F432009

General Info

Members Datasets Scaffolds Average Seq Length
391 230 388 125

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10026360|Ga0105237_100263602
Length 144
Sequence MNYGWRGAADFLCERIGEGMSIPAKHHNAAFLALVNDAKKRIREVDIGQYQAMKDQPHLLVDVREDNEWSAGHAAGSIHLGKGIIERDIEAKVPDKNATLVLYCGGGYRSALAADALRQMGYSNAISLDGGWRAWQNAGLPIEK

Samples

Sample ID Description Type Environment
1 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
2 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
3 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
133 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
145 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
148 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
160 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0.26
Isolates 0.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.3
Rhizosphere 96.42
Stem 0
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058860_11341985 3300004801 Unclassified 601
2 Ga0065715_10513451 3300005293 Bacteria 769
3 Ga0070658_10159498 3300005327 Bacteria 1892
4 Ga0070676_10246628 3300005328 Bacteria 1190
5 Ga0070683_100025322 3300005329 Bacteria 5327
6 Ga0070683_100129355 3300005329 Bacteria 2389
7 Ga0070690_100043069 3300005330 Bacteria 2861
8 Ga0070670_100096224 3300005331 Bacteria 2547
9 Ga0070670_100151773 3300005331 Bacteria 2005
10 Ga0070670_101625939 3300005331 Bacteria 594
11 Ga0068869_100005828 3300005334 Bacteria 7775
12 Ga0070666_10064660 3300005335 Bacteria 2481
13 Ga0070680_100651651 3300005336 Unclassified 905
14 Ga0070682_100132576 3300005337 Bacteria 1688
15 Ga0068868_100137045 3300005338 Bacteria 2007
16 Ga0070668_100767208 3300005347 Bacteria 855
17 Ga0070669_100199112 3300005353 Bacteria 1575
18 Ga0070669_101027905 3300005353 Bacteria 708
19 Ga0070675_100346677 3300005354 Bacteria 1316
20 Ga0070671_100130714 3300005355 Bacteria 2115
21 Ga0070674_100231550 3300005356 Bacteria 1442
22 Ga0070673_100574824 3300005364 Bacteria 1026
23 Ga0070659_100034708 3300005366 Bacteria 3925
24 Ga0070667_100015830 3300005367 Bacteria 6240
25 Ga0070667_100099008 3300005367 Bacteria 2516
26 Ga0070709_10260424 3300005434 Bacteria 1253
27 Ga0070709_10712394 3300005434 Bacteria 782
28 Ga0070713_100500245 3300005436 Bacteria 1147
29 Ga0070710_10936522 3300005437 Unclassified 627
30 Ga0070711_101750473 3300005439 Unclassified 545
31 Ga0070694_100189015 3300005444 Bacteria 1528
32 Ga0070694_101328933 3300005444 Bacteria 605
33 Ga0070708_100075056 3300005445 Bacteria 3051
34 Ga0070662_101153455 3300005457 Bacteria 665
35 Ga0070681_10330057 3300005458 Bacteria 1435
36 Ga0070681_10593421 3300005458 Bacteria 1022
37 Ga0068867_100124727 3300005459 Bacteria 1994
38 Ga0068867_100321176 3300005459 Bacteria 1283
39 Ga0068867_100435042 3300005459 Bacteria 1114
40 Ga0070699_100037095 3300005518 Bacteria 4218
41 Ga0070679_100568215 3300005530 Bacteria 1078
42 Ga0070679_102113071 3300005530 Unclassified 513
43 Ga0070684_100037470 3300005535 Bacteria 4159
44 Ga0070684_100070608 3300005535 Bacteria 3073
45 Ga0070684_100350164 3300005535 Bacteria 1358
46 Ga0070684_102150147 3300005535 Unclassified 527
47 Ga0070697_101051953 3300005536 Unclassified 724
48 Ga0068853_100070678 3300005539 Bacteria 3039
49 Ga0068853_100116005 3300005539 Bacteria 2384
50 Ga0068853_101653481 3300005539 Unclassified 621
51 Ga0070686_100646431 3300005544 Unclassified 838
52 Ga0070693_100061028 3300005547 Bacteria 2191
53 Ga0070693_100522465 3300005547 Unclassified 845
54 Ga0070665_100174663 3300005548 Bacteria 2149
55 Ga0070665_101079055 3300005548 Bacteria 815
56 Ga0070704_100820438 3300005549 Bacteria 832
57 Ga0070704_101397598 3300005549 Unclassified 642
58 Ga0068855_100006847 3300005563 Bacteria 13828
59 Ga0068855_101054860 3300005563 Bacteria 852
60 Ga0070664_100090862 3300005564 Bacteria 2643
61 Ga0070664_101614828 3300005564 Bacteria 614
62 Ga0068857_100006766 3300005577 Bacteria 9863
63 Ga0068856_100102673 3300005614 Bacteria 2853
64 Ga0068852_101122617 3300005616 Unclassified 806
65 Ga0068859_100195469 3300005617 Bacteria 2107
66 Ga0068859_101198487 3300005617 Bacteria 836
67 Ga0068864_100057181 3300005618 Bacteria 3369
68 Ga0068864_100260598 3300005618 Bacteria 1613
69 Ga0068863_100103054 3300005841 Bacteria 2714
70 Ga0068858_100102129 3300005842 Bacteria 2675
71 Ga0068860_100014146 3300005843 Bacteria 7826
72 Ga0068860_100200886 3300005843 Bacteria 1932
73 Ga0068860_100865990 3300005843 Bacteria 919
74 Ga0070717_10010183 3300006028 Bacteria 7080
75 Ga0070717_10574347 3300006028 Bacteria 1022
76 Ga0070716_100843727 3300006173 Bacteria 713
77 Ga0070716_100880347 3300006173 Unclassified 700
78 Ga0097621_100036132 3300006237 Bacteria 3952
79 Ga0097621_100068060 3300006237 Bacteria 2936
80 Ga0068871_100008615 3300006358 Bacteria 7335
81 Ga0068871_100012989 3300006358 Bacteria 6168
82 Ga0068871_100093769 3300006358 Bacteria 2505
83 Ga0068871_100606601 3300006358 Bacteria 996
84 Ga0068871_101767308 3300006358 Bacteria 587
85 Ga0075430_100299316 3300006846 Bacteria 1330
86 Ga0075436_100001822 3300006914 Bacteria 14616
87 Ga0075436_100251603 3300006914 Bacteria 1258
88 Ga0097620_100195466 3300006931 Bacteria 2107
89 Ga0097620_101198911 3300006931 Bacteria 836
90 Ga0075435_100210361 3300007076 Bacteria 1650
91 Ga0105240_10324010 3300009093 Bacteria 1755
92 Ga0105240_11529835 3300009093 Unclassified 699
93 Ga0105245_10041304 3300009098 Bacteria 4111
94 Ga0105245_10283402 3300009098 Bacteria 1620
95 Ga0105245_10665046 3300009098 Bacteria 1072
96 Ga0105247_10315867 3300009101 Unclassified 1088
97 Ga0114129_10144167 3300009147 Unclassified 3263
98 Ga0114129_13092717 3300009147 Unclassified 544
