F432026

General Info

Members Datasets Scaffolds Average Seq Length
391 198 782 336

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10006376|Ga0157375_100063763
Length 376
Sequence MGMGVGDLQAAKIEKANWELCFTFVSFMPKFLVIRFSSIGDIVLTSPVVRCLKQQVKDAEVHFLTKKSFSAVIEHNPFIDKKIYLEGAHPNLPEGKASENPLSKLIRQLKKENYDFIIDLHHNLRTLKLKRALGVKAFSFDKLNIEKWLLVNLKINRLPDIHIVDRYMKTVASFGVMNDGKGLDYYISVEDGDAIQKLPPAFHQGYVAFVIGAKHNTKKLPDEKIISICKKINHPIVLMGGKEDFETGEKIVAALQSQTIFNACGKFSLNESAALIKFSTRVISHDTGLMHIAAAYKKEIISVWGNTIPEFGMSPYYGDFSISNLKSEVLHLSCRPCSKIGFDKCPKGHFKCMVNQDEEKIAMEANKPRPSNGFNL

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
137 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
138 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
176 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
177 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
178 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
179 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
180 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
181 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
182 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
183 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
187 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
194 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
195 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.07
Nodule 0
Rhizoplane 0.26
Rhizosphere 92.84
Stem 0
Stem Tuber 0
Unclassified 15.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10006376 3300013308 Bacteria 10285
2 rootH1_10048081 3300003316 Bacteria 5352
3 rootH2_10013092 3300003320 Bacteria 17374
4 rootH2_10054734 3300003320 Bacteria 1527
5 rootH2_10068435 3300003320 Bacteria 6132
6 rootL2_10039133 3300003322 Unclassified 3995
7 rootL2_10168763 3300003322 Unclassified 1434
8 rootL2_10172518 3300003322 Bacteria 2246
9 rootL2_10229545 3300003322 Bacteria 7017
10 JGI25160J50197_1001126 3300003354 Bacteria 13660
11 Ga0055531_10000235 3300003794 Bacteria 60560
12 Ga0065715_10022077 3300005293 Bacteria 1800
13 Ga0070658_10000230 3300005327 Bacteria 49640
14 Ga0070658_10033888 3300005327 Bacteria 4109
15 Ga0070658_10038585 3300005327 Bacteria 3851
16 Ga0070658_10048199 3300005327 Bacteria 3448
17 Ga0070676_10000156 3300005328 Bacteria 27179
18 Ga0070683_100042913 3300005329 Bacteria 4166
19 Ga0070683_100213945 3300005329 Bacteria 1831
20 Ga0070683_100225466 3300005329 Bacteria 1781
21 Ga0070670_100309159 3300005331 Bacteria 1383
22 Ga0068869_100003133 3300005334 Bacteria 10092
23 Ga0068869_100009936 3300005334 Bacteria 6184
24 Ga0070666_10000546 3300005335 Bacteria 22738
25 Ga0070680_100000390 3300005336 Bacteria 29749
26 Ga0070680_100027333 3300005336 Bacteria 4569
27 Ga0070680_100050530 3300005336 Unclassified 3391
28 Ga0070680_100059435 3300005336 Bacteria 3127
29 Ga0070682_100000044 3300005337 Bacteria 133653
30 Ga0068868_100019716 3300005338 Bacteria 5056
31 Ga0068868_100213257 3300005338 Bacteria 1614
32 Ga0070660_100000807 3300005339 Bacteria 20768
33 Ga0070660_100065005 3300005339 Bacteria 2839
34 Ga0070691_10000447 3300005341 Bacteria 15259
35 Ga0070661_100146099 3300005344 Bacteria 1785
36 Ga0070668_100000872 3300005347 Bacteria 20984
37 Ga0070668_100136440 3300005347 Bacteria 1974
38 Ga0070675_100224908 3300005354 Bacteria 1635
39 Ga0070671_100016269 3300005355 Bacteria 6016
40 Ga0070671_100126095 3300005355 Bacteria 2155
41 Ga0070674_100121354 3300005356 Bacteria 1935
42 Ga0070673_100000096 3300005364 Bacteria 39184
43 Ga0070659_100010790 3300005366 Bacteria 6738
44 Ga0070659_100021630 3300005366 Unclassified 4902
45 Ga0070667_100000248 3300005367 Bacteria 61183
46 Ga0070713_100591760 3300005436 Bacteria 1053
47 Ga0070663_100087340 3300005455 Bacteria 2305
48 Ga0070678_100023810 3300005456 Unclassified 4088
49 Ga0070678_100498676 3300005456 Bacteria 1074
50 Ga0070662_100013855 3300005457 Bacteria 5371
