0000003 3300046475 Bacteria 118479
201 Ga0495639_0061300 3300046475 Bacteria 1725
202 Ga0495662_0000008 3300046476 Bacteria 71128
203 Ga0495664_0006834 3300046477 Bacteria 6315
204 Ga0495664_0045500 3300046477 Bacteria 2603
205 Ga0495664_0056161 3300046477 Bacteria 2342
206 Ga0495594_0000381 3300046499 Bacteria 22212
207 Ga0495594_0001775 3300046499 Bacteria 11200
208 Ga0495594_0169029 3300046499 Bacteria 1244
209 Ga0495608_0030137 3300046511 Bacteria 3675
210 Ga0495616_0069318 3300046513 Bacteria 1710
211 Ga0495628_0110986 3300046516 Bacteria 2109
212 Ga0495630_0257487 3300046517 Bacteria 1333
213 Ga0495643_0062028 3300046522 Bacteria 1980
214 Ga0495648_0020052 3300046524 Bacteria 4677
215 Ga0495652_0026496 3300046529 Bacteria 5121
216 Ga0495665_0000001 3300046531 Bacteria 156121
217 Ga0495665_0067660 3300046531 Bacteria 1884
218 Ga0495640_0015748 3300046533 Bacteria 5676
219 Ga0495586_0019418 3300046535 Bacteria 3618
220 Ga0495587_0038012 3300046536 Bacteria 2887
221 Ga0495645_0111228 3300046543 Bacteria 1938
222 Ga0495622_0009017 3300046557 Bacteria 4619
223 Ga0495622_0073196 3300046557 Bacteria 1581
224 Ga0495667_0126434 3300046559 Bacteria 1649
225 Ga0495634_0003065 3300046642 Bacteria 13605
226 Ga0495634_0026985 3300046642 Bacteria 4002
227 Ga0495634_0032046 3300046642 Bacteria 3617
228 Ga0495635_0002647 3300046663 Bacteria 12246
229 Ga0495588_0015001 3300046674 Bacteria 3721
230 Ga0495588_0016745 3300046674 Bacteria 3546
231 Ga0495657_0092031 3300046675 Bacteria 1943
232 Ga0495623_0085602 3300046679 Bacteria 1943
233 Ga0495646_0006907 3300046680 Bacteria 7204
234 Ga0495658_0000265 3300046683 Bacteria 29770
235 Ga0495658_0000790 3300046683 Bacteria 17043
236 Ga0495658_0003869 3300046683 Bacteria 7410
237 Ga0495613_0008665 3300046689 Bacteria 7543
238 Ga0495613_0032234 3300046689 Bacteria 3891
239 Ga0495613_0088113 3300046689 Bacteria 2249
240 Ga0495613_0125958 3300046689 Bacteria 1837
241 Ga0495613_0195438 3300046689 Bacteria 1428
242 Ga0495649_0168767 3300046694 Bacteria 1146
243 Ga0495581_0000011 3300047315 Bacteria 63980
244 Ga0495581_0020450 3300047315 Bacteria 3841
245 Ga0495581_0052883 3300047315 Bacteria 2346
246 Ga0495581_0053463 3300047315 Bacteria 2332
247 Ga0495581_0121670 3300047315 Bacteria 1519
248 Ga0495604_0110566 3300047317 Bacteria 2004
249 Ga0495674_0000031 3300047319 Bacteria 115867
250 Ga0495674_0052122 3300047319 Bacteria 3602
251 Ga0495674_0184001 3300047319 Bacteria 1739
252 Ga0495687_027207 3300047443 Bacteria 2679
253 Ga0495675_0063533 3300047444 Bacteria 2335
254 Ga0495673_0016096 3300047469 Bacteria 3833
255 Ga0495673_0046100 3300047469 Bacteria 1934
256 Ga0495684_0015406 3300047471 Bacteria 5884
257 Ga0495684_0036464 3300047471 Bacteria 3769
258 Ga0495593_0000231 3300047673 Bacteria 29745
259 Ga0495593_0015266 3300047673 Bacteria 4355