99 Ga0105243_10198764 3300009148 Bacteria 1757
100 Ga0105241_10712399 3300009174 Bacteria 917
101 Ga0105242_10028570 3300009176 Bacteria 4442
102 Ga0105242_10273382 3300009176 Bacteria 1531
103 Ga0105242_10580076 3300009176 Bacteria 1080
104 Ga0105242_11195662 3300009176 Bacteria 779
105 Ga0105242_11215922 3300009176 Unclassified 773
106 Ga0105242_12327942 3300009176 Unclassified 582
107 Ga0105248_10007297 3300009177 Bacteria 12130
108 Ga0105248_10248423 3300009177 Bacteria 2003
109 Ga0105248_10359585 3300009177 Bacteria 1639
110 Ga0105248_10502086 3300009177 Bacteria 1368
111 Ga0105248_10751555 3300009177 Bacteria 1100
112 Ga0105248_11907619 3300009177 Bacteria 674
113 Ga0105237_10022512 3300009545 Bacteria 6465
114 Ga0105237_10026360 3300009545 Bacteria 5940
115 Ga0105237_10609384 3300009545 Bacteria 1099
116 Ga0105237_10625210 3300009545 Bacteria 1084
117 Ga0105237_10832164 3300009545 Bacteria 930
118 Ga0105238_10016238 3300009551 Bacteria 7535
119 Ga0105238_10746562 3300009551 Unclassified 992
120 Ga0105249_11029050 3300009553 Bacteria 893
121 Ga0105249_11468945 3300009553 Bacteria 754
122 Ga0105239_10003447 3300010375 Bacteria 19363
123 Ga0105239_10020463 3300010375 Bacteria 7299
124 Ga0105239_10029693 3300010375 Bacteria 6012
125 Ga0157370_10035548 3300013104 Bacteria 4841
126 Ga0157374_10016349 3300013296 Bacteria 6517
127 Ga0157374_10118709 3300013296 Bacteria 2551
128 Ga0157374_10283126 3300013296 Unclassified 1637
129 Ga0157374_10415277 3300013296 Unclassified 1344
130 Ga0157378_10184499 3300013297 Bacteria 1964
131 Ga0157378_10662237 3300013297 Unclassified 1060
132 Ga0163162_10538466 3300013306 Bacteria 1296
133 Ga0163162_11573287 3300013306 Unclassified 750
134 Ga0163162_11953324 3300013306 Bacteria 672
135 Ga0163162_12118424 3300013306 Bacteria 645
136 Ga0157372_10003719 3300013307 Bacteria 16388
137 Ga0157372_10509916 3300013307 Bacteria 1402
138 Ga0157372_10791362 3300013307 Bacteria 1102
139 Ga0157375_10615190 3300013308 Bacteria 1245
140 Ga0163163_10024255 3300014325 Bacteria 5771
141 Ga0163163_11393347 3300014325 Bacteria 763
142 Ga0157380_10065371 3300014326 Bacteria 2923
143 Ga0157376_10155285 3300014969 Bacteria 2068
144 Ga0213872_10000315 3300021361 Bacteria 41197
145 Ga0207642_10213616 3300025899 Bacteria 1073
146 Ga0207642_10973088 3300025899 Bacteria 546
147 Ga0207710_10101954 3300025900 Bacteria 1354
148 Ga0207680_10062242 3300025903 Bacteria 2279
149 Ga0207645_10213618 3300025907 Bacteria 1271
150 Ga0207645_10564262 3300025907 Bacteria 772
151 Ga0207645_10627014 3300025907 Unclassified 730
152 Ga0207654_10131247 3300025911 Bacteria 1586
153 Ga0207654_10604270 3300025911 Bacteria 783
154 Ga0207707_10587130 3300025912 Bacteria 944
155 Ga0207707_10889840 3300025912 Bacteria 737
156 Ga0207695_10011914 3300025913 Bacteria 10473
157 Ga0207695_10225482 3300025913 Bacteria 1780
158 Ga0207671_10026203 3300025914 Bacteria 4371
159 Ga0207671_10470796 3300025914 Bacteria 1001
160 Ga0207663_10232730 3300025916 Bacteria 1347
161 Ga0207660_10282909 3300025917 Unclassified 1317
162 Ga0207649_10624571 3300025920 Bacteria 830
163 Ga0207652_10322147 3300025921 Bacteria 1395
164 Ga0207652_11052378 3300025921 Unclassified 713
165 Ga0207646_11374386 3300025922 Bacteria 615
166 Ga0207681_10862172 3300025923 Bacteria 758
167 Ga0207681_11201180 3300025923 Bacteria 637
168 Ga0207694_10014432 3300025924 Bacteria 5956
169 Ga0207694_10070175 3300025924 Bacteria 2737
170 Ga0207650_10199651 3300025925 Bacteria 1601
171 Ga0207650_10882316 3300025925 Bacteria 759
172 Ga0207659_10314917 3300025926 Bacteria 1289
173 Ga0207687_10042990 3300025927 Bacteria 3112
174 Ga0207687_10192058 3300025927 Bacteria 1590
175 Ga0207700_10191673 3300025928 Bacteria 1718
176 Ga0207700_10441182 3300025928 Bacteria 1146
177 Ga0207644_10197761 3300025931 Bacteria 1584
178 Ga0207690_10057782 3300025932 Bacteria 2622
179 Ga0207686_10005551 3300025934 Bacteria 6760
180 Ga0207686_10176385 3300025934 Bacteria 1512
181 Ga0207686_10693645 3300025934 Bacteria 809
182 Ga0207686_10924039 3300025934 Unclassified 705
183 Ga0207709_10278557 3300025935 Bacteria 1234
184 Ga0207670_11834642 3300025936 Bacteria 516
185 Ga0207669_10628423 3300025937 Unclassified 876
186 Ga0207704_10414698 3300025938 Bacteria 1066
187 Ga0207711_10214803 3300025941 Bacteria 1758
188 Ga0207711_10570320 3300025941 Bacteria 1056
189 Ga0207689_10013052 3300025942 Bacteria 7094
190 Ga0207661_10014038 3300025944 Bacteria 5860
191 Ga0207661_10202372 3300025944 Bacteria 1746
192 Ga0207661_11794693 3300025944 Bacteria 559
193 Ga0207679_10290889 3300025945 Bacteria 1404
194 Ga0207667_10077591 3300025949 Bacteria 3445
195 Ga0207651_11790062 3300025960 Bacteria 553
196 Ga0207668_10159930 3300025972 Bacteria 1754
197 Ga0207668_11384018 3300025972 Bacteria 634
198 Ga0207640_10338798 3300025981 Bacteria 1204
199 Ga0207658_10319684 3300025986 Bacteria 1343
200 Ga0207658_10563656 3300025986 Unclassified 1020
201 Ga0207658_10935785 3300025986 Bacteria 790
202 Ga0207677_10044210 3300026023 Bacteria 2966
203 Ga0207703_10056355 3300026035 Bacteria 3201
204 Ga0207703_10387736 3300026035 Bacteria 1294
205 Ga0207703_10757512 3300026035 Bacteria 925
206 Ga0207639_10009582 3300026041 Bacteria 6686
207 Ga0207639_10095758 3300026041 Bacteria 2387
208 Ga0207639_10598431 3300026041 Unclassified 1017
209 Ga0207678_11169669 3300026067 Bacteria 681
210 Ga0207702_10422278 3300026078 Bacteria 1290
211 Ga0207702_12107213 3300026078 Bacteria 554
212 Ga0207641_10086465 3300026088 Bacteria 2734
213 Ga0207641_10624614 3300026088 Bacteria 1057
214 Ga0207648_10049231 3300026089 Bacteria 3688