51 Ga0070681_10019987 3300005458 Bacteria 6709
52 Ga0070681_10024722 3300005458 Bacteria 6043
53 Ga0070681_10043616 3300005458 Unclassified 4491
54 Ga0070698_100002852 3300005471 Bacteria 19022
55 Ga0070679_100000656 3300005530 Bacteria 29462
56 Ga0070679_100005002 3300005530 Bacteria 12228
57 Ga0070679_100032589 3300005530 Bacteria 5155
58 Ga0070679_100109448 3300005530 Bacteria 2749
59 Ga0070679_100223378 3300005530 Bacteria 1844
60 Ga0070684_100000646 3300005535 Bacteria 23997
61 Ga0068853_100012619 3300005539 Bacteria 6876
62 Ga0070672_100000033 3300005543 Bacteria 61516
63 Ga0070665_100000641 3300005548 Bacteria 47468
64 Ga0068855_100002469 3300005563 Bacteria 22826
65 Ga0068855_100023619 3300005563 Bacteria 7365
66 Ga0068855_100030923 3300005563 Bacteria 6398
67 Ga0070664_100210307 3300005564 Bacteria 1738
68 Ga0068857_100032519 3300005577 Unclassified 4613
69 Ga0068857_100094240 3300005577 Unclassified 2681
70 Ga0068856_100186336 3300005614 Bacteria 2089
71 Ga0068856_100488698 3300005614 Unclassified 1252
72 Ga0068856_100562585 3300005614 Bacteria 1161
73 Ga0068852_100056677 3300005616 Bacteria 3388
74 Ga0068852_100074205 3300005616 Bacteria 2995
75 Ga0068859_100020700 3300005617 Bacteria 6601
76 Ga0068859_100094410 3300005617 Bacteria 3043
77 Ga0068864_100001018 3300005618 Bacteria 23447
78 Ga0068864_100292200 3300005618 Bacteria 1524
79 Ga0068866_10031648 3300005718 Unclassified 2550
80 Ga0068861_100133490 3300005719 Bacteria 2018
81 Ga0068851_10000882 3300005834 Bacteria 12946
82 Ga0068863_100015639 3300005841 Bacteria 7288
83 Ga0068863_100110466 3300005841 Bacteria 2618
84 Ga0068858_100000596 3300005842 Bacteria 37696
85 Ga0068858_100284670 3300005842 Bacteria 1574
86 Ga0068860_100021221 3300005843 Bacteria 6291
87 Ga0068860_100027319 3300005843 Bacteria 5498
88 Ga0068860_100088416 3300005843 Bacteria 2949
89 Ga0068860_100184684 3300005843 Unclassified 2016
90 Ga0068862_100175463 3300005844 Bacteria 1921
91 Ga0070712_100070344 3300006175 Bacteria 2500
92 Ga0075366_10043381 3300006195 Bacteria 2664
93 Ga0097621_100000167 3300006237 Bacteria 41215
94 Ga0097621_100000582 3300006237 Bacteria 25730
95 Ga0097621_100101770 3300006237 Bacteria 2418
96 Ga0068871_100000418 3300006358 Bacteria 29376
97 Ga0068871_100000764 3300006358 Bacteria 21686
98 Ga0068871_100050535 3300006358 Bacteria 3363
99 Ga0068871_100105429 3300006358 Unclassified 2365
100 Ga0068871_100158366 3300006358 Bacteria 1935
101 Ga0068871_100356038 3300006358 Bacteria 1296
102 Ga0075428_100010006 3300006844 Bacteria 10535
103 Ga0075430_100008685 3300006846 Bacteria 8574
104 Ga0068865_100005888 3300006881 Bacteria 7459
105 Ga0097620_100020700 3300006931 Bacteria 6601
106 Ga0097620_100094410 3300006931 Bacteria 3043
107 Ga0105240_10000273 3300009093 Bacteria 102198
108 Ga0105240_10007731 3300009093 Bacteria 15551
109 Ga0105240_10090991 3300009093 Bacteria 3728
110 Ga0111539_10008752 3300009094 Bacteria 12839
111 Ga0111539_10369557 3300009094 Bacteria 1669
112 Ga0105245_10173703 3300009098 Unclassified 2054
113 Ga0105245_10393255 3300009098 Bacteria 1384
114 Ga0105247_10055832 3300009101 Unclassified 2437
115 Ga0105247_10184554 3300009101 Bacteria 1394
116 Ga0105241_10000948 3300009174 Bacteria 21953
117 Ga0105242_10022970 3300009176 Bacteria 4913
118 Ga0105242_10026367 3300009176 Bacteria 4606
119 Ga0105242_10030655 3300009176 Bacteria 4294
120 Ga0105242_10551554 3300009176 Bacteria 1105
121 Ga0105248_10031247 3300009177 Bacteria 5952
122 Ga0105248_10063425 3300009177 Bacteria 4148
123 Ga0105248_10544155 3300009177 Bacteria 1310
124 Ga0105237_10004340 3300009545 Bacteria 16434
125 Ga0105237_10030017 3300009545 Bacteria 5523
126 Ga0105238_10276710 3300009551 Unclassified 1659
127 Ga0105249_10011697 3300009553 Bacteria 7719
128 Ga0105249_10020524 3300009553 Bacteria 5905
129 Ga0105249_10083659 3300009553 Bacteria 2970
130 Ga0105249_10170472 3300009553 Unclassified 2110