260 Ga0495602_0146215 3300048088 Bacteria 1864
261 Ga0495614_0019119 3300048089 Bacteria 2965
262 Ga0495626_0087505 3300048091 Bacteria 1375
263 Ga0496102_0103643 3300048905 Bacteria 2646
264 Ga0496103_0007623 3300048906 Bacteria 6439
265 Ga0496104_0031617 3300048907 Bacteria 4923
266 Ga0496104_0040956 3300048907 Bacteria 4343
267 Ga0496106_0105817 3300048909 Bacteria 2186
268 Ga0496106_0144492 3300048909 Bacteria 1873
269 Ga0496107_0011418 3300048910 Bacteria 6187
270 Ga0496107_0174386 3300048910 Bacteria 1596
271 Ga0496108_0003444 3300048911 Bacteria 12691
272 Ga0496108_0016652 3300048911 Bacteria 6003
273 Ga0496108_0025280 3300048911 Bacteria 4893
274 Ga0496108_0033747 3300048911 Bacteria 4251
275 Ga0496108_0049772 3300048911 Bacteria 3505
276 Ga0496109_0008458 3300048912 Bacteria 8748
277 Ga0496109_0028117 3300048912 Bacteria 5027
278 Ga0496109_0051032 3300048912 Bacteria 3767
279 Ga0496109_0065208 3300048912 Bacteria 3334
280 Ga0496109_0132712 3300048912 Bacteria 2325
281 Ga0496109_0197550 3300048912 Bacteria 1891
282 Ga0496110_0008452 3300048913 Bacteria 8287
283 Ga0496111_0055254 3300048914 Bacteria 2871
284 Ga0496111_0064411 3300048914 Bacteria 2659
285 Ga0496112_0007806 3300048915 Bacteria 9523
286 Ga0496112_0013667 3300048915 Bacteria 7501
287 Ga0496112_0016577 3300048915 Bacteria 6908
288 Ga0496112_0035375 3300048915 Bacteria 4865
289 Ga0496112_0084858 3300048915 Bacteria 3133
290 Ga0496112_0091667 3300048915 Bacteria 3008
291 Ga0496112_0170539 3300048915 Bacteria 2141
292 Ga0496112_0183282 3300048915 Bacteria 2057
293 Ga0496112_0295407 3300048915 Bacteria 1566
294 Ga0496112_0362887 3300048915 Bacteria 1390
295 Ga0496113_0037706 3300048916 Bacteria 3549
296 Ga0496113_0046471 3300048916 Bacteria 3223
297 Ga0496113_0047983 3300048916 Bacteria 3176
298 Ga0496113_0097726 3300048916 Bacteria 2272
299 Ga0496113_0221070 3300048916 Bacteria 1509
300 Ga0496117_0022234 3300048920 Bacteria 5091
301 Ga0496118_0011620 3300048921 Bacteria 8564
302 Ga0496118_0036744 3300048921 Bacteria 3954
303 Ga0496119_0045076 3300048922 Bacteria 2769
304 Ga0496121_0001474 3300048924 Bacteria 39613
305 Ga0496121_0126063 3300048924 Bacteria 1924
306 Ga0496124_0000837 3300048927 Bacteria 50140
307 Ga0496124_0224934 3300048927 Bacteria 1408
308 Ga0496125_0025502 3300048928 Bacteria 5412
309 Ga0496126_0008770 3300048929 Bacteria 10853
310 Ga0496126_0343899 3300048929 Bacteria 1221
311 Ga0495682_0008695 3300049460 Bacteria 3998
312 Ga0501031_0058078 3300049568 Bacteria 2521
313 Ga0501032_0105580 3300049569 Bacteria 1866
314 Ga0501033_0048003 3300049570 Bacteria 3173
315 Ga0501033_0161564 3300049570 Bacteria 1612
316 Ga0501033_0225243 3300049570 Bacteria 1334
317 Ga0501036_0030169 3300049572 Bacteria 4581
318 Ga0501036_0234293 3300049572 Bacteria 1540
319 Ga0501037_0041937 3300049573 Bacteria 3364