215 Ga0207648_10794532 3300026089 Bacteria 881
216 Ga0207648_11233110 3300026089 Bacteria 702
217 Ga0207648_11310339 3300026089 Bacteria 680
218 Ga0207676_10283526 3300026095 Bacteria 1505
219 Ga0207676_11851891 3300026095 Unclassified 602
220 Ga0207676_12079954 3300026095 Unclassified 566
221 Ga0207674_10004305 3300026116 Bacteria 17168
222 Ga0207683_10359464 3300026121 Bacteria 1337
223 Ga0207683_10778576 3300026121 Bacteria 888
224 Ga0268264_10320181 3300028381 Bacteria 1466
225 Ga0268264_12495350 3300028381 Bacteria 522
226 Ga0265336_10179345 3300028666 Bacteria 630
227 Ga0265338_10088434 3300028800 Bacteria 2570
228 Ga0265330_10354639 3300031235 Bacteria 619
229 Ga0265332_10018285 3300031238 Bacteria 3092
230 Ga0265332_10022597 3300031238 Bacteria 2775
231 Ga0265320_10010127 3300031240 Bacteria 5633
232 Ga0265329_10176896 3300031242 Bacteria 697
233 Ga0265339_10068192 3300031249 Bacteria 1902
234 Ga0265331_10058634 3300031250 Bacteria 1822
235 Ga0265331_10318573 3300031250 Bacteria 696
236 Ga0265316_10007390 3300031344 Bacteria 10354
237 Ga0265316_10008222 3300031344 Bacteria 9709
238 Ga0265316_10030412 3300031344 Bacteria 4427
239 Ga0265316_10347807 3300031344 Bacteria 1073
240 Ga0265316_10867083 3300031344 Bacteria 631
241 Ga0265313_10197898 3300031595 Unclassified 837
242 Ga0265314_10006803 3300031711 Bacteria 10019
243 Ga0265314_10044411 3300031711 Bacteria 3151
244 Ga0265314_10181822 3300031711 Bacteria 1259
245 Ga0265314_10451611 3300031711 Bacteria 684
246 Ga0265342_10010946 3300031712 Bacteria 6238
247 Ga0265342_10088551 3300031712 Bacteria 1777
248 Ga0265342_10134642 3300031712 Bacteria 1382
249 Ga0373926_0038176 3300035083 Bacteria 1710
250 Ga0373926_0044869 3300035083 Unclassified 1584
251 Ga0373934_0020308 3300035086 Bacteria 2552
252 Ga0373923_0012571 3300035111 Bacteria 3134
253 Ga0373923_0544647 3300035111 Unclassified 568
254 Ga0373936_0244825 3300035113 Bacteria 800
255 Ga0373945_0467236 3300035116 Unclassified 559
256 Ga0373953_0018705 3300035117 Bacteria 2567
257 Ga0373953_0041948 3300035117 Bacteria 1822
258 Ga0373953_0367804 3300035117 Bacteria 631
259 Ga0373954_0004570 3300035118 Bacteria 5963
260 Ga0373954_0023864 3300035118 Bacteria 2786
261 Ga0373954_0101078 3300035118 Bacteria 1391
262 Ga0373956_0175282 3300035119 Bacteria 1013
263 Ga0373957_0026234 3300035120 Bacteria 2106
264 Ga0373943_0099821 3300035170 Bacteria 1516
265 Ga0373924_0326325 3300035410 Bacteria 683
266 Ga0373931_0133918 3300035691 Bacteria 1429
267 Ga0373935_0066214 3300035692 Bacteria 2320
268 Ga0373935_0322589 3300035692 Bacteria 1096
269 Ga0373927_0006230 3300035695 Bacteria 8144
270 Ga0373927_0013400 3300035695 Bacteria 5449
271 Ga0373927_0169762 3300035695 Bacteria 1430
272 Ga0373927_0520617 3300035695 Bacteria 786
273 Ga0373927_0639427 3300035695 Bacteria 703
274 Ga0373933_0067296 3300035724 Bacteria 2173
275 Ga0373933_0682137 3300035724 Bacteria 675
276 Ga0373947_0002350 3300035725 Bacteria 11442
277 Ga0373947_0054143 3300035725 Bacteria 2421
278 Ga0373947_0427685 3300035725 Bacteria 895
279 Ga0373947_0723372 3300035725 Bacteria 679
280 Ga0373937_0013556 3300036401 Bacteria 7182
281 Ga0373937_0018835 3300036401 Bacteria 6172
282 Ga0373937_0512774 3300036401 Bacteria 1139
283 Ga0316584_0783349 3300036712 Unclassified 649
284 Ga0373925_0000116 3300037068 Bacteria 85656
285 Ga0373925_0026817 3300037068 Bacteria 4218
286 Ga0373925_0050681 3300037068 Bacteria 3097
287 Ga0436364_1396354 3300037853 Bacteria 1128
288 Ga0436360_1055376 3300039438 Bacteria 815
289 Ga0436361_0146780 3300039447 Unclassified 551
290 Ga0436361_0371060 3300039447 Unclassified 849
291 Ga0436362_1134939 3300039453 Bacteria 708
292 Ga0451577_0399217 3300042876 Bacteria 1248
293 Ga0466961_0557647 3300044693 Unclassified 690
294 Ga0466970_0811484 3300044765 Unclassified 548
295 Ga0466957_0199366 3300044842 Unclassified 1314
296 Ga0466957_0764140 3300044842 Bacteria 685
297 Ga0451576_0337594 3300045051 Bacteria 1577
298 Ga0451576_0441494 3300045051 Bacteria 1366
299 Ga0451576_1910783 3300045051 Unclassified 612
300 Ga0451576_1978248 3300045051 Unclassified 601
301 Ga0451576_2552796 3300045051 Bacteria 521
302 Ga0466958_0736669 3300045836 Unclassified 642
303 Ga0495592_0031768 3300046454 Bacteria 3988
304 Ga0495651_0480392 3300046462 Bacteria 798
305 Ga0495580_0019930 3300046472 Bacteria 4972
306 Ga0495580_0085771 3300046472 Bacteria 2193
307 Ga0495580_0100766 3300046472 Bacteria 2009
308 Ga0495580_0119989 3300046472 Bacteria 1826
309 Ga0495580_0124777 3300046472 Bacteria 1787
310 Ga0495582_0003535 3300046473 Bacteria 8804
311 Ga0495582_0394624 3300046473 Bacteria 798
312 Ga0495582_0420877 3300046473 Bacteria 771
313 Ga0495594_0076129 3300046499 Bacteria 1871
314 Ga0495608_0337478 3300046511 Bacteria 929
315 Ga0495628_0152161 3300046516 Bacteria 1762
316 Ga0495666_0069084 3300046526 Bacteria 1681
317 Ga0495652_0144758 3300046529 Bacteria 1865
318 Ga0495652_0401802 3300046529 Bacteria 970
319 Ga0495665_0088075 3300046531 Unclassified 1632
320 Ga0495665_0178910 3300046531 Bacteria 1102
321 Ga0495586_0141149 3300046535 Bacteria 1352
322 Ga0495586_0607099 3300046535 Unclassified 632
323 Ga0495586_0727803 3300046535 Bacteria 573
324 Ga0495587_0178648 3300046536 Bacteria 1204
325 Ga0495587_0434112 3300046536 Bacteria 728
326 Ga0495667_0435938 3300046559 Bacteria 824
327 Ga0495634_0115186 3300046642 Bacteria 1725
328 Ga0495635_0685733 3300046663 Bacteria 665
329 Ga0495635_0785464 3300046663 Bacteria 614
330 Ga0495657_0424165 3300046675 Bacteria 781
331 Ga0495599_0237023 3300046678 Bacteria 1113
332 Ga0495623_0114299 3300046679 Bacteria 1632
