F432044

General Info

Members Datasets Scaffolds Average Seq Length
391 210 782 245

Family's Representative Sequence

Representative Sequence 3300025940|Ga0207691_10441591|Ga0207691_104415911
Length 270
Sequence VARRTARGRVTAQRHDPVPPRPHASGVRPPDLPTELVPAHVAIVMDGNGRWAQRRGLKRTDGHAAGEEALADTVEGGVEVGLKWLTVYAFSTENWRRPAGEVLYLMNFNRKLLRRRRDRFHELNVRIRFTGRRDWRVPRSVLREIEAAEEMTRDNTGMTLTIAFNYGGRVEIVDAVKQIVRDHDAGTLRTEKISVDSILERLYYPDMPDPDLLIRTSGEQRISNFLLWEAAYAELWFTPVFWPDFDREHLYEAIRDFQKRSRRFGNVDDD

Samples

Sample ID Description Type Environment
1 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
101 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
102 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
113 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
116 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
117 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
118 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
119 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
126 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
130 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
153 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.53
Nodule 0
Rhizoplane 3.32
Rhizosphere 92.07
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207691_10441591 3300025940 Bacteria 1108
2 JGI24751J29686_10000324 3300002459 Bacteria 17623
3 JGI24751J29686_10014275 3300002459 Bacteria 1639
4 Ga0070676_10323027 3300005328 Bacteria 1053
5 Ga0070683_100054592 3300005329 Bacteria 3704
6 Ga0070670_100036781 3300005331 Bacteria 4212
7 Ga0070670_100135092 3300005331 Bacteria 2131
8 Ga0070661_100040073 3300005344 Bacteria 3415
9 Ga0070692_10011062 3300005345 Bacteria 4131
10 Ga0070675_100173259 3300005354 Bacteria 1862
11 Ga0070675_100235933 3300005354 Bacteria 1597
12 Ga0070688_100401910 3300005365 Bacteria 1014
13 Ga0070659_100177684 3300005366 Bacteria 1746
14 Ga0070703_10065372 3300005406 Bacteria 1201
15 Ga0070711_100031425 3300005439 Bacteria 3525
16 Ga0070708_100009623 3300005445 Bacteria 7794
17 Ga0070663_100078413 3300005455 Bacteria 2421
18 Ga0070681_10225076 3300005458 Bacteria 1791
19 Ga0070685_10529641 3300005466 Bacteria 838
20 Ga0070706_100010740 3300005467 Bacteria 8497
21 Ga0070707_100546465 3300005468 Bacteria 1120
22 Ga0070698_100022052 3300005471 Bacteria 6668
23 Ga0070698_100072847 3300005471 Bacteria 3442
24 Ga0070698_100131582 3300005471 Bacteria 2457
25 Ga0070699_100089028 3300005518 Bacteria 2697
26 Ga0070699_100594407 3300005518 Bacteria 1009
27 Ga0070684_100032698 3300005535 Bacteria 4435
28 Ga0070697_100425657 3300005536 Bacteria 1154
29 Ga0070672_100333299 3300005543 Bacteria 1291
30 Ga0070664_100006335 3300005564 Bacteria 9546
31 Ga0068857_100048244 3300005577 Bacteria 3781
32 Ga0068857_100488695 3300005577 Bacteria 1154
33 Ga0068854_100481446 3300005578 Bacteria 1042
34 Ga0068859_100878262 3300005617 Bacteria 982
35 Ga0068861_100410024 3300005719 Bacteria 1205
36 Ga0068870_10003427 3300005840 Bacteria 6723
37 Ga0068863_100008184 3300005841 Bacteria 10213
38 Ga0068860_100004081 3300005843 Bacteria 14986
39 Ga0068860_100314579 3300005843 Bacteria 1536
40 Ga0068862_100023995 3300005844 Bacteria 5113
41 Ga0081455_10005484 3300005937 Bacteria 13908
42 Ga0081455_10009550 3300005937 Bacteria 9964
43 Ga0081455_10051742 3300005937 Bacteria 3521
44 Ga0081539_10031829 3300005985 Bacteria 3244
45 Ga0081539_10130186 3300005985 Bacteria 1237
46 Ga0075365_10285918 3300006038 Bacteria 1160
47 Ga0075432_10001810 3300006058 Bacteria 7040
48 Ga0070715_10007709 3300006163 Bacteria 3718
49 Ga0070712_100027929 3300006175 Bacteria 3770
50 Ga0075367_10174167 3300006178 Bacteria 1341
51 Ga0075367_10447211 3300006178 Bacteria 819
52 Ga0075428_100094668 3300006844 Bacteria 3256
53 Ga0075428_100183888 3300006844 Bacteria 2262
54 Ga0075430_100001556 3300006846 Bacteria 18764