320 Ga0501039_0015615 3300049575 Bacteria 5811
321 Ga0501039_0051283 3300049575 Bacteria 3193
322 Ga0501040_0002438 3300049576 Bacteria 11974
323 Ga0501040_0026520 3300049576 Bacteria 3898
324 Ga0501041_0002713 3300049577 Bacteria 10099
325 Ga0501041_0149829 3300049577 Bacteria 1456
326 Ga0501042_0004216 3300049578 Bacteria 9154
327 Ga0501043_0056818 3300049579 Bacteria 3074
328 Ga0501043_0072168 3300049579 Bacteria 2712
329 Ga0501046_0001274 3300049580 Bacteria 24409
330 Ga0501048_0008122 3300049582 Bacteria 7942
331 Ga0501068_0010185 3300049584 Bacteria 5276
332 Ga0501069_0133929 3300049585 Bacteria 1420
333 Ga0501071_0000140 3300049587 Bacteria 29634
334 Ga0501071_0056632 3300049587 Bacteria 2832
335 Ga0501072_0005758 3300049588 Bacteria 9433
336 Ga0501074_0014670 3300049590 Bacteria 5700
337 Ga0501074_0104037 3300049590 Bacteria 2032
338 Ga0501075_0001164 3300049591 Bacteria 17018
339 Ga0501075_0122385 3300049591 Bacteria 1980
340 Ga0501076_0009146 3300049592 Bacteria 7297
341 Ga0501076_0119861 3300049592 Bacteria 2130
342 Ga0501076_0241848 3300049592 Bacteria 1477
343 Ga0501077_0007640 3300049593 Bacteria 6672
344 Ga0501077_0066772 3300049593 Bacteria 2281
345 Ga0501079_0009572 3300049741 Bacteria 7346
346 Ga0501079_0130448 3300049741 Bacteria 1956
347 Ga0501080_0013192 3300049742 Bacteria 7591
348 Ga0501080_0250547 3300049742 Bacteria 1615
349 Ga0501081_0005293 3300049743 Bacteria 8318
350 Ga0501083_0071095 3300049744 Bacteria 2314
351 Ga0501035_0043001 3300049822 Bacteria 4073
352 Ga0501044_0230925 3300049823 Bacteria 1798
353 Ga0501045_0006751 3300049824 Bacteria 7949
354 nmdc:mga0yw44_40814_c1 3300050492 Bacteria 2760
355 nmdc:mga06z11_98981_c1 3300050494 Bacteria 1597
356 nmdc:mga07m45_93298_c1 3300050496 Bacteria 1726
357 nmdc:mga05p37_15280_c1 3300050507 Bacteria 9223
358 nmdc:mga05p37_385721_c1 3300050507 Bacteria 1640
359 nmdc:mga05p37_52631_c1 3300050507 Bacteria 5006
360 nmdc:mga0qj67_18005_c1 3300050509 Bacteria 5380
361 nmdc:mga0qj67_27963_c1 3300050509 Bacteria 4374
362 nmdc:mga06r32_193109_c1 3300050510 Bacteria 2023
363 nmdc:mga06r32_206261_c1 3300050510 Bacteria 1954
364 nmdc:mga06r32_6814_c1 3300050510 Bacteria 10271
365 nmdc:mga08y16_12251_c1 3300050511 Bacteria 9012
366 nmdc:mga08y16_123675_c1 3300050511 Bacteria 2692
367 nmdc:mga0n895_27417_c1 3300050512 Bacteria 5412
368 nmdc:mga0rr50_179094_c1 3300050513 Bacteria 1732
369 nmdc:mga08x19_130819_c1 3300050514 Bacteria 1688
370 nmdc:mga08x19_61369_c1 3300050514 Bacteria 2436
371 nmdc:mga0a205_181341_c1 3300050515 Bacteria 2000
372 nmdc:mga0a205_4531_c1 3300050515 Bacteria 12473
373 nmdc:mga0sz30_32832_c1 3300050516 Bacteria 2155
374 Ga0495601_0030813 3300053077 Bacteria 3332
375 Ga0495601_0061357 3300053077 Bacteria 2387
376 Ga0500635_0001986 3300053080 Bacteria 4997
377 Ga0495619_0000164 3300053085 Bacteria 48672