131 Ga0105249_10440496 3300009553 Bacteria 1340
132 Ga0105239_10005534 3300010375 Bacteria 14789
133 Ga0105239_10023071 3300010375 Bacteria 6860
134 Ga0105239_10027514 3300010375 Bacteria 6258
135 Ga0105246_10222381 3300011119 Unclassified 1481
136 Ga0157373_10000871 3300013100 Bacteria 23357
137 Ga0157373_10003764 3300013100 Bacteria 11473
138 Ga0157373_10017412 3300013100 Bacteria 5235
139 Ga0157373_10030321 3300013100 Bacteria 3891
140 Ga0157373_10180921 3300013100 Bacteria 1484
141 Ga0157371_10001002 3300013102 Bacteria 31205
142 Ga0157371_10003073 3300013102 Bacteria 15481
143 Ga0157371_10007637 3300013102 Bacteria 8718
144 Ga0157371_10010255 3300013102 Bacteria 7313
145 Ga0157371_10016925 3300013102 Bacteria 5429
146 Ga0157371_10032406 3300013102 Unclassified 3760
147 Ga0157371_10034343 3300013102 Bacteria 3638
148 Ga0157371_10037151 3300013102 Bacteria 3487
149 Ga0157371_10097435 3300013102 Bacteria 2085
150 Ga0157370_10001799 3300013104 Bacteria 26427
151 Ga0157370_10003936 3300013104 Bacteria 17285
152 Ga0157370_10013052 3300013104 Bacteria 8579
153 Ga0157370_10013268 3300013104 Bacteria 8491
154 Ga0157370_10015874 3300013104 Bacteria 7641
155 Ga0157370_10351146 3300013104 Bacteria 1359
156 Ga0157369_10021375 3300013105 Bacteria 7238
157 Ga0157369_10045717 3300013105 Unclassified 4760
158 Ga0157369_10094845 3300013105 Unclassified 3185
159 Ga0157369_10106081 3300013105 Unclassified 2990
160 Ga0157369_10153171 3300013105 Unclassified 2436
161 Ga0157369_10277680 3300013105 Bacteria 1745
162 Ga0157369_10310298 3300013105 Bacteria 1640
163 Ga0157374_10000266 3300013296 Bacteria 48468
164 Ga0157374_10074475 3300013296 Bacteria 3206
165 Ga0157374_10117496 3300013296 Bacteria 2563
166 Ga0157374_10285709 3300013296 Bacteria 1629
167 Ga0157378_10008516 3300013297 Bacteria 8928
168 Ga0157378_10010678 3300013297 Bacteria 8026
169 Ga0157378_10070624 3300013297 Bacteria 3136
170 Ga0157378_10276688 3300013297 Bacteria 1616
171 Ga0163162_10000114 3300013306 Bacteria 71183
172 Ga0163162_10000397 3300013306 Bacteria 39878
173 Ga0163162_10027798 3300013306 Bacteria 5595
174 Ga0163162_10036426 3300013306 Bacteria 4904
175 Ga0163162_10148970 3300013306 Bacteria 2457
176 Ga0163162_10669216 3300013306 Bacteria 1161
177 Ga0157372_10000683 3300013307 Bacteria 37283
178 Ga0157372_10013757 3300013307 Bacteria 8645
179 Ga0157372_10041690 3300013307 Bacteria 5074
180 Ga0157372_10055977 3300013307 Unclassified 4406
181 Ga0157372_10088006 3300013307 Bacteria 3526
182 Ga0157372_10149389 3300013307 Unclassified 2696
183 Ga0157372_10151783 3300013307 Bacteria 2674
184 Ga0157372_10175596 3300013307 Bacteria 2479
185 Ga0157372_10261291 3300013307 Unclassified 2010
186 Ga0157372_10337747 3300013307 Bacteria 1755
187 Ga0157372_10338153 3300013307 Bacteria 1753
188 Ga0157375_10000346 3300013308 Bacteria 41874
189 Ga0157375_10000569 3300013308 Bacteria 33134
190 Ga0157375_10088640 3300013308 Bacteria 3149
191 Ga0157375_10381215 3300013308 Unclassified 1577
192 Ga0163163_10000912 3300014325 Bacteria 25059
193 Ga0163163_10005890 3300014325 Bacteria 10665
194 Ga0163163_10272973 3300014325 Bacteria 1742
195 Ga0157380_10008241 3300014326 Bacteria 7427
196 Ga0157380_10126214 3300014326 Bacteria 2175
197 Ga0157380_10129300 3300014326 Bacteria 2152
198 Ga0157380_10151014 3300014326 Bacteria 2008
199 Ga0157379_10000229 3300014968 Bacteria 43909
200 Ga0157379_10089427 3300014968 Bacteria 2762
201 Ga0157379_10120181 3300014968 Bacteria 2363
202 Ga0157376_10000117 3300014969 Bacteria 56126
203 Ga0157376_10005117 3300014969 Bacteria 9140
204 Ga0157376_10081806 3300014969 Bacteria 2773
205 Ga0157376_10260847 3300014969 Unclassified 1623
206 Ga0157376_10320985 3300014969 Bacteria 1472
207 Ga0163161_10003009 3300017792 Bacteria 11911
208 Ga0207426_1000230 3300025302 Bacteria 128357
209 Ga0209257_1000023 3300025304 Bacteria 753019
210 Ga0207656_10000261 3300025321 Bacteria 18358