55 Ga0075430_100022793 3300006846 Bacteria 5325
56 Ga0075430_100258141 3300006846 Bacteria 1443
57 Ga0075430_100363145 3300006846 Bacteria 1196
58 Ga0075431_100001850 3300006847 Bacteria 20044
59 Ga0075431_100006773 3300006847 Bacteria 11377
60 Ga0075431_100398660 3300006847 Bacteria 1377
61 Ga0075433_10004550 3300006852 Bacteria 10816
62 Ga0075433_10006691 3300006852 Bacteria 9130
63 Ga0075433_10052799 3300006852 Bacteria 3542
64 Ga0075434_100019715 3300006871 Bacteria 6528
65 Ga0075434_100029474 3300006871 Bacteria 5401
66 Ga0075434_100044025 3300006871 Bacteria 4428
67 Ga0075429_100000304 3300006880 Bacteria 34801
68 Ga0075429_100005938 3300006880 Bacteria 10539
69 Ga0075429_100089916 3300006880 Bacteria 2677
70 Ga0068865_100277592 3300006881 Bacteria 1333
71 Ga0075436_100019917 3300006914 Bacteria 4602
72 Ga0097620_100878239 3300006931 Bacteria 982
73 Ga0075435_100001781 3300007076 Bacteria 14014
74 Ga0105251_10028884 3300009011 Bacteria 2799
75 Ga0105251_10035248 3300009011 Bacteria 2470
76 Ga0111539_10021077 3300009094 Bacteria 8026
77 Ga0111539_10252759 3300009094 Bacteria 2052
78 Ga0111539_10525806 3300009094 Bacteria 1378
79 Ga0111539_10560155 3300009094 Bacteria 1331
80 Ga0111539_10839116 3300009094 Bacteria 1069
81 Ga0111539_11313533 3300009094 Bacteria 839
82 Ga0105245_10119023 3300009098 Bacteria 2465
83 Ga0105245_10244253 3300009098 Bacteria 1742
84 Ga0105245_10514449 3300009098 Bacteria 1215
85 Ga0105247_10058921 3300009101 Bacteria 2376
86 Ga0114129_10001808 3300009147 Bacteria 29161
87 Ga0114129_10006997 3300009147 Bacteria 16058
88 Ga0114129_10028952 3300009147 Bacteria 7847
89 Ga0114129_10041419 3300009147 Bacteria 6490
90 Ga0114129_10445590 3300009147 Bacteria 1699
91 Ga0114129_10821157 3300009147 Bacteria 1184
92 Ga0105243_10013594 3300009148 Bacteria 6157
93 Ga0105243_10017267 3300009148 Bacteria 5456
94 Ga0105243_10089001 3300009148 Bacteria 2537
95 Ga0105243_10149867 3300009148 Bacteria 2000
96 Ga0105242_10184359 3300009176 Bacteria 1843
97 Ga0105249_10933457 3300009553 Bacteria 935
98 Ga0105239_10490648 3300010375 Bacteria 1396
99 Ga0105246_10021335 3300011119 Bacteria 4167
100 Ga0105246_10034119 3300011119 Bacteria 3387
101 Ga0157378_10218392 3300013297 Bacteria 1811
102 Ga0163162_10870226 3300013306 Bacteria 1016
103 Ga0157375_10328189 3300013308 Bacteria 1695
104 Ga0163163_10038747 3300014325 Bacteria 4646
105 Ga0163163_10052260 3300014325 Bacteria 4031
106 Ga0157380_10185353 3300014326 Bacteria 1832
107 Ga0157380_10445825 3300014326 Bacteria 1242
108 Ga0157377_10015109 3300014745 Bacteria 3940
109 Ga0157379_10075189 3300014968 Bacteria 3024
110 Ga0213876_10012355 3300021384 Bacteria 4545
111 Ga0207710_10061465 3300025900 Bacteria 1705
112 Ga0207688_10110061 3300025901 Bacteria 1598
113 Ga0207688_10396619 3300025901 Bacteria 855
114 Ga0207647_10195874 3300025904 Bacteria 1170
115 Ga0207685_10011099 3300025905 Bacteria 2694
116 Ga0207645_10258097 3300025907 Bacteria 1154
117 Ga0207643_10009889 3300025908 Bacteria 5125
118 Ga0207684_10203842 3300025910 Bacteria 1706
119 Ga0207693_10001872 3300025915 Bacteria 18427
120 Ga0207663_10067317 3300025916 Bacteria 2296
121 Ga0207649_10095237 3300025920 Bacteria 1958
122 Ga0207681_10101705 3300025923 Bacteria 2074
123 Ga0207650_10077808 3300025925 Bacteria 2508
124 Ga0207659_10016676 3300025926 Bacteria 4786
125 Ga0207659_10083296 3300025926 Bacteria 2371
126 Ga0207659_10153209 3300025926 Bacteria 1802
127 Ga0207659_10238719 3300025926 Bacteria 1469
128 Ga0207687_10516745 3300025927 Bacteria 998
129 Ga0207644_10465618 3300025931 Bacteria 1040
130 Ga0207690_10074454 3300025932 Bacteria 2352
131 Ga0207706_10145477 3300025933 Bacteria 2085
132 Ga0207709_10020183 3300025935 Bacteria 3755
133 Ga0207709_10030155 3300025935 Bacteria 3152
134 Ga0207709_10070886 3300025935 Bacteria 2211
135 Ga0207709_10245960 3300025935 Bacteria 1304