378 Ga0495619_0053902 3300053085 Bacteria 2661
379 Ga0495619_0176215 3300053085 Bacteria 1479
380 Ga0500554_002846 3300053102 Bacteria 3456
381 Ga0500658_0051525 3300053134 Bacteria 1683
382 Ga0500568_0035260 3300053139 Bacteria 2043
383 Ga0500603_000909 3300053150 Bacteria 7015
384 Ga0500636_0065857 3300053177 Bacteria 2107
385 Ga0500637_0007900 3300053178 Bacteria 5343
386 Ga0500552_008487 3300053733 Bacteria 1214
387 Ga0501084_0004254 3300054114 Bacteria 11644
388 Ga0530510_0000580 3300061734 Bacteria 23480
389 Ga0530510_0067155 3300061734 Bacteria 2601
390 Ga0530510_0272349 3300061734 Bacteria 1263
391 2889038914 2889033259 Bacteria 9099371
392 Ga0373936_0027691
393 JGI25153J46596_10042973
394 Ga0070670_100014538
395 Ga0068869_100027791
396 Ga0068869_100401877
397 Ga0070680_100010012
398 Ga0068868_100266616
399 Ga0070671_100275765
400 Ga0070688_100053830
401 Ga0070659_100044389
402 Ga0070714_100011210
403 Ga0070714_100017471
404 Ga0070714_100026989
405 Ga0070714_100033173
406 Ga0070714_100145418
407 Ga0070714_100305274
408 Ga0070713_100004109
409 Ga0070713_100011759
410 Ga0070713_100087351
411 Ga0070713_100125760
412 Ga0070713_100344342
413 Ga0070710_10004864
414 Ga0070710_10006904
415 Ga0070711_100114220
416 Ga0070694_100003481
417 Ga0070708_100161598
418 Ga0070663_100040740
419 Ga0070663_100106606
420 Ga0068867_100039359
421 Ga0068867_100108134
422 Ga0070706_100025538
423 Ga0070698_100179162
424 Ga0070699_100150912
425 Ga0070699_100249188
426 Ga0070679_100011744
427 Ga0070684_100030279
428 Ga0070697_100209698
429 Ga0070704_100290776
430 Ga0068857_100144103
431 Ga0068856_100209987
432 Ga0068859_100145124
433 Ga0068858_100324497
434 Ga0068860_100137846
435 Ga0068860_100179362
436 Ga0068860_100600587
437 Ga0068862_100297053
438 Ga0081540_1035137
439 Ga0070717_10077808
440 Ga0075365_10052304
441 Ga0070715_10054118
442 Ga0070716_100001837
443 Ga0070716_100020787
444 Ga0070712_100125688
445 Ga0070712_100232914
446 Ga0075367_10036665
447 Ga0075369_10032925
448 Ga0097621_100153015
449 Ga0075370_10070196
450 Ga0075428_100125356
451 Ga0075430_100020676
452 Ga0075430_100032844
453 Ga0075431_100072175
454 Ga0075431_100219209
455 Ga0075433_10007134
456 Ga0075433_10116296
457 Ga0075434_100365513
458 Ga0075429_100002082
459 Ga0075436_100001745
460 Ga0075436_100053691
461 Ga0097620_100145126
462 Ga0099794_10045533
463 Ga0111539_10023204
464 Ga0111539_10127558
465 Ga0105245_10116174
466 Ga0114129_10041693
467 Ga0114129_10054459
468 Ga0114129_10447276
469 Ga0105241_10032494
470 Ga0105248_10103837
471 Ga0105237_10029332
472 Ga0105237_10049065
473 Ga0105237_10054530
474 Ga0105239_10056301
475 Ga0105239_10147022
476 Ga0157369_10018670
477 Ga0157372_10021498
478 Ga0157375_10167899
479 Ga0163163_10040799
480 Ga0163163_10096955
481 Ga0157377_10050832
482 Ga0157379_10030857
483 Ga0157379_10136399
484 Ga0157376_10002150