333 Ga0495623_0127288 3300046679 Bacteria 1529
334 Ga0495647_0028143 3300046681 Bacteria 2071
335 Ga0495658_0011548 3300046683 Bacteria 4447
336 Ga0495613_0080243 3300046689 Bacteria 2372
337 Ga0495613_0203565 3300046689 Bacteria 1395
338 Ga0495624_0108552 3300046690 Bacteria 1707
339 Ga0495604_0162523 3300047317 Bacteria 1577
340 Ga0495604_0249581 3300047317 Bacteria 1210
341 Ga0495674_0373171 3300047319 Bacteria 1155
342 Ga0495675_0130293 3300047444 Bacteria 1563
343 Ga0495675_0143453 3300047444 Bacteria 1479
344 Ga0495675_0405765 3300047444 Bacteria 794
345 Ga0495684_0069097 3300047471 Bacteria 2686
346 Ga0495602_0024043 3300048088 Bacteria 5918
347 Ga0495602_0410409 3300048088 Bacteria 964
348 Ga0495602_0700075 3300048088 Unclassified 688
349 Ga0496104_0102669 3300048907 Bacteria 2739
350 Ga0496104_0611746 3300048907 Bacteria 1000
351 Ga0496104_0667234 3300048907 Bacteria 948
352 Ga0496109_0771998 3300048912 Bacteria 899
353 Ga0496109_1279262 3300048912 Bacteria 670
354 Ga0496112_0013152 3300048915 Bacteria 7637
355 Ga0496112_0539106 3300048915 Bacteria 1101
356 Ga0496114_0615400 3300048917 Unclassified 957
357 Ga0496115_0155669 3300048918 Bacteria 1888
358 Ga0496123_0121291 3300048926 Bacteria 1470
359 Ga0501032_0000837 3300049569 Bacteria 25024
360 Ga0501033_0148515 3300049570 Bacteria 1692
361 Ga0501034_0102071 3300049571 Bacteria 2861
362 Ga0501036_0011297 3300049572 Bacteria 7387
363 Ga0501037_0006399 3300049573 Bacteria 8618
364 Ga0501039_0007586 3300049575 Bacteria 8284
365 Ga0501043_0005570 3300049579 Bacteria 10146
366 Ga0501046_0000591 3300049580 Bacteria 35671
367 Ga0501048_0011743 3300049582 Bacteria 6529
368 Ga0501067_0015339 3300049583 Bacteria 4240
369 Ga0501068_0002241 3300049584 Bacteria 10291
370 Ga0501069_0000329 3300049585 Bacteria 21365
371 Ga0501070_0061031 3300049586 Bacteria 3124
372 Ga0501072_0001356 3300049588 Bacteria 18370
373 Ga0501073_0000929 3300049589 Bacteria 21018
374 Ga0501074_0099135 3300049590 Bacteria 2085
375 Ga0501076_0028731 3300049592 Bacteria 4321
376 Ga0501077_0001401 3300049593 Bacteria 14499
377 Ga0501080_0000466 3300049742 Bacteria 31417
378 Ga0501083_0337383 3300049744 Bacteria 980
379 Ga0501035_0008952 3300049822 Bacteria 9314
380 Ga0501044_1202651 3300049823 Bacteria 626
381 nmdc:mga05p37_117794_c1 3300050507 Unclassified 3263
382 nmdc:mga08y16_751174_c1 3300050511 Bacteria 971
383 nmdc:mga0rr50_295114_c1 3300050513 Bacteria 1355
384 nmdc:mga08x19_1578_c1 3300050514 Bacteria 14135
385 Ga0495601_0385815 3300053077 Bacteria 909
386 Ga0501084_0005349 3300054114 Bacteria 10518
387 Ga0501084_0082369 3300054114 Bacteria 2700
388 Ga0501082_0009950 3300060353 Bacteria 8199

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048926 Ga0496123_0121291 Ga0496123_0121291_555_917 117
2 3300006028 Ga0070717_10574347 Ga0070717_105743471 118
3 iso_pu_bacteria 2919493220 2919496344 118
4 iso_pu_bacteria 2919543075 2919544236 118
5 iso_pu_bacteria 2923525760 2923528863 118
6 3300005437 Ga0070710_10936522 Ga0070710_109365222 119
7 3300005439 Ga0070711_101750473 Ga0070711_1017504731 119
8 3300006173 Ga0070716_100843727 Ga0070716_1008437271 119
9 3300006914 Ga0075436_100251603 Ga0075436_1002516032 119
10 3300005329 Ga0070683_100025322 Ga0070683_1000253223 120
11 3300005329 Ga0070683_100129355 Ga0070683_1001293553 120
12 3300005330 Ga0070690_100043069 Ga0070690_1000430691 120
13 3300005334 Ga0068869_100005828 Ga0068869_1000058285 120
14 3300005335 Ga0070666_10064660 Ga0070666_100646603 120
15 3300005336 Ga0070680_100651651 Ga0070680_1006516512 120
16 3300005337 Ga0070682_100132576 Ga0070682_1001325762 120
17 3300005338 Ga0068868_100137045 Ga0068868_1001370452 120
18 3300005355 Ga0070671_100130714 Ga0070671_1001307142 120
19 3300005356 Ga0070674_100231550 Ga0070674_1002315502 120
20 3300005366 Ga0070659_100034708 Ga0070659_1000347083 120
21 3300005367 Ga0070667_100015830 Ga0070667_1000158306 120
22 3300005434 Ga0070709_10260424 Ga0070709_102604242 120
23 3300005458 Ga0070681_10593421 Ga0070681_105934212 120
24 3300005459 Ga0068867_100124727 Ga0068867_1001247272 120
25 3300005459 Ga0068867_100321176 Ga0068867_1003211762 120
26 3300005459 Ga0068867_100435042 Ga0068867_1004350423 120
27 3300005530 Ga0070679_100568215 Ga0070679_1005682151 120
28 3300005530 Ga0070679_102113071 Ga0070679_1021130711 120
29 3300005535 Ga0070684_100037470 Ga0070684_1000374702 120
30 3300005535 Ga0070684_100070608 Ga0070684_1000706082 120
31 3300005535 Ga0070684_100350164 Ga0070684_1003501642 120
32 3300005535 Ga0070684_102150147 Ga0070684_1021501471 120
33 3300005539 Ga0068853_100070678 Ga0068853_1000706783 120
34 3300005539 Ga0068853_100116005 Ga0068853_1001160053 120
35 3300005539 Ga0068853_101653481 Ga0068853_1016534811 120
36 3300005544 Ga0070686_100646431 Ga0070686_1006464312 120
37 3300005547 Ga0070693_100061028 Ga0070693_1000610283 120
38 3300005548 Ga0070665_100174663 Ga0070665_1001746632 120
39 3300005563 Ga0068855_100006847 Ga0068855_1000068479 120
40 3300005563 Ga0068855_101054860 Ga0068855_1010548601 120
41 3300005564 Ga0070664_100090862 Ga0070664_1000908623 120
42 3300005577 Ga0068857_100006766 Ga0068857_1000067664 120
43 3300005614 Ga0068856_100102673 Ga0068856_1001026732 120
44 3300005616 Ga0068852_101122617 Ga0068852_1011226171 120
45 3300005617 Ga0068859_100195469 Ga0068859_1001954692 120
46 3300005618 Ga0068864_100057181 Ga0068864_1000571814 120
47 3300005618 Ga0068864_100260598 Ga0068864_1002605982 120
48 3300005841 Ga0068863_100103054 Ga0068863_1001030542 120
49 3300005842 Ga0068858_100102129 Ga0068858_1001021293 120
50 3300005843 Ga0068860_100014146 Ga0068860_1000141462 120