136 Ga0207669_10161543 3300025937 Bacteria 1583
137 Ga0207669_10465390 3300025937 Bacteria 1005
138 Ga0207665_10009492 3300025939 Bacteria 6389
139 Ga0207661_10286290 3300025944 Bacteria 1474
140 Ga0207679_10005135 3300025945 Bacteria 8195
141 Ga0207678_10099841 3300026067 Bacteria 2479
142 Ga0207708_10141576 3300026075 Bacteria 1887
143 Ga0207641_10002656 3300026088 Bacteria 16338
144 Ga0207676_10006401 3300026095 Bacteria 8318
145 Ga0207674_10005191 3300026116 Bacteria 15513
146 Ga0207674_10048272 3300026116 Bacteria 4357
147 Ga0207674_10502311 3300026116 Bacteria 1172
148 Ga0207675_100009083 3300026118 Bacteria 9328
149 Ga0207675_100164266 3300026118 Bacteria 2119
150 Ga0207675_100697899 3300026118 Bacteria 1023
151 Ga0207428_10000843 3300027907 Bacteria 34495
152 Ga0207428_10014817 3300027907 Bacteria 6754
153 Ga0268265_10128377 3300028380 Bacteria 2103
154 Ga0268265_10147275 3300028380 Bacteria 1980
155 Ga0268264_10046496 3300028381 Bacteria 3604
156 Ga0307415_100088100 3300032126 Bacteria 2239
157 Ga0373926_0001057 3300035083 Bacteria 8092
158 Ga0373944_0012798 3300035089 Bacteria 2317
159 Ga0316574_0297684 3300035398 Bacteria 1026
160 Ga0373924_0030656 3300035410 Bacteria 2157
161 Ga0373931_0014559 3300035691 Bacteria 3847
162 Ga0373947_0242199 3300035725 Bacteria 1190
163 Ga0316584_0248158 3300036712 Bacteria 1301
164 Ga0373925_0012746 3300037068 Bacteria 6091
165 Ga0395900_0046480 3300037418 Bacteria 4470
166 Ga0395900_0181360 3300037418 Bacteria 2139
167 Ga0395898_0405300 3300037466 Bacteria 1300
168 Ga0395898_0606567 3300037466 Bacteria 1037
169 Ga0395905_0124361 3300037471 Bacteria 2425
170 Ga0395905_0292250 3300037471 Bacteria 1516
171 Ga0395905_0345297 3300037471 Bacteria 1380
172 Ga0395901_0003598 3300038443 Bacteria 15633
173 Ga0395901_0242514 3300038443 Bacteria 1879
174 Ga0400485_14074 3300038735 Bacteria 1604
175 Ga0400483_022363 3300039062 Bacteria 1862
176 Ga0400483_024877 3300039062 Bacteria 9704
177 Ga0400483_096070 3300039062 Bacteria 2385
178 Ga0400483_131791 3300039062 Bacteria 2870
179 Ga0400483_138411 3300039062 Bacteria 3033
180 Ga0400483_153519 3300039062 Bacteria 29541
181 Ga0400483_211169 3300039062 Bacteria 13328
182 Ga0400483_258594 3300039062 Bacteria 3378
183 Ga0436365_1796488 3300039437 Bacteria 4809
184 Ga0451837_0391415 3300041494 Bacteria 2397
185 Ga0439448_0010917 3300042005 Bacteria 2701
186 Ga0439463_006917 3300042016 Bacteria 2798
187 Ga0439464_0011980 3300042439 Bacteria 2304
188 Ga0439440_0012086 3300042993 Bacteria 1831
189 Ga0466967_0487807 3300045976 Bacteria 1208
190 Ga0466967_0797596 3300045976 Bacteria 938
191 Ga0495591_053750 3300046458 Bacteria 1091
192 Ga0495641_0002433 3300046461 Bacteria 14703
193 Ga0495580_0028631 3300046472 Bacteria 4049
194 Ga0495580_0046325 3300046472 Bacteria 3086
195 Ga0495582_0001744 3300046473 Bacteria 12260
196 Ga0495639_0000269 3300046475 Bacteria 25802
197 Ga0495662_0003745 3300046476 Bacteria 7665
198 Ga0495584_0164883 3300046491 Bacteria 1126
199 Ga0495594_0040414 3300046499 Bacteria 2552
200 Ga0495596_0169103 3300046500 Bacteria 850
201 Ga0495607_0100029 3300046501 Bacteria 1555
202 Ga0495608_0228558 3300046511 Bacteria 1165
203 Ga0495628_0388933 3300046516 Bacteria 1020
204 Ga0495630_0025924 3300046517 Bacteria 4338
205 Ga0495630_0357855 3300046517 Bacteria 1117
206 Ga0495665_0003797 3300046531 Bacteria 8177
207 Ga0495665_0110250 3300046531 Bacteria 1444
208 Ga0495640_0004978 3300046533 Bacteria 10554
209 Ga0495586_0021682 3300046535 Bacteria 3427
210 Ga0495598_0074774 3300046537 Bacteria 1075
211 Ga0495667_0075361 3300046559 Bacteria 2196
212 Ga0495667_0110503 3300046559 Bacteria 1776
213 Ga0495634_0015600 3300046642 Bacteria 5453
214 Ga0495634_0120290 3300046642 Bacteria 1682
215 Ga0495635_0002284 3300046663 Bacteria 13036
216 Ga0495635_0220154 3300046663 Bacteria 1284