485 Ga0209677_101971
486 Ga0209758_1002469
487 Ga0207692_10001042
488 Ga0207692_10004230
489 Ga0207685_10075936
490 Ga0207699_10001653
491 Ga0207684_10018455
492 Ga0207684_10053421
493 Ga0207671_10161771
494 Ga0207693_10026715
495 Ga0207693_10038989
496 Ga0207693_10105756
497 Ga0207663_10094856
498 Ga0207681_10042466
499 Ga0207650_10007484
500 Ga0207700_10008559
501 Ga0207700_10068917
502 Ga0207700_10120940
503 Ga0207700_10330799
504 Ga0207664_10001495
505 Ga0207664_10024015
506 Ga0207664_10088139
507 Ga0207644_10025066
508 Ga0207644_10114648
509 Ga0207706_10079827
510 Ga0207670_10009744
511 Ga0207665_10004573
512 Ga0207665_10048032
513 Ga0207665_10072350
514 Ga0207711_10162829
515 Ga0207689_10004185
516 Ga0207679_10363245
517 Ga0207667_10276133
518 Ga0207651_10007389
519 Ga0207668_10131867
520 Ga0207658_10199640
521 Ga0207677_10122412
522 Ga0207703_10241308
523 Ga0207678_10132450
524 Ga0207678_10174933
525 Ga0207678_10195927
526 Ga0207702_10164945
527 Ga0207648_10369822
528 Ga0207676_10063837
529 Ga0207675_100221265
530 Ga0209389_1021611
531 Ga0209489_114763
532 Ga0209700_100030
533 Ga0207428_10007288
534 Ga0268265_10034102
535 Ga0268264_10239754
536 Ga0307405_10044303
537 Ga0307413_10122611
538 Ga0307410_10042692
539 Ga0307407_10042741
540 Ga0307416_100224294
541 Ga0307414_10065770
542 Ga0307414_10106389
543 Ga0307415_100334439
544 Ga0307507_10040938
545 Ga0307510_10136730
546 Ga0373940_0004085
547 Ga0373954_0072996
548 Ga0373956_0028211
549 Ga0373946_0008637
550 Ga0373955_0016522
551 Ga0373955_0032083
552 Ga0373927_0014087
553 Ga0373927_0058227
554 Ga0373927_0113187
555 Ga0373927_0171204
556 Ga0373927_0224167
557 Ga0373933_0083873
558 Ga0373933_0113466
559 Ga0373947_0000556
560 Ga0373947_0071483
561 Ga0373937_0039256
562 Ga0373937_0124196
563 Ga0373937_0141574
564 Ga0373937_0285401
565 Ga0373925_0004569
566 Ga0373925_0068617
567 Ga0395900_0215127
568 Ga0395898_0103364
569 Ga0395905_0037659
570 Ga0439435_0007694
571 Ga0453683_0016406
572 Ga0451576_0177848
573 Ga0451576_0527885
574 Ga0495592_0097721
575 Ga0495603_0000032
576 Ga0495603_0001437
577 Ga0495603_0018041
578 Ga0495603_0025450
579 Ga0495629_0000094
580 Ga0495629_0000108
581 Ga0495629_0000401
582 Ga0495629_0105923
583 Ga0495641_0002902
584 Ga0495641_0031902
585 Ga0495651_0045265
586 Ga0495653_0138757
587 Ga0495580_0003216
588 Ga0495580_0006937
589 Ga0495582_0000030
590 Ga0495582_0030661
591 Ga0495639_0000003
592 Ga0495639_0061300
593 Ga0495662_0000008
594 Ga0495664_0006834
595 Ga0495664_0045500
596 Ga0495664_0056161
597 Ga0495594_0000381
598 Ga0495594_0001775
599 Ga0495594_0169029
600 Ga0495608_0030137
601 Ga0495616_0069318
602 Ga0495628_0110986
603 Ga0495630_0257487
604 Ga0495643_0062028
605 Ga0495648_0020052
606 Ga0495652_0026496
607 Ga0495665_0000001
608 Ga0495665_0067660
609 Ga0495640_0015748
610 Ga0495586_0019418