211 Ga0207682_10012999 3300025893 Bacteria 3245
212 Ga0207710_10038450 3300025900 Unclassified 2115
213 Ga0207680_10004001 3300025903 Bacteria 6964
214 Ga0207680_10017982 3300025903 Bacteria 3745
215 Ga0207647_10000279 3300025904 Bacteria 41622
216 Ga0207647_10020994 3300025904 Bacteria 4367
217 Ga0207645_10000836 3300025907 Bacteria 25657
218 Ga0207643_10017895 3300025908 Bacteria 3881
219 Ga0207705_10012519 3300025909 Bacteria 6125
220 Ga0207705_10015008 3300025909 Bacteria 5570
221 Ga0207705_10090749 3300025909 Bacteria 2237
222 Ga0207705_10275331 3300025909 Bacteria 1287
223 Ga0207654_10000832 3300025911 Bacteria 16989
224 Ga0207707_10001200 3300025912 Bacteria 24391
225 Ga0207707_10154782 3300025912 Bacteria 2005
226 Ga0207695_10000130 3300025913 Bacteria 224214
227 Ga0207695_10004710 3300025913 Bacteria 18478
228 Ga0207671_10078153 3300025914 Bacteria 2478
229 Ga0207660_10000111 3300025917 Bacteria 46780
230 Ga0207660_10037227 3300025917 Bacteria 3389
231 Ga0207660_10210833 3300025917 Bacteria 1521
232 Ga0207657_10002612 3300025919 Bacteria 19465
233 Ga0207657_10053973 3300025919 Bacteria 3478
234 Ga0207657_10140929 3300025919 Bacteria 1970
235 Ga0207652_10000093 3300025921 Bacteria 98248
236 Ga0207652_10000275 3300025921 Bacteria 53349
237 Ga0207652_10000460 3300025921 Bacteria 42038
238 Ga0207652_10000768 3300025921 Bacteria 30720
239 Ga0207650_10012303 3300025925 Bacteria 5905
240 Ga0207650_10084644 3300025925 Bacteria 2411
241 Ga0207650_10108373 3300025925 Bacteria 2147
242 Ga0207687_10108053 3300025927 Unclassified 2059
243 Ga0207644_10110655 3300025931 Unclassified 2076
244 Ga0207644_10118881 3300025931 Bacteria 2009
245 Ga0207690_10008148 3300025932 Bacteria 6219
246 Ga0207706_10012970 3300025933 Bacteria 7585
247 Ga0207686_10010589 3300025934 Bacteria 5025
248 Ga0207686_10033542 3300025934 Unclassified 3066
249 Ga0207686_10078781 3300025934 Bacteria 2144
250 Ga0207686_10084257 3300025934 Bacteria 2082
251 Ga0207686_10092871 3300025934 Bacteria 1997
252 Ga0207704_10002674 3300025938 Bacteria 8040
253 Ga0207704_10379118 3300025938 Bacteria 1110
254 Ga0207691_10000001 3300025940 Bacteria 220829
255 Ga0207691_10114540 3300025940 Bacteria 2395
256 Ga0207711_10020211 3300025941 Bacteria 5549
257 Ga0207689_10004326 3300025942 Bacteria 12934
258 Ga0207689_10005568 3300025942 Bacteria 11246
259 Ga0207689_10020199 3300025942 Bacteria 5610
260 Ga0207661_10035676 3300025944 Bacteria 3877
261 Ga0207679_10196402 3300025945 Bacteria 1682
262 Ga0207667_10000131 3300025949 Bacteria 115088
263 Ga0207667_10025850 3300025949 Bacteria 6423
264 Ga0207667_10055144 3300025949 Unclassified 4179
265 Ga0207651_10002426 3300025960 Bacteria 8910
266 Ga0207712_10011203 3300025961 Bacteria 5709
267 Ga0207712_10014298 3300025961 Bacteria 5102
268 Ga0207668_10000263 3300025972 Bacteria 35099
269 Ga0207658_10028714 3300025986 Bacteria 3921
270 Ga0207677_10096649 3300026023 Bacteria 2162
271 Ga0207703_10003862 3300026035 Bacteria 12452
272 Ga0207703_10120219 3300026035 Bacteria 2254
273 Ga0207639_10040799 3300026041 Unclassified 3467
274 Ga0207678_10077374 3300026067 Unclassified 2850
275 Ga0207678_10112038 3300026067 Bacteria 2328
276 Ga0207702_10105153 3300026078 Bacteria 2500
277 Ga0207702_10170418 3300026078 Bacteria 1996
278 Ga0207641_10000756 3300026088 Bacteria 34796
279 Ga0207641_10001344 3300026088 Bacteria 24357
280 Ga0207676_10005739 3300026095 Bacteria 8782
281 Ga0207676_10065779 3300026095 Bacteria 2888
282 Ga0207676_10514535 3300026095 Bacteria 1139
283 Ga0207674_10425567 3300026116 Bacteria 1283
284 Ga0207675_100180549 3300026118 Unclassified 2021
285 Ga0207683_10032828 3300026121 Bacteria 4510
286 Ga0207683_10056710 3300026121 Unclassified 3437
287 Ga0207428_10292712 3300027907 Bacteria 1206
288 Ga0268266_10001506 3300028379 Bacteria 27540
289 Ga0268264_10004599 3300028381 Bacteria 11728