217 Ga0495588_0002701 3300046674 Bacteria 7598
218 Ga0495588_0006334 3300046674 Bacteria 5328
219 Ga0495647_0000193 3300046681 Bacteria 16216
220 Ga0495647_0022226 3300046681 Bacteria 2291
221 Ga0495647_0131851 3300046681 Bacteria 1059
222 Ga0495658_0005403 3300046683 Bacteria 6280
223 Ga0495669_0132508 3300046684 Bacteria 1174
224 Ga0495613_0004570 3300046689 Bacteria 10380
225 Ga0495624_0001998 3300046690 Bacteria 15563
226 Ga0495581_0013661 3300047315 Bacteria 4708
227 Ga0495676_0012319 3300047321 Bacteria 7704
228 Ga0495680_0048921 3300047322 Bacteria 3317
229 Ga0495684_0068211 3300047471 Bacteria 2705
230 Ga0495593_0003013 3300047673 Bacteria 10149
231 Ga0495614_0013249 3300048089 Bacteria 3616
232 Ga0495615_0048522 3300048090 Bacteria 1086
233 Ga0496108_0053155 3300048911 Bacteria 3396
234 Ga0496108_0058667 3300048911 Bacteria 3236
235 Ga0496109_0020495 3300048912 Bacteria 5840
236 Ga0496109_0088997 3300048912 Bacteria 2854
237 Ga0496110_0029900 3300048913 Bacteria 4694
238 Ga0496110_0320572 3300048913 Bacteria 1412
239 Ga0496111_0036988 3300048914 Bacteria 3492
240 Ga0496111_0333712 3300048914 Bacteria 1123
241 Ga0496112_0122347 3300048915 Bacteria 2573
242 Ga0496114_0004903 3300048917 Bacteria 10424
243 Ga0496114_0100457 3300048917 Bacteria 2469
244 Ga0496114_0361385 3300048917 Bacteria 1284
245 Ga0496114_0714376 3300048917 Bacteria 878
246 Ga0501031_0064667 3300049568 Bacteria 2382
247 Ga0501032_0090176 3300049569 Bacteria 2034
248 Ga0501032_0125906 3300049569 Bacteria 1692
249 Ga0501033_0188737 3300049570 Bacteria 1475
250 Ga0501034_0000292 3300049571 Bacteria 89524
251 Ga0501034_0076314 3300049571 Bacteria 3358
252 Ga0501034_0167525 3300049571 Bacteria 2165
253 Ga0501036_0034837 3300049572 Bacteria 4259
254 Ga0501036_0080493 3300049572 Bacteria 2754
255 Ga0501036_0087779 3300049572 Bacteria 2628
256 Ga0501037_0070481 3300049573 Bacteria 2543
257 Ga0501037_0321374 3300049573 Bacteria 1071
258 Ga0501038_0034335 3300049574 Bacteria 4460
259 Ga0501038_0043549 3300049574 Bacteria 3902
260 Ga0501039_0019397 3300049575 Bacteria 5212
261 Ga0501039_0080705 3300049575 Bacteria 2531
262 Ga0501039_0316142 3300049575 Bacteria 1228
263 Ga0501039_0508778 3300049575 Bacteria 945
264 Ga0501040_0015073 3300049576 Bacteria 5107
265 Ga0501040_0021421 3300049576 Bacteria 4318
266 Ga0501040_0031065 3300049576 Bacteria 3608
267 Ga0501040_0110719 3300049576 Bacteria 1920
268 Ga0501041_0020031 3300049577 Bacteria 3996
269 Ga0501041_0083852 3300049577 Bacteria 1964
270 Ga0501042_0001751 3300049578 Bacteria 12972
271 Ga0501042_0026907 3300049578 Bacteria 4042
272 Ga0501042_0108750 3300049578 Bacteria 1996
273 Ga0501042_0228692 3300049578 Bacteria 1341
274 Ga0501042_0235709 3300049578 Bacteria 1320
275 Ga0501043_0013646 3300049579 Bacteria 6357
276 Ga0501043_0085673 3300049579 Bacteria 2476
277 Ga0501043_0156186 3300049579 Bacteria 1784
278 Ga0501043_0337702 3300049579 Bacteria 1146
279 Ga0501046_0075648 3300049580 Bacteria 2610
280 Ga0501046_0076087 3300049580 Bacteria 2601
281 Ga0501046_0077431 3300049580 Bacteria 2574
282 Ga0501046_0137091 3300049580 Bacteria 1853
283 Ga0501047_0073021 3300049581 Bacteria 3303
284 Ga0501048_0005810 3300049582 Bacteria 9385
285 Ga0501048_0028295 3300049582 Bacteria 4068
286 Ga0501048_0111974 3300049582 Bacteria 1927
287 Ga0501048_0113563 3300049582 Bacteria 1913
288 Ga0501067_0039750 3300049583 Bacteria 2612
289 Ga0501067_0105325 3300049583 Bacteria 1567
290 Ga0501068_0047324 3300049584 Bacteria 2594
291 Ga0501068_0057995 3300049584 Bacteria 2348
292 Ga0501068_0228819 3300049584 Bacteria 1182
293 Ga0501069_0151460 3300049585 Bacteria 1333
294 Ga0501070_0049970 3300049586 Bacteria 3472
295 Ga0501070_0189601 3300049586 Bacteria 1690
296 Ga0501071_0015604 3300049587 Bacteria 5216
297 Ga0501071_0048036 3300049587 Bacteria 3068
298 Ga0501071_0085299 3300049587 Bacteria 2315