611 Ga0495587_0038012
612 Ga0495645_0111228
613 Ga0495622_0009017
614 Ga0495622_0073196
615 Ga0495667_0126434
616 Ga0495634_0003065
617 Ga0495634_0026985
618 Ga0495634_0032046
619 Ga0495635_0002647
620 Ga0495588_0015001
621 Ga0495588_0016745
622 Ga0495657_0092031
623 Ga0495623_0085602
624 Ga0495646_0006907
625 Ga0495658_0000265
626 Ga0495658_0000790
627 Ga0495658_0003869
628 Ga0495613_0008665
629 Ga0495613_0032234
630 Ga0495613_0088113
631 Ga0495613_0125958
632 Ga0495613_0195438
633 Ga0495649_0168767
634 Ga0495581_0000011
635 Ga0495581_0020450
636 Ga0495581_0052883
637 Ga0495581_0053463
638 Ga0495581_0121670
639 Ga0495604_0110566
640 Ga0495674_0000031
641 Ga0495674_0052122
642 Ga0495674_0184001
643 Ga0495687_027207
644 Ga0495675_0063533
645 Ga0495673_0016096
646 Ga0495673_0046100
647 Ga0495684_0015406
648 Ga0495684_0036464
649 Ga0495593_0000231
650 Ga0495593_0015266
651 Ga0495602_0146215
652 Ga0495614_0019119
653 Ga0495626_0087505
654 Ga0496102_0103643
655 Ga0496103_0007623
656 Ga0496104_0031617
657 Ga0496104_0040956
658 Ga0496106_0105817
659 Ga0496106_0144492
660 Ga0496107_0011418
661 Ga0496107_0174386
662 Ga0496108_0003444
663 Ga0496108_0016652
664 Ga0496108_0025280
665 Ga0496108_0033747
666 Ga0496108_0049772
667 Ga0496109_0008458
668 Ga0496109_0028117
669 Ga0496109_0051032
670 Ga0496109_0065208
671 Ga0496109_0132712
672 Ga0496109_0197550
673 Ga0496110_0008452
674 Ga0496111_0055254
675 Ga0496111_0064411
676 Ga0496112_0007806
677 Ga0496112_0013667
678 Ga0496112_0016577
679 Ga0496112_0035375
680 Ga0496112_0084858
681 Ga0496112_0091667
682 Ga0496112_0170539
683 Ga0496112_0183282
684 Ga0496112_0295407
685 Ga0496112_0362887
686 Ga0496113_0037706
687 Ga0496113_0046471
688 Ga0496113_0047983
689 Ga0496113_0097726
690 Ga0496113_0221070
691 Ga0496117_0022234
692 Ga0496118_0011620
693 Ga0496118_0036744
694 Ga0496119_0045076
695 Ga0496121_0001474
696 Ga0496121_0126063
697 Ga0496124_0000837
698 Ga0496124_0224934
699 Ga0496125_0025502
700 Ga0496126_0008770
701 Ga0496126_0343899
702 Ga0495682_0008695
703 Ga0501031_0058078
704 Ga0501032_0105580
705 Ga0501033_0048003
706 Ga0501033_0161564
707 Ga0501033_0225243
708 Ga0501036_0030169
709 Ga0501036_0234293
710 Ga0501037_0041937
711 Ga0501039_0015615
712 Ga0501039_0051283
713 Ga0501040_0002438
714 Ga0501040_0026520
715 Ga0501041_0002713
716 Ga0501041_0149829
717 Ga0501042_0004216
718 Ga0501043_0056818
719 Ga0501043_0072168
720 Ga0501046_0001274
721 Ga0501048_0008122
722 Ga0501068_0010185
723 Ga0501069_0133929
724 Ga0501071_0000140
725 Ga0501071_0056632
726 Ga0501072_0005758
727 Ga0501074_0014670
728 Ga0501074_0104037
729 Ga0501075_0001164
730 Ga0501075_0122385
731 Ga0501076_0009146
732 Ga0501076_0119861
733 Ga0501076_0241848
734 Ga0501077_0007640
735 Ga0501077_0066772
736 Ga0501079_0009572
737 Ga0501079_0130448
738 Ga0501080_0013192
739 Ga0501080_0250547