290 Ga0268264_10020031 3300028381 Bacteria 5465
291 Ga0268264_10159762 3300028381 Bacteria 2029
292 Ga0307515_10000557 3300028794 Bacteria 87964
293 Ga0307515_10051738 3300028794 Bacteria 6114
294 Ga0307515_10189572 3300028794 Bacteria 1972
295 Ga0265320_10093838 3300031240 Unclassified 1388
296 Ga0265331_10024268 3300031250 Bacteria 3070
297 Ga0265327_10000609 3300031251 Bacteria 59168
298 Ga0307509_10073664 3300031507 Bacteria 3555
299 Ga0307508_10000413 3300031616 Bacteria 50697
300 Ga0307507_10212579 3300033179 Unclassified 1316
301 Ga0373937_0073461 3300036401 Bacteria 3155
302 Ga0373937_0211729 3300036401 Bacteria 1824
303 Ga0373925_0185539 3300037068 Unclassified 1649
304 Ga0395899_0000025 3300037312 Bacteria 350927
305 Ga0395899_0028470 3300037312 Bacteria 4206
306 Ga0395900_0001975 3300037418 Bacteria 23148
307 Ga0395900_0020410 3300037418 Bacteria 6764
308 Ga0395900_0054782 3300037418 Bacteria 4106
309 Ga0395900_0055523 3300037418 Unclassified 4078
310 Ga0395900_0090668 3300037418 Unclassified 3142
311 Ga0395900_0131233 3300037418 Bacteria 2567
312 Ga0395900_0169454 3300037418 Unclassified 2224
313 Ga0395898_0000794 3300037466 Bacteria 53591
314 Ga0395898_0020721 3300037466 Bacteria 6675
315 Ga0395898_0053545 3300037466 Bacteria 3941
316 Ga0395905_0000001 3300037471 Bacteria 2037079
317 Ga0395905_0002388 3300037471 Bacteria 20901
318 Ga0395905_0066442 3300037471 Bacteria 3377
319 Ga0395905_0080252 3300037471 Bacteria 3058
320 Ga0395905_0290083 3300037471 Unclassified 1523
321 Ga0395901_0003291 3300038443 Bacteria 16267
322 Ga0395901_0010422 3300038443 Bacteria 9416
323 Ga0436365_1732478 3300039437 Bacteria 27077
324 Ga0450923_023725 3300042125 Bacteria 1212
325 Ga0451577_0011267 3300042876 Bacteria 8470
326 Ga0451577_0027064 3300042876 Bacteria 5192
327 Ga0451577_0071406 3300042876 Bacteria 3096
328 Ga0466972_0000050 3300044658 Bacteria 118759
329 Ga0453683_0025846 3300044673 Bacteria 3728
330 Ga0453684_0004908 3300044712 Bacteria 27376
331 Ga0453684_0031949 3300044712 Bacteria 7381
332 Ga0453684_0068773 3300044712 Bacteria 4495
333 Ga0453684_0162133 3300044712 Bacteria 2643
334 Ga0466970_0020546 3300044765 Unclassified 3432
335 Ga0451576_0001369 3300045051 Bacteria 41890
336 Ga0451576_0009790 3300045051 Bacteria 11078
337 Ga0495592_0147653 3300046454 Unclassified 1629
338 Ga0495629_0094921 3300046459 Bacteria 2081
339 Ga0495638_0118566 3300046460 Bacteria 1566
340 Ga0495580_0054774 3300046472 Bacteria 2812
341 Ga0495582_0011723 3300046473 Bacteria 4831
342 Ga0495586_0053610 3300046535 Unclassified 2185
343 Ga0495668_0001964 3300046616 Bacteria 18112
344 Ga0495647_0043193 3300046681 Bacteria 1724
345 Ga0495670_0007434 3300046691 Bacteria 5378
346 Ga0495674_0205603 3300047319 Unclassified 1632
347 Ga0495674_0503397 3300047319 Bacteria 969
348 Ga0495684_0075114 3300047471 Unclassified 2568
349 Ga0495686_0000034 3300047472 Bacteria 325038
350 Ga0495593_0160746 3300047673 Unclassified 1134
351 Ga0496109_0068074 3300048912 Unclassified 3263
352 Ga0501034_0019729 3300049571 Bacteria 6890
353 Ga0501034_0467662 3300049571 Bacteria 1177
354 Ga0501036_0034684 3300049572 Unclassified 4268
355 Ga0501037_0012117 3300049573 Bacteria 6349
356 Ga0501047_0122125 3300049581 Bacteria 2486
357 Ga0501047_0229362 3300049581 Bacteria 1711
358 Ga0501047_0249904 3300049581 Unclassified 1622
359 Ga0501048_0090864 3300049582 Unclassified 2154
360 Ga0501071_0166481 3300049587 Unclassified 1650
361 Ga0501073_0056054 3300049589 Unclassified 2757
362 Ga0501207_012693 3300049654 Bacteria 1269
363 Ga0501223_007038 3300049663 Unclassified 2310
364 Ga0501240_000743 3300049673 Unclassified 2864
365 Ga0501243_005564 3300049675 Bacteria 1894
366 Ga0501250_000078 3300049680 Bacteria 4896
367 Ga0501259_001609 3300049688 Bacteria 3766
368 Ga0501219_000914 3300049703 Bacteria 3606
369 Ga0501225_0017222 3300049705 Unclassified 2005
370 Ga0501245_000348 3300049708 Bacteria 5539