299 Ga0501071_0161745 3300049587 Bacteria 1673
300 Ga0501072_0040157 3300049588 Bacteria 3674
301 Ga0501072_0042473 3300049588 Bacteria 3571
302 Ga0501072_0084372 3300049588 Bacteria 2518
303 Ga0501072_0101653 3300049588 Bacteria 2285
304 Ga0501072_0143591 3300049588 Bacteria 1903
305 Ga0501072_0409892 3300049588 Bacteria 1075
306 Ga0501073_0089884 3300049589 Bacteria 2135
307 Ga0501074_0007490 3300049590 Bacteria 7896
308 Ga0501074_0017041 3300049590 Bacteria 5270
309 Ga0501075_0001502 3300049591 Bacteria 15206
310 Ga0501075_0042691 3300049591 Bacteria 3400
311 Ga0501075_0043405 3300049591 Bacteria 3372
312 Ga0501075_0479467 3300049591 Bacteria 949
313 Ga0501075_0535702 3300049591 Bacteria 894
314 Ga0501076_0002623 3300049592 Bacteria 12391
315 Ga0501076_0041796 3300049592 Bacteria 3608
316 Ga0501076_0048141 3300049592 Bacteria 3370
317 Ga0501076_0060047 3300049592 Bacteria 3024
318 Ga0501076_0121725 3300049592 Bacteria 2113
319 Ga0501077_0039651 3300049593 Bacteria 3000
320 Ga0501077_0105747 3300049593 Bacteria 1783
321 Ga0501079_0023310 3300049741 Bacteria 4751
322 Ga0501079_0083916 3300049741 Bacteria 2464
323 Ga0501079_0096252 3300049741 Bacteria 2294
324 Ga0501079_0105329 3300049741 Bacteria 2188
325 Ga0501079_0272963 3300049741 Bacteria 1322
326 Ga0501079_0301717 3300049741 Bacteria 1253
327 Ga0501079_0379549 3300049741 Bacteria 1108
328 Ga0501080_0019081 3300049742 Bacteria 6349
329 Ga0501080_0020100 3300049742 Bacteria 6179
330 Ga0501080_0993525 3300049742 Bacteria 728
331 Ga0501081_0137041 3300049743 Bacteria 1752
332 Ga0501081_0150237 3300049743 Bacteria 1673
333 Ga0501081_0263375 3300049743 Bacteria 1260
334 Ga0501081_0334619 3300049743 Bacteria 1114
335 Ga0501083_0091407 3300049744 Bacteria 2009
336 Ga0501035_0013057 3300049822 Bacteria 7664
337 Ga0501035_0219652 3300049822 Bacteria 1623
338 Ga0501035_0269869 3300049822 Bacteria 1440
339 Ga0501044_0266928 3300049823 Bacteria 1648
340 Ga0501045_0017756 3300049824 Bacteria 5051
341 Ga0501045_0024438 3300049824 Bacteria 4338
342 Ga0501045_0112857 3300049824 Bacteria 2015
343 Ga0501045_0118674 3300049824 Bacteria 1963
344 Ga0501045_0146326 3300049824 Bacteria 1758
345 nmdc:mga00v17_3231_c1 3300050491 Bacteria 8392
346 nmdc:mga0yw44_308178_c1 3300050492 Bacteria 1062
347 nmdc:mga06z11_184022_c1 3300050494 Bacteria 1206
348 nmdc:mga05p37_103245_c1 3300050507 Bacteria 3510
349 nmdc:mga05p37_3107_c1 3300050507 Bacteria 19296
350 nmdc:mga05p37_35969_c1 3300050507 Bacteria 6076
351 nmdc:mga05p37_38044_c1 3300050507 Bacteria 5901
352 nmdc:mga05p37_49122_c1 3300050507 Bacteria 5190
353 nmdc:mga05p37_910557_c1 3300050507 Bacteria 947
354 nmdc:mga09592_15818_c1 3300050508 Bacteria 6165
355 nmdc:mga09592_19665_c1 3300050508 Bacteria 5546
356 nmdc:mga09592_26390_c1 3300050508 Bacteria 4812
357 nmdc:mga0qj67_13248_c1 3300050509 Bacteria 6222
358 nmdc:mga0qj67_3911_c1 3300050509 Bacteria 10767
359 nmdc:mga06r32_193206_c1 3300050510 Bacteria 2023
360 nmdc:mga06r32_256985_c1 3300050510 Bacteria 1735
361 nmdc:mga06r32_79162_c1 3300050510 Bacteria 3197
362 nmdc:mga08y16_287424_c1 3300050511 Bacteria 1695
363 nmdc:mga08y16_467458_c1 3300050511 Bacteria 1285
364 nmdc:mga08y16_57183_c1 3300050511 Bacteria 4077
365 nmdc:mga0n895_1780_c1 3300050512 Bacteria 16335
366 nmdc:mga0n895_189675_c1 3300050512 Bacteria 2087
367 nmdc:mga0n895_74413_c1 3300050512 Bacteria 3374
368 nmdc:mga0rr50_2332_c1 3300050513 Bacteria 10667
369 nmdc:mga0a205_1886_c1 3300050515 Bacteria 18188
370 nmdc:mga0a205_29385_c1 3300050515 Bacteria 5260
371 nmdc:mga0a205_40467_c1 3300050515 Bacteria 4487
372 Ga0495601_0000814 3300053077 Bacteria 16892
373 Ga0495655_0049637 3300053083 Bacteria 1106
374 Ga0495655_0097986 3300053083 Bacteria 864
375 Ga0495595_0057921 3300053084 Bacteria 1808
376 Ga0495619_0279749 3300053085 Bacteria 1156
377 Ga0501084_0032449 3300054114 Bacteria 4369