740 Ga0501081_0005293
741 Ga0501083_0071095
742 Ga0501035_0043001
743 Ga0501044_0230925
744 Ga0501045_0006751
745 nmdc:mga0yw44_40814_c1
746 nmdc:mga06z11_98981_c1
747 nmdc:mga07m45_93298_c1
748 nmdc:mga05p37_15280_c1
749 nmdc:mga05p37_385721_c1
750 nmdc:mga05p37_52631_c1
751 nmdc:mga0qj67_18005_c1
752 nmdc:mga0qj67_27963_c1
753 nmdc:mga06r32_193109_c1
754 nmdc:mga06r32_206261_c1
755 nmdc:mga06r32_6814_c1
756 nmdc:mga08y16_12251_c1
757 nmdc:mga08y16_123675_c1
758 nmdc:mga0n895_27417_c1
759 nmdc:mga0rr50_179094_c1
760 nmdc:mga08x19_130819_c1
761 nmdc:mga08x19_61369_c1
762 nmdc:mga0a205_181341_c1
763 nmdc:mga0a205_4531_c1
764 nmdc:mga0sz30_32832_c1
765 Ga0495601_0030813
766 Ga0495601_0061357
767 Ga0500635_0001986
768 Ga0495619_0000164
769 Ga0495619_0053902
770 Ga0495619_0176215
771 Ga0500554_002846
772 Ga0500658_0051525
773 Ga0500568_0035260
774 Ga0500603_000909
775 Ga0500636_0065857
776 Ga0500637_0007900
777 Ga0500552_008487
778 Ga0501084_0004254
779 Ga0530510_0000580
780 Ga0530510_0067155
781 Ga0530510_0272349
782 2889038914

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

31

137

0.8

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

189

334

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a27-assembly1.cif.gz_B crystal structure of human synaptic vesicle membrane protein vat-1 homolog-like protein 0.8814 4 339
4a27-assembly1.cif.gz_B crystal structure of human synaptic vesicle membrane protein vat-1 homolog-like protein 0.8761 4 339
4a27-assembly1.cif.gz_A crystal structure of human synaptic vesicle membrane protein vat-1 homolog-like protein 0.8667 5 339
4a27-assembly1.cif.gz_A crystal structure of human synaptic vesicle membrane protein vat-1 homolog-like protein 0.8564 5 339
4eye-assembly1.cif.gz_A crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.8553 5 336
ID Description Score Start End Superfamily
af_Q75JT6_127_265_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9267 133 234 3.40.50.720
af_Q8JFV8_70_190_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.8854 6 126 3.90.180.10
af_O07721_1_120_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.8786 7 126 3.90.180.10
af_A0A0R0I1N1_1_153_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.8779 6 141 3.90.180.10
af_Q8JFV8_70_190_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.872 6 126 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A227J0B0-F1-model_v4 NADPH:quinone reductase 0.9305 114 199
AF-A0A227J0B0-F1-model_v4 NADPH:quinone reductase 0.9202 114 199
AF-A0A376RR08-F1-model_v4 Quinone oxidoreductase, NADPH-dependent (EC 1.6.5.5) 0.914 77 218 GO:0003960
GO:0005829
GO:0008270
GO:0035925
GO:0070402
AF-A0A810DVS2-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9102 4 234 GO:0016491
AF-A0A7L3Q574-F1-model_v4 VAT1 protein 0.906 5 234 GO:0005741
GO:0008270
GO:0010637
GO:0016491

Map