371 Ga0501245_013653 3300049708 Bacteria 1205
372 Ga0501079_0118758 3300049741 Unclassified 2056
373 Ga0501083_0020190 3300049744 Bacteria 4635
374 Ga0501241_006684 3300049758 Bacteria 2118
375 Ga0501266_001207 3300049763 Unclassified 3306
376 Ga0501035_0034771 3300049822 Bacteria 4578
377 Ga0501035_0041093 3300049822 Bacteria 4176
378 Ga0501044_0007122 3300049823 Bacteria 12299
379 Ga0501044_0010121 3300049823 Bacteria 10247
380 Ga0501284_00016 3300050005 Bacteria 97390
381 nmdc:mga0k408_40495_c1 3300050493 Bacteria 2681
382 nmdc:mga0k408_49552_c1 3300050493 Bacteria 2431
383 nmdc:mga0k408_8897_c1 3300050493 Bacteria 5401
384 nmdc:mga08y16_12456_c1 3300050511 Bacteria 8946
385 nmdc:mga08y16_250287_c1 3300050511 Bacteria 1831
386 Ga0500578_0000131 3300053086 Bacteria 89434
387 Ga0500646_0002639 3300053090 Bacteria 4641
388 Ga0500604_0017947 3300053151 Bacteria 1966
389 Ga0500616_0006533 3300053153 Bacteria 7620
390 Ga0501084_0074447 3300054114 Unclassified 2843
391 2881955528 2881955468 Bacteria 3545609
392 Ga0157375_10006376
393 rootH1_10048081
394 rootH2_10013092
395 rootH2_10054734
396 rootH2_10068435
397 rootL2_10039133
398 rootL2_10168763
399 rootL2_10172518
400 rootL2_10229545
401 JGI25160J50197_1001126
402 Ga0055531_10000235
403 Ga0065715_10022077
404 Ga0070658_10000230
405 Ga0070658_10033888
406 Ga0070658_10038585
407 Ga0070658_10048199
408 Ga0070676_10000156
409 Ga0070683_100042913
410 Ga0070683_100213945
411 Ga0070683_100225466
412 Ga0070670_100309159
413 Ga0068869_100003133
414 Ga0068869_100009936
415 Ga0070666_10000546
416 Ga0070680_100000390
417 Ga0070680_100027333
418 Ga0070680_100050530
419 Ga0070680_100059435
420 Ga0070682_100000044
421 Ga0068868_100019716
422 Ga0068868_100213257
423 Ga0070660_100000807
424 Ga0070660_100065005
425 Ga0070691_10000447
426 Ga0070661_100146099
427 Ga0070668_100000872
428 Ga0070668_100136440
429 Ga0070675_100224908
430 Ga0070671_100016269
431 Ga0070671_100126095
432 Ga0070674_100121354
433 Ga0070673_100000096
434 Ga0070659_100010790
435 Ga0070659_100021630
436 Ga0070667_100000248
437 Ga0070713_100591760
438 Ga0070663_100087340
439 Ga0070678_100023810
440 Ga0070678_100498676
441 Ga0070662_100013855
442 Ga0070681_10019987
443 Ga0070681_10024722
444 Ga0070681_10043616
445 Ga0070698_100002852
446 Ga0070679_100000656
447 Ga0070679_100005002
448 Ga0070679_100032589
449 Ga0070679_100109448
450 Ga0070679_100223378
451 Ga0070684_100000646
452 Ga0068853_100012619
453 Ga0070672_100000033
454 Ga0070665_100000641
455 Ga0068855_100002469
456 Ga0068855_100023619
457 Ga0068855_100030923
458 Ga0070664_100210307
459 Ga0068857_100032519
460 Ga0068857_100094240
461 Ga0068856_100186336
462 Ga0068856_100488698
463 Ga0068856_100562585
464 Ga0068852_100056677
465 Ga0068852_100074205
466 Ga0068859_100020700
467 Ga0068859_100094410
468 Ga0068864_100001018
469 Ga0068864_100292200
470 Ga0068866_10031648
471 Ga0068861_100133490
472 Ga0068851_10000882
473 Ga0068863_100015639
474 Ga0068863_100110466
475 Ga0068858_100000596
476 Ga0068858_100284670
477 Ga0068860_100021221
478 Ga0068860_100027319
479 Ga0068860_100088416
480 Ga0068860_100184684
481 Ga0068862_100175463
482 Ga0070712_100070344
483 Ga0075366_10043381
484 Ga0097621_100000167
485 Ga0097621_100000582
486 Ga0097621_100101770
487 Ga0068871_100000418
488 Ga0068871_100000764
489 Ga0068871_100050535
490 Ga0068871_100105429
491 Ga0068871_100158366
492 Ga0068871_100356038
493 Ga0075428_100010006
494 Ga0075430_100008685
495 Ga0068865_100005888
496 Ga0097620_100020700
497 Ga0097620_100094410
498 Ga0105240_10000273
499 Ga0105240_10007731
500 Ga0105240_10090991
501 Ga0111539_10008752
502 Ga0111539_10369557
503 Ga0105245_10173703
504 Ga0105245_10393255
505 Ga0105247_10055832
506 Ga0105247_10184554
507 Ga0105241_10000948
508 Ga0105242_10022970
509 Ga0105242_10026367
510 Ga0105242_10030655
511 Ga0105242_10551554
512 Ga0105248_10031247
513 Ga0105248_10063425