378 Ga0501084_0043455 3300054114 Bacteria 3759
379 Ga0501084_0099516 3300054114 Bacteria 2441
380 Ga0501084_0189424 3300054114 Bacteria 1735
381 Ga0501084_0211209 3300054114 Bacteria 1638
382 Ga0501084_0257108 3300054114 Bacteria 1474
383 Ga0501082_0009965 3300060353 Bacteria 8192
384 Ga0501082_0041567 3300060353 Bacteria 3963
385 Ga0501082_0112049 3300060353 Bacteria 2362
386 Ga0501082_0161917 3300060353 Bacteria 1944
387 Ga0530510_0016555 3300061734 Bacteria 5220
388 Ga0530510_0060604 3300061734 Bacteria 2739
389 Ga0530510_0106375 3300061734 Bacteria 2053
390 Ga0530510_0134983 3300061734 Bacteria 1816
391 Ga0530510_0560338 3300061734 Bacteria 868
392 Ga0207691_10441591
393 JGI24751J29686_10000324
394 JGI24751J29686_10014275
395 Ga0070676_10323027
396 Ga0070683_100054592
397 Ga0070670_100036781
398 Ga0070670_100135092
399 Ga0070661_100040073
400 Ga0070692_10011062
401 Ga0070675_100173259
402 Ga0070675_100235933
403 Ga0070688_100401910
404 Ga0070659_100177684
405 Ga0070703_10065372
406 Ga0070711_100031425
407 Ga0070708_100009623
408 Ga0070663_100078413
409 Ga0070681_10225076
410 Ga0070685_10529641
411 Ga0070706_100010740
412 Ga0070707_100546465
413 Ga0070698_100022052
414 Ga0070698_100072847
415 Ga0070698_100131582
416 Ga0070699_100089028
417 Ga0070699_100594407
418 Ga0070684_100032698
419 Ga0070697_100425657
420 Ga0070672_100333299
421 Ga0070664_100006335
422 Ga0068857_100048244
423 Ga0068857_100488695
424 Ga0068854_100481446
425 Ga0068859_100878262
426 Ga0068861_100410024
427 Ga0068870_10003427
428 Ga0068863_100008184
429 Ga0068860_100004081
430 Ga0068860_100314579
431 Ga0068862_100023995
432 Ga0081455_10005484
433 Ga0081455_10009550
434 Ga0081455_10051742
435 Ga0081539_10031829
436 Ga0081539_10130186
437 Ga0075365_10285918
438 Ga0075432_10001810
439 Ga0070715_10007709
440 Ga0070712_100027929
441 Ga0075367_10174167
442 Ga0075367_10447211
443 Ga0075428_100094668
444 Ga0075428_100183888
445 Ga0075430_100001556
446 Ga0075430_100022793
447 Ga0075430_100258141
448 Ga0075430_100363145
449 Ga0075431_100001850
450 Ga0075431_100006773
451 Ga0075431_100398660
452 Ga0075433_10004550
453 Ga0075433_10006691
454 Ga0075433_10052799
455 Ga0075434_100019715
456 Ga0075434_100029474
457 Ga0075434_100044025
458 Ga0075429_100000304
459 Ga0075429_100005938
460 Ga0075429_100089916
461 Ga0068865_100277592
462 Ga0075436_100019917
463 Ga0097620_100878239
464 Ga0075435_100001781
465 Ga0105251_10028884
466 Ga0105251_10035248
467 Ga0111539_10021077
468 Ga0111539_10252759
469 Ga0111539_10525806
470 Ga0111539_10560155
471 Ga0111539_10839116
472 Ga0111539_11313533
473 Ga0105245_10119023
474 Ga0105245_10244253
475 Ga0105245_10514449
476 Ga0105247_10058921
477 Ga0114129_10001808
478 Ga0114129_10006997
479 Ga0114129_10028952
480 Ga0114129_10041419
481 Ga0114129_10445590
482 Ga0114129_10821157
483 Ga0105243_10013594
484 Ga0105243_10017267
485 Ga0105243_10089001
486 Ga0105243_10149867
487 Ga0105242_10184359
488 Ga0105249_10933457
489 Ga0105239_10490648
490 Ga0105246_10021335
491 Ga0105246_10034119
492 Ga0157378_10218392
493 Ga0163162_10870226
494 Ga0157375_10328189
495 Ga0163163_10038747
496 Ga0163163_10052260
497 Ga0157380_10185353
498 Ga0157380_10445825
499 Ga0157377_10015109
500 Ga0157379_10075189
501 Ga0213876_10012355
502 Ga0207710_10061465
503 Ga0207688_10110061
504 Ga0207688_10396619
505 Ga0207647_10195874
506 Ga0207685_10011099
507 Ga0207645_10258097
508 Ga0207643_10009889
509 Ga0207684_10203842
510 Ga0207693_10001872
511 Ga0207663_10067317
512 Ga0207649_10095237
513 Ga0207681_10101705
514 Ga0207650_10077808
515 Ga0207659_10016676
516 Ga0207659_10083296
517 Ga0207659_10153209
518 Ga0207659_10238719
519 Ga0207687_10516745
520 Ga0207644_10465618
521 Ga0207690_10074454
522 Ga0207706_10145477
523 Ga0207709_10020183
524 Ga0207709_10030155
525 Ga0207709_10070886
526 Ga0207709_10245960