51 3300005843 Ga0068860_100200886 Ga0068860_1002008862 120
52 3300006237 Ga0097621_100036132 Ga0097621_1000361323 120
53 3300006237 Ga0097621_100068060 Ga0097621_1000680602 120
54 3300006358 Ga0068871_100008615 Ga0068871_1000086159 120
55 3300006358 Ga0068871_100012989 Ga0068871_1000129893 120
56 3300006358 Ga0068871_100093769 Ga0068871_1000937694 120
57 3300006358 Ga0068871_101767308 Ga0068871_1017673082 120
58 3300006931 Ga0097620_100195466 Ga0097620_1001954663 120
59 3300009093 Ga0105240_10324010 Ga0105240_103240102 120
60 3300009093 Ga0105240_11529835 Ga0105240_115298352 120
61 3300009098 Ga0105245_10041304 Ga0105245_100413044 120
62 3300009098 Ga0105245_10283402 Ga0105245_102834022 120
63 3300009098 Ga0105245_10665046 Ga0105245_106650462 120
64 3300009101 Ga0105247_10315867 Ga0105247_103158672 120
65 3300009148 Ga0105243_10198764 Ga0105243_101987642 120
66 3300009174 Ga0105241_10712399 Ga0105241_107123993 120
67 3300009176 Ga0105242_10028570 Ga0105242_100285704 120
68 3300009176 Ga0105242_10273382 Ga0105242_102733822 120
69 3300009176 Ga0105242_11195662 Ga0105242_111956622 120
70 3300009176 Ga0105242_11215922 Ga0105242_112159222 120
71 3300009176 Ga0105242_12327942 Ga0105242_123279422 120
72 3300009177 Ga0105248_10007297 Ga0105248_1000729710 120
73 3300009177 Ga0105248_10248423 Ga0105248_102484232 120
74 3300009177 Ga0105248_10359585 Ga0105248_103595852 120
75 3300009177 Ga0105248_10751555 Ga0105248_107515551 120
76 3300009177 Ga0105248_11907619 Ga0105248_119076192 120
77 3300009545 Ga0105237_10022512 Ga0105237_100225123 120
78 3300009545 Ga0105237_10026360 Ga0105237_100263602 120
79 3300009545 Ga0105237_10625210 Ga0105237_106252101 120
80 3300009545 Ga0105237_10832164 Ga0105237_108321642 120
81 3300009551 Ga0105238_10016238 Ga0105238_100162388 120
82 3300009551 Ga0105238_10746562 Ga0105238_107465622 120
83 3300009553 Ga0105249_11468945 Ga0105249_114689452 120
84 3300010375 Ga0105239_10003447 Ga0105239_100034479 120
85 3300010375 Ga0105239_10020463 Ga0105239_100204633 120
86 3300010375 Ga0105239_10029693 Ga0105239_100296932 120
87 3300013296 Ga0157374_10016349 Ga0157374_100163496 120
88 3300013296 Ga0157374_10118709 Ga0157374_101187094 120
89 3300013296 Ga0157374_10283126 Ga0157374_102831263 120
90 3300013306 Ga0163162_10538466 Ga0163162_105384661 120
91 3300013306 Ga0163162_11573287 Ga0163162_115732872 120
92 3300013307 Ga0157372_10003719 Ga0157372_1000371911 120
93 3300013307 Ga0157372_10509916 Ga0157372_105099163 120
94 3300014325 Ga0163163_10024255 Ga0163163_100242556 120
95 3300014325 Ga0163163_11393347 Ga0163163_113933472 120
96 3300014969 Ga0157376_10155285 Ga0157376_101552853 120
97 3300025899 Ga0207642_10213616 Ga0207642_102136162 120
98 3300025900 Ga0207710_10101954 Ga0207710_101019542 120
99 3300025903 Ga0207680_10062242 Ga0207680_100622423 120
100 3300025907 Ga0207645_10213618 Ga0207645_102136182 120
101 3300025907 Ga0207645_10627014 Ga0207645_106270142 120
102 3300025911 Ga0207654_10131247 Ga0207654_101312472 120
103 3300025911 Ga0207654_10604270 Ga0207654_106042702 120
104 3300025912 Ga0207707_10587130 Ga0207707_105871302 120
105 3300025913 Ga0207695_10011914 Ga0207695_1001191410 120
106 3300025913 Ga0207695_10225482 Ga0207695_102254822 120
107 3300025914 Ga0207671_10026203 Ga0207671_100262033 120
108 3300025917 Ga0207660_10282909 Ga0207660_102829092 120
109 3300025920 Ga0207649_10624571 Ga0207649_106245712 120
110 3300025921 Ga0207652_10322147 Ga0207652_103221472 120
111 3300025921 Ga0207652_11052378 Ga0207652_110523781 120
112 3300025924 Ga0207694_10014432 Ga0207694_100144324 120
113 3300025924 Ga0207694_10070175 Ga0207694_100701751 120
114 3300025927 Ga0207687_10042990 Ga0207687_100429904 120
115 3300025927 Ga0207687_10192058 Ga0207687_101920583 120
116 3300025928 Ga0207700_10191673 Ga0207700_101916733 120
117 3300025931 Ga0207644_10197761 Ga0207644_101977612 120
118 3300025932 Ga0207690_10057782 Ga0207690_100577824 120
119 3300025934 Ga0207686_10005551 Ga0207686_100055514 120
120 3300025934 Ga0207686_10176385 Ga0207686_101763852 120
121 3300025934 Ga0207686_10693645 Ga0207686_106936452 120
122 3300025934 Ga0207686_10924039 Ga0207686_109240392 120
123 3300025935 Ga0207709_10278557 Ga0207709_102785572 120
124 3300025937 Ga0207669_10628423 Ga0207669_106284232 120
125 3300025941 Ga0207711_10214803 Ga0207711_102148032 120
126 3300025941 Ga0207711_10570320 Ga0207711_105703202 120
127 3300025942 Ga0207689_10013052 Ga0207689_100130527 120
128 3300025944 Ga0207661_10014038 Ga0207661_100140385 120
129 3300025944 Ga0207661_10202372 Ga0207661_102023722 120
130 3300025944 Ga0207661_11794693 Ga0207661_117946932 120
131 3300025945 Ga0207679_10290889 Ga0207679_102908892 120
132 3300025949 Ga0207667_10077591 Ga0207667_100775912 120
133 3300025986 Ga0207658_10319684 Ga0207658_103196843 120
134 3300026023 Ga0207677_10044210 Ga0207677_100442104 120
135 3300026035 Ga0207703_10056355 Ga0207703_100563553 120
136 3300026035 Ga0207703_10757512 Ga0207703_107575122 120
137 3300026041 Ga0207639_10009582 Ga0207639_100095823 120
138 3300026041 Ga0207639_10095758 Ga0207639_100957583 120
139 3300026041 Ga0207639_10598431 Ga0207639_105984312 120
140 3300026078 Ga0207702_10422278 Ga0207702_104222782 120
141 3300026078 Ga0207702_12107213 Ga0207702_121072132 120
142 3300026088 Ga0207641_10086465 Ga0207641_100864654 120
143 3300026089 Ga0207648_10049231 Ga0207648_100492314 120
144 3300026089 Ga0207648_10794532 Ga0207648_107945321 120
145 3300026095 Ga0207676_10283526 Ga0207676_102835262 120
146 3300026095 Ga0207676_11851891 Ga0207676_118518912 120
147 3300026095 Ga0207676_12079954 Ga0207676_120799542 120
148 3300026116 Ga0207674_10004305 Ga0207674_1000430510 120