514 Ga0105248_10544155
515 Ga0105237_10004340
516 Ga0105237_10030017
517 Ga0105238_10276710
518 Ga0105249_10011697
519 Ga0105249_10020524
520 Ga0105249_10083659
521 Ga0105249_10170472
522 Ga0105249_10440496
523 Ga0105239_10005534
524 Ga0105239_10023071
525 Ga0105239_10027514
526 Ga0105246_10222381
527 Ga0157373_10000871
528 Ga0157373_10003764
529 Ga0157373_10017412
530 Ga0157373_10030321
531 Ga0157373_10180921
532 Ga0157371_10001002
533 Ga0157371_10003073
534 Ga0157371_10007637
535 Ga0157371_10010255
536 Ga0157371_10016925
537 Ga0157371_10032406
538 Ga0157371_10034343
539 Ga0157371_10037151
540 Ga0157371_10097435
541 Ga0157370_10001799
542 Ga0157370_10003936
543 Ga0157370_10013052
544 Ga0157370_10013268
545 Ga0157370_10015874
546 Ga0157370_10351146
547 Ga0157369_10021375
548 Ga0157369_10045717
549 Ga0157369_10094845
550 Ga0157369_10106081
551 Ga0157369_10153171
552 Ga0157369_10277680
553 Ga0157369_10310298
554 Ga0157374_10000266
555 Ga0157374_10074475
556 Ga0157374_10117496
557 Ga0157374_10285709
558 Ga0157378_10008516
559 Ga0157378_10010678
560 Ga0157378_10070624
561 Ga0157378_10276688
562 Ga0163162_10000114
563 Ga0163162_10000397
564 Ga0163162_10027798
565 Ga0163162_10036426
566 Ga0163162_10148970
567 Ga0163162_10669216
568 Ga0157372_10000683
569 Ga0157372_10013757
570 Ga0157372_10041690
571 Ga0157372_10055977
572 Ga0157372_10088006
573 Ga0157372_10149389
574 Ga0157372_10151783
575 Ga0157372_10175596
576 Ga0157372_10261291
577 Ga0157372_10337747
578 Ga0157372_10338153
579 Ga0157375_10000346
580 Ga0157375_10000569
581 Ga0157375_10088640
582 Ga0157375_10381215
583 Ga0163163_10000912
584 Ga0163163_10005890
585 Ga0163163_10272973
586 Ga0157380_10008241
587 Ga0157380_10126214
588 Ga0157380_10129300
589 Ga0157380_10151014
590 Ga0157379_10000229
591 Ga0157379_10089427
592 Ga0157379_10120181
593 Ga0157376_10000117
594 Ga0157376_10005117
595 Ga0157376_10081806
596 Ga0157376_10260847
597 Ga0157376_10320985
598 Ga0163161_10003009
599 Ga0207426_1000230
600 Ga0209257_1000023
601 Ga0207656_10000261
602 Ga0207682_10012999
603 Ga0207710_10038450
604 Ga0207680_10004001
605 Ga0207680_10017982
606 Ga0207647_10000279
607 Ga0207647_10020994
608 Ga0207645_10000836
609 Ga0207643_10017895
610 Ga0207705_10012519
611 Ga0207705_10015008
612 Ga0207705_10090749
613 Ga0207705_10275331
614 Ga0207654_10000832
615 Ga0207707_10001200
616 Ga0207707_10154782
617 Ga0207695_10000130
618 Ga0207695_10004710
619 Ga0207671_10078153
620 Ga0207660_10000111
621 Ga0207660_10037227
622 Ga0207660_10210833
623 Ga0207657_10002612
624 Ga0207657_10053973
625 Ga0207657_10140929
626 Ga0207652_10000093
627 Ga0207652_10000275
628 Ga0207652_10000460
629 Ga0207652_10000768
630 Ga0207650_10012303
631 Ga0207650_10084644
632 Ga0207650_10108373
633 Ga0207687_10108053
634 Ga0207644_10110655
635 Ga0207644_10118881
636 Ga0207690_10008148
637 Ga0207706_10012970
638 Ga0207686_10010589
639 Ga0207686_10033542
640 Ga0207686_10078781
641 Ga0207686_10084257
642 Ga0207686_10092871
643 Ga0207704_10002674
644 Ga0207704_10379118
645 Ga0207691_10000001
646 Ga0207691_10114540
647 Ga0207711_10020211
648 Ga0207689_10004326
649 Ga0207689_10005568
650 Ga0207689_10020199
651 Ga0207661_10035676
652 Ga0207679_10196402
653 Ga0207667_10000131
654 Ga0207667_10025850
655 Ga0207667_10055144
656 Ga0207651_10002426
657 Ga0207712_10011203
658 Ga0207712_10014298
659 Ga0207668_10000263
660 Ga0207658_10028714
661 Ga0207677_10096649
662 Ga0207703_10003862
663 Ga0207703_10120219
664 Ga0207639_10040799
665 Ga0207678_10077374
666 Ga0207678_10112038
667 Ga0207702_10105153
668 Ga0207702_10170418
669 Ga0207641_10000756
670 Ga0207641_10001344
671 Ga0207676_10005739
672 Ga0207676_10065779
673 Ga0207676_10514535
674 Ga0207674_10425567
675 Ga0207675_100180549
676 Ga0207683_10032828
677 Ga0207683_10056710
678 Ga0207428_10292712
679 Ga0268266_10001506
680 Ga0268264_10004599
681 Ga0268264_10020031
682 Ga0268264_10159762