527 Ga0207669_10161543
528 Ga0207669_10465390
529 Ga0207665_10009492
530 Ga0207661_10286290
531 Ga0207679_10005135
532 Ga0207678_10099841
533 Ga0207708_10141576
534 Ga0207641_10002656
535 Ga0207676_10006401
536 Ga0207674_10005191
537 Ga0207674_10048272
538 Ga0207674_10502311
539 Ga0207675_100009083
540 Ga0207675_100164266
541 Ga0207675_100697899
542 Ga0207428_10000843
543 Ga0207428_10014817
544 Ga0268265_10128377
545 Ga0268265_10147275
546 Ga0268264_10046496
547 Ga0307415_100088100
548 Ga0373926_0001057
549 Ga0373944_0012798
550 Ga0316574_0297684
551 Ga0373924_0030656
552 Ga0373931_0014559
553 Ga0373947_0242199
554 Ga0316584_0248158
555 Ga0373925_0012746
556 Ga0395900_0046480
557 Ga0395900_0181360
558 Ga0395898_0405300
559 Ga0395898_0606567
560 Ga0395905_0124361
561 Ga0395905_0292250
562 Ga0395905_0345297
563 Ga0395901_0003598
564 Ga0395901_0242514
565 Ga0400485_14074
566 Ga0400483_022363
567 Ga0400483_024877
568 Ga0400483_096070
569 Ga0400483_131791
570 Ga0400483_138411
571 Ga0400483_153519
572 Ga0400483_211169
573 Ga0400483_258594
574 Ga0436365_1796488
575 Ga0451837_0391415
576 Ga0439448_0010917
577 Ga0439463_006917
578 Ga0439464_0011980
579 Ga0439440_0012086
580 Ga0466967_0487807
581 Ga0466967_0797596
582 Ga0495591_053750
583 Ga0495641_0002433
584 Ga0495580_0028631
585 Ga0495580_0046325
586 Ga0495582_0001744
587 Ga0495639_0000269
588 Ga0495662_0003745
589 Ga0495584_0164883
590 Ga0495594_0040414
591 Ga0495596_0169103
592 Ga0495607_0100029
593 Ga0495608_0228558
594 Ga0495628_0388933
595 Ga0495630_0025924
596 Ga0495630_0357855
597 Ga0495665_0003797
598 Ga0495665_0110250
599 Ga0495640_0004978
600 Ga0495586_0021682
601 Ga0495598_0074774
602 Ga0495667_0075361
603 Ga0495667_0110503
604 Ga0495634_0015600
605 Ga0495634_0120290
606 Ga0495635_0002284
607 Ga0495635_0220154
608 Ga0495588_0002701
609 Ga0495588_0006334
610 Ga0495647_0000193
611 Ga0495647_0022226
612 Ga0495647_0131851
613 Ga0495658_0005403
614 Ga0495669_0132508
615 Ga0495613_0004570
616 Ga0495624_0001998
617 Ga0495581_0013661
618 Ga0495676_0012319
619 Ga0495680_0048921
620 Ga0495684_0068211
621 Ga0495593_0003013
622 Ga0495614_0013249
623 Ga0495615_0048522
624 Ga0496108_0053155
625 Ga0496108_0058667
626 Ga0496109_0020495
627 Ga0496109_0088997
628 Ga0496110_0029900
629 Ga0496110_0320572
630 Ga0496111_0036988
631 Ga0496111_0333712
632 Ga0496112_0122347
633 Ga0496114_0004903
634 Ga0496114_0100457
635 Ga0496114_0361385
636 Ga0496114_0714376
637 Ga0501031_0064667
638 Ga0501032_0090176
639 Ga0501032_0125906
640 Ga0501033_0188737
641 Ga0501034_0000292
642 Ga0501034_0076314
643 Ga0501034_0167525
644 Ga0501036_0034837
645 Ga0501036_0080493
646 Ga0501036_0087779
647 Ga0501037_0070481
648 Ga0501037_0321374
649 Ga0501038_0034335
650 Ga0501038_0043549
651 Ga0501039_0019397
652 Ga0501039_0080705
653 Ga0501039_0316142
654 Ga0501039_0508778
655 Ga0501040_0015073
656 Ga0501040_0021421
657 Ga0501040_0031065
658 Ga0501040_0110719
659 Ga0501041_0020031
660 Ga0501041_0083852
661 Ga0501042_0001751
662 Ga0501042_0026907
663 Ga0501042_0108750
664 Ga0501042_0228692
665 Ga0501042_0235709
666 Ga0501043_0013646
667 Ga0501043_0085673
668 Ga0501043_0156186
669 Ga0501043_0337702
670 Ga0501046_0075648
671 Ga0501046_0076087
672 Ga0501046_0077431
673 Ga0501046_0137091
674 Ga0501047_0073021
675 Ga0501048_0005810
676 Ga0501048_0028295
677 Ga0501048_0111974
678 Ga0501048_0113563
679 Ga0501067_0039750
680 Ga0501067_0105325
681 Ga0501068_0047324
682 Ga0501068_0057995
683 Ga0501068_0228819
684 Ga0501069_0151460
685 Ga0501070_0049970
686 Ga0501070_0189601
687 Ga0501071_0015604
688 Ga0501071_0048036
689 Ga0501071_0085299
690 Ga0501071_0161745
691 Ga0501072_0040157
692 Ga0501072_0042473
693 Ga0501072_0084372
694 Ga0501072_0101653
695 Ga0501072_0143591
696 Ga0501072_0409892
697 Ga0501073_0089884
698 Ga0501074_0007490
699 Ga0501074_0017041
700 Ga0501075_0001502
701 Ga0501075_0042691