149 3300026121 Ga0207683_10359464 Ga0207683_103594642 120
150 3300028381 Ga0268264_10320181 Ga0268264_103201812 120
151 3300031238 Ga0265332_10022597 Ga0265332_100225971 120
152 3300031711 Ga0265314_10181822 Ga0265314_101818221 120
153 3300031712 Ga0265342_10134642 Ga0265342_101346422 120
154 3300035086 Ga0373934_0020308 Ga0373934_0020308_330_710 120
155 3300035111 Ga0373923_0012571 Ga0373923_0012571_2607_2987 120
156 3300035113 Ga0373936_0244825 Ga0373936_0244825_271_651 120
157 3300035117 Ga0373953_0018705 Ga0373953_0018705_122_502 120
158 3300035117 Ga0373953_0041948 Ga0373953_0041948_695_1075 120
159 3300035118 Ga0373954_0004570 Ga0373954_0004570_144_524 120
160 3300035118 Ga0373954_0101078 Ga0373954_0101078_505_885 120
161 3300035120 Ga0373957_0026234 Ga0373957_0026234_1473_1853 120
162 3300035410 Ga0373924_0326325 Ga0373924_0326325_214_594 120
163 3300035695 Ga0373927_0520617 Ga0373927_0520617_78_443 120
164 3300035695 Ga0373927_0639427 Ga0373927_0639427_124_504 120
165 3300035724 Ga0373933_0682137 Ga0373933_0682137_231_611 120
166 3300035725 Ga0373947_0427685 Ga0373947_0427685_165_545 120
167 3300036401 Ga0373937_0512774 Ga0373937_0512774_596_976 120
168 3300037068 Ga0373925_0026817 Ga0373925_0026817_2447_2827 120
169 3300046454 Ga0495592_0031768 Ga0495592_0031768_336_713 120
170 3300046472 Ga0495580_0124777 Ga0495580_0124777_975_1355 120
171 3300046473 Ga0495582_0003535 Ga0495582_0003535_3262_3639 120
172 3300046499 Ga0495594_0076129 Ga0495594_0076129_806_1183 120
173 3300046511 Ga0495608_0337478 Ga0495608_0337478_495_875 120
174 3300046516 Ga0495628_0152161 Ga0495628_0152161_417_797 120
175 3300046529 Ga0495652_0144758 Ga0495652_0144758_1163_1540 120
176 3300046529 Ga0495652_0401802 Ga0495652_0401802_453_833 120
177 3300046535 Ga0495586_0141149 Ga0495586_0141149_512_889 120
178 3300046535 Ga0495586_0727803 Ga0495586_0727803_110_490 120
179 3300046536 Ga0495587_0178648 Ga0495587_0178648_69_449 120
180 3300046536 Ga0495587_0434112 Ga0495587_0434112_259_636 120
181 3300046559 Ga0495667_0435938 Ga0495667_0435938_325_705 120
182 3300046642 Ga0495634_0115186 Ga0495634_0115186_843_1220 120
183 3300046663 Ga0495635_0685733 Ga0495635_0685733_160_540 120
184 3300046679 Ga0495623_0114299 Ga0495623_0114299_331_708 120
185 3300046679 Ga0495623_0127288 Ga0495623_0127288_170_550 120
186 3300046683 Ga0495658_0011548 Ga0495658_0011548_2632_3009 120
187 3300046689 Ga0495613_0080243 Ga0495613_0080243_357_737 120
188 3300046689 Ga0495613_0203565 Ga0495613_0203565_47_424 120
189 3300047444 Ga0495675_0143453 Ga0495675_0143453_517_897 120
190 3300047444 Ga0495675_0405765 Ga0495675_0405765_271_651 120
191 3300047471 Ga0495684_0069097 Ga0495684_0069097_1765_2142 120
192 3300048088 Ga0495602_0024043 Ga0495602_0024043_3556_3933 120
193 3300048907 Ga0496104_0102669 Ga0496104_0102669_276_656 120
194 3300048918 Ga0496115_0155669 Ga0496115_0155669_836_1216 120
195 3300049569 Ga0501032_0000837 Ga0501032_0000837_17152_17529 120
196 3300049570 Ga0501033_0148515 Ga0501033_0148515_373_753 120
197 3300049571 Ga0501034_0102071 Ga0501034_0102071_310_687 120
198 3300049572 Ga0501036_0011297 Ga0501036_0011297_2333_2710 120
199 3300049573 Ga0501037_0006399 Ga0501037_0006399_966_1343 120
200 3300049575 Ga0501039_0007586 Ga0501039_0007586_2940_3317 120
201 3300049579 Ga0501043_0005570 Ga0501043_0005570_4964_5341 120
202 3300049580 Ga0501046_0000591 Ga0501046_0000591_22054_22431 120
203 3300049582 Ga0501048_0011743 Ga0501048_0011743_610_987 120
204 3300049583 Ga0501067_0015339 Ga0501067_0015339_966_1343 120
205 3300049584 Ga0501068_0002241 Ga0501068_0002241_2419_2796 120
206 3300049585 Ga0501069_0000329 Ga0501069_0000329_14360_14737 120
207 3300049586 Ga0501070_0061031 Ga0501070_0061031_2205_2582 120
208 3300049588 Ga0501072_0001356 Ga0501072_0001356_10885_11262 120
209 3300049589 Ga0501073_0000929 Ga0501073_0000929_671_1048 120
210 3300049590 Ga0501074_0099135 Ga0501074_0099135_966_1343 120
211 3300049592 Ga0501076_0028731 Ga0501076_0028731_3877_4254 120
212 3300049593 Ga0501077_0001401 Ga0501077_0001401_9062_9439 120
213 3300049742 Ga0501080_0000466 Ga0501080_0000466_11233_11610 120
214 3300049822 Ga0501035_0008952 Ga0501035_0008952_2205_2582 120
215 3300053077 Ga0495601_0385815 Ga0495601_0385815_457_837 120
216 3300054114 Ga0501084_0005349 Ga0501084_0005349_2905_3282 120
217 3300060353 Ga0501082_0009950 Ga0501082_0009950_5046_5423 120
218 3300005293 Ga0065715_10513451 Ga0065715_105134511 121
219 3300005331 Ga0070670_100151773 Ga0070670_1001517732 121
220 3300005353 Ga0070669_100199112 Ga0070669_1001991122 121
221 3300005353 Ga0070669_101027905 Ga0070669_1010279052 121
222 3300005354 Ga0070675_100346677 Ga0070675_1003466772 121
223 3300005367 Ga0070667_100099008 Ga0070667_1000990083 121
224 3300005436 Ga0070713_100500245 Ga0070713_1005002452 121
225 3300005458 Ga0070681_10330057 Ga0070681_103300572 121
226 3300005564 Ga0070664_101614828 Ga0070664_1016148281 121
227 3300005617 Ga0068859_101198487 Ga0068859_1011984872 121
228 3300006931 Ga0097620_101198911 Ga0097620_1011989112 121
229 3300009147 Ga0114129_13092717 Ga0114129_130927171 121
230 3300009545 Ga0105237_10609384 Ga0105237_106093842 121
231 3300013297 Ga0157378_10662237 Ga0157378_106622372 121
232 3300014326 Ga0157380_10065371 Ga0157380_100653712 121
233 3300025912 Ga0207707_10889840 Ga0207707_108898401 121
234 3300025914 Ga0207671_10470796 Ga0207671_104707962 121
235 3300025923 Ga0207681_11201180 Ga0207681_112011802 121
236 3300025925 Ga0207650_10882316 Ga0207650_108823161 121
237 3300025926 Ga0207659_10314917 Ga0207659_103149171 121
238 3300025928 Ga0207700_10441182 Ga0207700_104411821 121