683 Ga0307515_10000557
684 Ga0307515_10051738
685 Ga0307515_10189572
686 Ga0265320_10093838
687 Ga0265331_10024268
688 Ga0265327_10000609
689 Ga0307509_10073664
690 Ga0307508_10000413
691 Ga0307507_10212579
692 Ga0373937_0073461
693 Ga0373937_0211729
694 Ga0373925_0185539
695 Ga0395899_0000025
696 Ga0395899_0028470
697 Ga0395900_0001975
698 Ga0395900_0020410
699 Ga0395900_0054782
700 Ga0395900_0055523
701 Ga0395900_0090668
702 Ga0395900_0131233
703 Ga0395900_0169454
704 Ga0395898_0000794
705 Ga0395898_0020721
706 Ga0395898_0053545
707 Ga0395905_0000001
708 Ga0395905_0002388
709 Ga0395905_0066442
710 Ga0395905_0080252
711 Ga0395905_0290083
712 Ga0395901_0003291
713 Ga0395901_0010422
714 Ga0436365_1732478
715 Ga0450923_023725
716 Ga0451577_0011267
717 Ga0451577_0027064
718 Ga0451577_0071406
719 Ga0466972_0000050
720 Ga0453683_0025846
721 Ga0453684_0004908
722 Ga0453684_0031949
723 Ga0453684_0068773
724 Ga0453684_0162133
725 Ga0466970_0020546
726 Ga0451576_0001369
727 Ga0451576_0009790
728 Ga0495592_0147653
729 Ga0495629_0094921
730 Ga0495638_0118566
731 Ga0495580_0054774
732 Ga0495582_0011723
733 Ga0495586_0053610
734 Ga0495668_0001964
735 Ga0495647_0043193
736 Ga0495670_0007434
737 Ga0495674_0205603
738 Ga0495674_0503397
739 Ga0495684_0075114
740 Ga0495686_0000034
741 Ga0495593_0160746
742 Ga0496109_0068074
743 Ga0501034_0019729
744 Ga0501034_0467662
745 Ga0501036_0034684
746 Ga0501037_0012117
747 Ga0501047_0122125
748 Ga0501047_0229362
749 Ga0501047_0249904
750 Ga0501048_0090864
751 Ga0501071_0166481
752 Ga0501073_0056054
753 Ga0501207_012693
754 Ga0501223_007038
755 Ga0501240_000743
756 Ga0501243_005564
757 Ga0501250_000078
758 Ga0501259_001609
759 Ga0501219_000914
760 Ga0501225_0017222
761 Ga0501245_000348
762 Ga0501245_013653
763 Ga0501079_0118758
764 Ga0501083_0020190
765 Ga0501241_006684
766 Ga0501266_001207
767 Ga0501035_0034771
768 Ga0501035_0041093
769 Ga0501044_0007122
770 Ga0501044_0010121
771 Ga0501284_00016
772 nmdc:mga0k408_40495_c1
773 nmdc:mga0k408_49552_c1
774 nmdc:mga0k408_8897_c1
775 nmdc:mga08y16_12456_c1
776 nmdc:mga08y16_250287_c1
777 Ga0500578_0000131
778 Ga0500646_0002639
779 Ga0500604_0017947
780 Ga0500616_0006533
781 Ga0501084_0074447
782 2881955528

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01075

Glyco_transf_9

Glycosyltransferase family 9 (heptosyltransferase)

102

341

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tov-assembly1.cif.gz_A the crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008 0.7871 2 289
3tov-assembly2.cif.gz_B the crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008 0.7609 2 313
2h1f-assembly2.cif.gz_B e. coli heptosyltransferase waac with adp 0.7502 1 287
3tov-assembly2.cif.gz_B the crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008 0.7344 2 313
6dfe-assembly1.cif.gz_A the structure of a ternary complex of e. coli waac 0.7332 1 287
ID Description Score Start End Superfamily
af_I1KVM5_139_276_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8445 15 98 3.40.50.2000
af_P25742_154_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8374 164 286 3.40.50.2000
2h1fB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7975 160 287 3.40.50.2000
af_P27242_36_183_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7594 2 133 3.40.50.2000
af_A0A0N7KD23_75_238_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.758 3 94 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A3C0IST5-F1-model_v4 Glycosyl transferase 0.9829 2 132 GO:0005829
GO:0008713
GO:0009244
AF-A0A1Q3GGP6-F1-model_v4 Glycosyl transferase 0.9814 2 323 GO:0005829
GO:0008713
GO:0009244
AF-A0A3C0R934-F1-model_v4 Glycosyl transferase 0.9786 1 203 GO:0005829
GO:0008713
GO:0009244
AF-A0A7W1PVN0-F1-model_v4 Glycosyltransferase family 9 protein 0.9756 2 255 GO:0005829
GO:0008713
GO:0009244
AF-A0A3D4IQW0-F1-model_v4 Glycosyl transferase 0.9756 1 146 GO:0005829
GO:0008713
GO:0009244

Map