702 Ga0501075_0043405
703 Ga0501075_0479467
704 Ga0501075_0535702
705 Ga0501076_0002623
706 Ga0501076_0041796
707 Ga0501076_0048141
708 Ga0501076_0060047
709 Ga0501076_0121725
710 Ga0501077_0039651
711 Ga0501077_0105747
712 Ga0501079_0023310
713 Ga0501079_0083916
714 Ga0501079_0096252
715 Ga0501079_0105329
716 Ga0501079_0272963
717 Ga0501079_0301717
718 Ga0501079_0379549
719 Ga0501080_0019081
720 Ga0501080_0020100
721 Ga0501080_0993525
722 Ga0501081_0137041
723 Ga0501081_0150237
724 Ga0501081_0263375
725 Ga0501081_0334619
726 Ga0501083_0091407
727 Ga0501035_0013057
728 Ga0501035_0219652
729 Ga0501035_0269869
730 Ga0501044_0266928
731 Ga0501045_0017756
732 Ga0501045_0024438
733 Ga0501045_0112857
734 Ga0501045_0118674
735 Ga0501045_0146326
736 nmdc:mga00v17_3231_c1
737 nmdc:mga0yw44_308178_c1
738 nmdc:mga06z11_184022_c1
739 nmdc:mga05p37_103245_c1
740 nmdc:mga05p37_3107_c1
741 nmdc:mga05p37_35969_c1
742 nmdc:mga05p37_38044_c1
743 nmdc:mga05p37_49122_c1
744 nmdc:mga05p37_910557_c1
745 nmdc:mga09592_15818_c1
746 nmdc:mga09592_19665_c1
747 nmdc:mga09592_26390_c1
748 nmdc:mga0qj67_13248_c1
749 nmdc:mga0qj67_3911_c1
750 nmdc:mga06r32_193206_c1
751 nmdc:mga06r32_256985_c1
752 nmdc:mga06r32_79162_c1
753 nmdc:mga08y16_287424_c1
754 nmdc:mga08y16_467458_c1
755 nmdc:mga08y16_57183_c1
756 nmdc:mga0n895_1780_c1
757 nmdc:mga0n895_189675_c1
758 nmdc:mga0n895_74413_c1
759 nmdc:mga0rr50_2332_c1
760 nmdc:mga0a205_1886_c1
761 nmdc:mga0a205_29385_c1
762 nmdc:mga0a205_40467_c1
763 Ga0495601_0000814
764 Ga0495655_0049637
765 Ga0495655_0097986
766 Ga0495595_0057921
767 Ga0495619_0279749
768 Ga0501084_0032449
769 Ga0501084_0043455
770 Ga0501084_0099516
771 Ga0501084_0189424
772 Ga0501084_0211209
773 Ga0501084_0257108
774 Ga0501082_0009965
775 Ga0501082_0041567
776 Ga0501082_0112049
777 Ga0501082_0161917
778 Ga0530510_0016555
779 Ga0530510_0060604
780 Ga0530510_0106375
781 Ga0530510_0134983
782 Ga0530510_0560338

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01255

Prenyltransf

Putative undecaprenyl diphosphate synthase

44

265

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1x07-assembly1.cif.gz_A crystal structure of undecaprenyl pyrophosphate synthase in complex with mg and ipp 0.9557 14 233
6szg-assembly1.cif.gz_A acinetobacter baumannii undecaprenyl pyrophosphate synthase (ab-upps) in complex with gr839 and gsk513 0.9532 12 233
4onc-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis decaprenyl diphosphate synthase in complex with bph-640 0.9531 8 239
2vg3-assembly1.cif.gz_A rv2361 with citronellyl pyrophosphate 0.9529 8 242
4onc-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis decaprenyl diphosphate synthase in complex with bph-640 0.95 8 242
ID Description Score Start End Superfamily
2vg2A01 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9561 8 236 3.40.1180.10
5hc7A00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9485 13 236 3.40.1180.10
af_Q5FC21_4_262_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9382 13 234 3.40.1180.10
af_A0A1D8PFD1_28_274_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9372 13 233 3.40.1180.10
2dtnB00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.936 15 242 3.40.1180.10
ID Description Score Start End GO Terms
AF-A0A4Q5R3Z9-F1-model_v4 Isoprenyl transferase 0.9635 1 236 GO:0016094
GO:0045547
GO:0046872
AF-A0A6M6E329-F1-model_v4 Isoprenyl transferase (EC 2.5.1.-) 0.9635 13 234 GO:0000287
GO:0016094
GO:0045547
AF-A0A258EU35-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.9633 5 224 GO:0016094
GO:0045547
GO:0046872
AF-A0A2H9T6S0-F1-model_v4 Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) (EC 2.5.1.31) 0.9625 1 236 GO:0000287
GO:0005829
GO:0008834
GO:0016094
GO:0045547
AF-A0A7X7KE85-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) 0.9621 7 229 GO:0008834
GO:0016094
GO:0045547
GO:0046872

Map