239 3300025960 Ga0207651_11790062 Ga0207651_117900621 121
240 3300025972 Ga0207668_11384018 Ga0207668_113840181 121
241 3300025986 Ga0207658_10563656 Ga0207658_105636562 121
242 3300031344 Ga0265316_10867083 Ga0265316_108670832 121
243 3300031711 Ga0265314_10451611 Ga0265314_104516111 121
244 3300036712 Ga0316584_0783349 Ga0316584_0783349_212_583 121
245 3300045051 Ga0451576_0337594 Ga0451576_0337594_1171_1536 121
246 3300045051 Ga0451576_0441494 Ga0451576_0441494_636_1007 121
247 3300045051 Ga0451576_2552796 Ga0451576_2552796_64_429 121
248 3300046472 Ga0495580_0100766 Ga0495580_0100766_1541_1906 121
249 3300046531 Ga0495665_0178910 Ga0495665_0178910_93_458 121
250 3300046678 Ga0495599_0237023 Ga0495599_0237023_689_1054 121
251 3300047317 Ga0495604_0162523 Ga0495604_0162523_269_634 121
252 3300047319 Ga0495674_0373171 Ga0495674_0373171_678_1043 121
253 3300047444 Ga0495675_0130293 Ga0495675_0130293_532_897 121
254 3300048917 Ga0496114_0615400 Ga0496114_0615400_359_826 121
255 3300004801 Ga0058860_11341985 Ga0058860_113419852 122
256 3300005327 Ga0070658_10159498 Ga0070658_101594982 122
257 3300005328 Ga0070676_10246628 Ga0070676_102466282 122
258 3300005331 Ga0070670_100096224 Ga0070670_1000962242 122
259 3300005331 Ga0070670_101625939 Ga0070670_1016259391 122
260 3300005347 Ga0070668_100767208 Ga0070668_1007672082 122
261 3300005364 Ga0070673_100574824 Ga0070673_1005748242 122
262 3300005434 Ga0070709_10712394 Ga0070709_107123942 122
263 3300005444 Ga0070694_100189015 Ga0070694_1001890152 122
264 3300005444 Ga0070694_101328933 Ga0070694_1013289331 122
265 3300005445 Ga0070708_100075056 Ga0070708_1000750563 122
266 3300005457 Ga0070662_101153455 Ga0070662_1011534551 122
267 3300005518 Ga0070699_100037095 Ga0070699_1000370953 122
268 3300005536 Ga0070697_101051953 Ga0070697_1010519531 122
269 3300005547 Ga0070693_100522465 Ga0070693_1005224652 122
270 3300005548 Ga0070665_101079055 Ga0070665_1010790551 122
271 3300005549 Ga0070704_100820438 Ga0070704_1008204382 122
272 3300005549 Ga0070704_101397598 Ga0070704_1013975981 122
273 3300005843 Ga0068860_100865990 Ga0068860_1008659902 122
274 3300006028 Ga0070717_10010183 Ga0070717_100101834 122
275 3300006173 Ga0070716_100880347 Ga0070716_1008803472 122
276 3300006358 Ga0068871_100606601 Ga0068871_1006066011 122
277 3300006846 Ga0075430_100299316 Ga0075430_1002993162 122
278 3300006914 Ga0075436_100001822 Ga0075436_1000018226 122
279 3300007076 Ga0075435_100210361 Ga0075435_1002103612 122
280 3300009147 Ga0114129_10144167 Ga0114129_101441673 122
281 3300009176 Ga0105242_10580076 Ga0105242_105800762 122
282 3300009177 Ga0105248_10502086 Ga0105248_105020862 122
283 3300009553 Ga0105249_11029050 Ga0105249_110290502 122
284 3300013104 Ga0157370_10035548 Ga0157370_100355482 122
285 3300013296 Ga0157374_10415277 Ga0157374_104152772 122
286 3300013297 Ga0157378_10184499 Ga0157378_101844993 122
287 3300013306 Ga0163162_11953324 Ga0163162_119533242 122
288 3300013306 Ga0163162_12118424 Ga0163162_121184242 122
289 3300013307 Ga0157372_10791362 Ga0157372_107913621 122
290 3300013308 Ga0157375_10615190 Ga0157375_106151901 122
291 3300021361 Ga0213872_10000315 Ga0213872_100003159 122
292 3300025899 Ga0207642_10973088 Ga0207642_109730881 122
293 3300025907 Ga0207645_10564262 Ga0207645_105642622 122
294 3300025916 Ga0207663_10232730 Ga0207663_102327302 122
295 3300025922 Ga0207646_11374386 Ga0207646_113743862 122
296 3300025923 Ga0207681_10862172 Ga0207681_108621722 122
297 3300025925 Ga0207650_10199651 Ga0207650_101996512 122
298 3300025936 Ga0207670_11834642 Ga0207670_118346422 122
299 3300025938 Ga0207704_10414698 Ga0207704_104146982 122
300 3300025972 Ga0207668_10159930 Ga0207668_101599302 122
301 3300025981 Ga0207640_10338798 Ga0207640_103387982 122
302 3300025986 Ga0207658_10935785 Ga0207658_109357852 122
303 3300026035 Ga0207703_10387736 Ga0207703_103877362 122
304 3300026067 Ga0207678_11169669 Ga0207678_111696692 122
305 3300026088 Ga0207641_10624614 Ga0207641_106246141 122
306 3300026089 Ga0207648_11233110 Ga0207648_112331102 122
307 3300026089 Ga0207648_11310339 Ga0207648_113103392 122
308 3300026121 Ga0207683_10778576 Ga0207683_107785762 122
309 3300028381 Ga0268264_12495350 Ga0268264_124953502 122
310 3300028666 Ga0265336_10179345 Ga0265336_101793452 122
311 3300028800 Ga0265338_10088434 Ga0265338_100884343 122
312 3300031235 Ga0265330_10354639 Ga0265330_103546392 122
313 3300031238 Ga0265332_10018285 Ga0265332_100182852 122
314 3300031240 Ga0265320_10010127 Ga0265320_100101275 122
315 3300031242 Ga0265329_10176896 Ga0265329_101768961 122
316 3300031249 Ga0265339_10068192 Ga0265339_100681921 122
317 3300031250 Ga0265331_10058634 Ga0265331_100586342 122
318 3300031250 Ga0265331_10318573 Ga0265331_103185732 122
319 3300031344 Ga0265316_10007390 Ga0265316_1000739010 122
320 3300031344 Ga0265316_10008222 Ga0265316_1000822210 122
321 3300031344 Ga0265316_10030412 Ga0265316_100304124 122
322 3300031344 Ga0265316_10347807 Ga0265316_103478072 122
323 3300031595 Ga0265313_10197898 Ga0265313_101978982 122
324 3300031711 Ga0265314_10006803 Ga0265314_100068034 122
325 3300031711 Ga0265314_10044411 Ga0265314_100444112 122
326 3300031712 Ga0265342_10010946 Ga0265342_100109467 122
327 3300031712 Ga0265342_10088551 Ga0265342_100885512 122
328 3300035083 Ga0373926_0038176 Ga0373926_0038176_532_900 122
329 3300035083 Ga0373926_0044869 Ga0373926_0044869_404_784 122
330 3300035111 Ga0373923_0544647 Ga0373923_0544647_154_534 122
331 3300035116 Ga0373945_0467236 Ga0373945_0467236_138_518 122
332 3300035117 Ga0373953_0367804 Ga0373953_0367804_145_522 122
333 3300035118 Ga0373954_0023864 Ga0373954_0023864_2004_2384 122
334 3300035119 Ga0373956_0175282 Ga0373956_0175282_157_537 122
335 3300035170 Ga0373943_0099821 Ga0373943_0099821_513_881 122
336 3300035691 Ga0373931_0133918 Ga0373931_0133918_732_1100 122
337 3300035692 Ga0373935_0066214 Ga0373935_0066214_1562_1930 122
338 3300035692 Ga0373935_0322589 Ga0373935_0322589_157_537 122
339 3300035695 Ga0373927_0006230 Ga0373927_0006230_5914_6294 122
340 3300035695 Ga0373927_0013400 Ga0373927_0013400_3286_3654 122
341 3300035695 Ga0373927_0169762 Ga0373927_0169762_682_1050 122
342 3300035724 Ga0373933_0067296 Ga0373933_0067296_558_926 122
343 3300035725 Ga0373947_0002350 Ga0373947_0002350_2387_2755 122
344 3300035725 Ga0373947_0054143 Ga0373947_0054143_963_1343 122
345 3300035725 Ga0373947_0723372 Ga0373947_0723372_151_519 122
346 3300036401 Ga0373937_0013556 Ga0373937_0013556_5343_5711 122
347 3300036401 Ga0373937_0018835 Ga0373937_0018835_1226_1606 122
348 3300037068 Ga0373925_0000116 Ga0373925_0000116_25737_26105 122
349 3300037068 Ga0373925_0050681 Ga0373925_0050681_900_1280 122
350 3300037853 Ga0436364_1396354 Ga0436364_1396354_490_879 122
351 3300039438 Ga0436360_1055376 Ga0436360_1055376_363_752 122
352 3300039447 Ga0436361_0146780 Ga0436361_0146780_85_474 122
353 3300039447 Ga0436361_0371060 Ga0436361_0371060_261_662 122
354 3300039453 Ga0436362_1134939 Ga0436362_1134939_292_678 122
355 3300042876 Ga0451577_0399217 Ga0451577_0399217_19_411 122
356 3300044693 Ga0466961_0557647 Ga0466961_0557647_246_629 122
357 3300044765 Ga0466970_0811484 Ga0466970_0811484_57_440 122
358 3300044842 Ga0466957_0199366 Ga0466957_0199366_349_732 122
359 3300044842 Ga0466957_0764140 Ga0466957_0764140_116_547 122
360 3300045051 Ga0451576_1910783 Ga0451576_1910783_47_439 122
361 3300045051 Ga0451576_1978248 Ga0451576_1978248_34_402 122
362 3300045836 Ga0466958_0736669 Ga0466958_0736669_65_448 122
363 3300046462 Ga0495651_0480392 Ga0495651_0480392_173_553 122
364 3300046472 Ga0495580_0019930 Ga0495580_0019930_3302_3682 122
365 3300046472 Ga0495580_0085771 Ga0495580_0085771_975_1343 122
366 3300046472 Ga0495580_0119989 Ga0495580_0119989_1382_1759 122
367 3300046473 Ga0495582_0394624 Ga0495582_0394624_272_640 122
368 3300046473 Ga0495582_0420877 Ga0495582_0420877_44_424 122
369 3300046526 Ga0495666_0069084 Ga0495666_0069084_1013_1390 122
370 3300046531 Ga0495665_0088075 Ga0495665_0088075_791_1171 122
371 3300046535 Ga0495586_0607099 Ga0495586_0607099_84_461 122
372 3300046663 Ga0495635_0785464 Ga0495635_0785464_59_436 122
373 3300046675 Ga0495657_0424165 Ga0495657_0424165_93_470 122
374 3300046681 Ga0495647_0028143 Ga0495647_0028143_133_510 122
375 3300046690 Ga0495624_0108552 Ga0495624_0108552_842_1210 122
376 3300047317 Ga0495604_0249581 Ga0495604_0249581_25_402 122
377 3300048088 Ga0495602_0410409 Ga0495602_0410409_274_654 122
378 3300048088 Ga0495602_0700075 Ga0495602_0700075_202_570 122
379 3300048907 Ga0496104_0611746 Ga0496104_0611746_443_823 122
380 3300048907 Ga0496104_0667234 Ga0496104_0667234_486_854 122
381 3300048912 Ga0496109_0771998 Ga0496109_0771998_69_437 122
382 3300048912 Ga0496109_1279262 Ga0496109_1279262_70_450 122
383 3300048915 Ga0496112_0013152 Ga0496112_0013152_4589_4957 122
384 3300048915 Ga0496112_0539106 Ga0496112_0539106_115_483 122
385 3300049744 Ga0501083_0337383 Ga0501083_0337383_378_794 122
386 3300049823 Ga0501044_1202651 Ga0501044_1202651_207_581 122
387 3300050507 nmdc:mga05p37_117794_c1 nmdc:mga05p37_117794_c1_993_1361 122
388 3300050511 nmdc:mga08y16_751174_c1 nmdc:mga08y16_751174_c1_53_436 122
389 3300050513 nmdc:mga0rr50_295114_c1 nmdc:mga0rr50_295114_c1_791_1159 122
390 3300050514 nmdc:mga08x19_1578_c1 nmdc:mga08x19_1578_c1_9996_10364 122
391 3300054114 Ga0501084_0082369 Ga0501084_0082369_117_533 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

46

138

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hix-assembly3.cif.gz_C crystal structure of the rhodanese_3 like domain from anabaena sp alr3790 protein. northeast structural genomics consortium target nsr437i 0.9297 35 122
3hix-assembly1.cif.gz_A crystal structure of the rhodanese_3 like domain from anabaena sp alr3790 protein. northeast structural genomics consortium target nsr437i 0.9292 35 121
3hix-assembly3.cif.gz_C crystal structure of the rhodanese_3 like domain from anabaena sp alr3790 protein. northeast structural genomics consortium target nsr437i 0.9196 35 122
3tp9-assembly1.cif.gz_B crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains 0.9122 18 121
6mxv-assembly1.cif.gz_A the crystal structure of a rhodanese-like family protein from francisella tularensis subsp. tularensis schu s4 0.9067 1 122
ID Description Score Start End Superfamily
3tp9B03 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9076 19 121 3.40.250.10
af_Q4CQU5_222_326_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9055 36 115 3.40.250.10
2kl3A01 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8945 20 122 3.40.250.10
af_Q38853_56_181_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8913 18 121 3.40.250.10
3tp9B03 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8908 19 121 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A2V6ACE6-F1-model_v4 Sulfurtransferase 0.9943 36 122 GO:0016740
AF-A0A257VKD6-F1-model_v4 Sulfurtransferase 0.9935 1 114 GO:0016740
AF-A0A2V8U390-F1-model_v4 Sulfurtransferase 0.9884 2 122 GO:0004792
AF-Q5WVJ9-F1-model_v4 Rhodanese domain-containing protein 0.98 36 122 GO:0004792
AF-A0A522KZT8-F1-model_v4 deleted 0.9786 2 121

Feature Viewer

pLDDT pTM Quality
93.25 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map