F431988

General Info

Members Datasets Scaffolds Average Seq Length
391 232 357 270

Family's Representative Sequence

Representative Sequence 3300006163|Ga0070715_10169167|Ga0070715_101691671
Length 308
Sequence VRGRSCCPTLKVIPAVPQARRLRSVPVIVSTVNVNGIRAAIKQRSSENLGLLPWLAQTRADVVCLQETRADDEQLAGALRPALSDRPPRKLGGTPWYLASAGGDLKGRNGVAVLSRHPIKSVRDLDGADVGAPPTSRGGFALHGRYVEVDIDGLTVASVYIQTGEAGTDRQLEKERFMSALAHRMATLTDRDAVVCGDWNIAHTENDIKNWRGNVKKSGFLPSERQWLTELMATGWVDVVRKLHPDVAGPYSWWSWRGRAFDNDAGWRIDYQLATPALAGRARAARVERAAAYALRWSDHAPVTVEYR

Samples

Sample ID Description Type Environment
1 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
2 2643221549 Agromyces sp. Root1464 Isolate Unclassified
3 2643221613 Oerskovia sp. Root22 Isolate Unclassified
4 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
5 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
6 2643221692 Nocardia sp. Root136 Isolate Unclassified
7 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
8 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
9 2643221721 Oerskovia sp. Root918 Isolate Unclassified
10 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
11 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
12 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
13 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
14 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
15 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
16 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
17 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
18 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
19 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
20 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
21 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
22 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
23 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
24 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
25 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
26 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
27 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
28 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
29 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
30 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
31 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
32 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
33 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
34 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
35 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
143 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
144 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
145 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
146 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
147 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
148 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
149 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
150 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
151 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
152 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
163 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
166 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
218 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
219 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
220 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
221 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
222 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
223 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
224 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
225 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
226 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
227 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
228 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
229 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
232 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.05
Metatranscriptomes 0.26
Isolates 8.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.62
Nodule 0.26
Rhizoplane 11.76
Rhizosphere 55.75
Stem 0
Stem Tuber 0
Unclassified 15.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0007423J48922_100328 3300003285 Bacteria 3796
2 Ga0055542_1012829 3300003762 Bacteria 1433
3 Ga0055540_1000143 3300003792 Bacteria 71425
4 Ga0055540_1001003 3300003792 Bacteria 18221
5 Ga0055540_1002822 3300003792 Bacteria 8878
6 Ga0055540_1020604 3300003792 Bacteria 1739
7 Ga0065704_10003446 3300005289 Bacteria 4063
8 Ga0070666_10043607 3300005335 Bacteria 3004
9 Ga0070666_10323478 3300005335 Bacteria 1100
10 Ga0070682_100060544 3300005337 Bacteria 2394
11 Ga0070661_100072310 3300005344 Bacteria 2538
12 Ga0070668_100000664 3300005347 Bacteria 23292
13 Ga0070669_100001172 3300005353 Bacteria 19133
14 Ga0070669_100221312 3300005353 Bacteria 1497
15 Ga0070671_100001179 3300005355 Bacteria 19539
16 Ga0070674_100261538 3300005356 Bacteria 1363
17 Ga0070659_100000308 3300005366 Bacteria 38002
18 Ga0070659_100059439 3300005366 Bacteria 3018
19 Ga0070667_100000447 3300005367 Bacteria 42767
20 Ga0070667_100000722 3300005367 Bacteria 31740
21 Ga0070667_100038761 3300005367 Bacteria 3995
22 Ga0070714_100442318 3300005435 Bacteria 1234
23 Ga0070713_100245945 3300005436 Bacteria 1630
24 Ga0070710_10010954 3300005437 Bacteria 4467
25 Ga0070663_100233625 3300005455 Bacteria 1449
26 Ga0070678_100038703 3300005456 Bacteria 3359
27 Ga0070678_100215588 3300005456 Bacteria 1593
28 Ga0068853_100223211 3300005539 Bacteria 1722
29 Ga0070672_100061261 3300005543 Bacteria 2966
30 Ga0070665_100014959 3300005548 Bacteria 7789
31 Ga0068855_100006470 3300005563 Bacteria 14247
32 Ga0068855_100257471 3300005563 Bacteria 1945
33 Ga0068855_100397669 3300005563 Bacteria 1510
34 Ga0068857_100055705 3300005577 Bacteria 3508
35 Ga0068856_100051516 3300005614 Bacteria 4058
36 Ga0068856_100095482 3300005614 Bacteria 2961
37 Ga0068852_100031385 3300005616 Bacteria 4383
38 Ga0068852_100041164 3300005616 Bacteria 3903
39 Ga0068852_100042157 3300005616 Bacteria 3862
40 Ga0068859_100003471 3300005617 Bacteria 16034
41 Ga0068851_10000001 3300005834 Bacteria 495512
42 Ga0068863_100001461 3300005841 Bacteria 23435
43 Ga0068863_100003619 3300005841 Bacteria 15258
44 Ga0068863_100024574 3300005841 Bacteria 5746
45 Ga0068858_100000016 3300005842 Bacteria 193130
46 Ga0068858_100064097 3300005842 Bacteria 3401
47 Ga0068860_100000016 3300005843 Bacteria 310468
48 Ga0068862_100000051 3300005844 Bacteria 145362
49 Ga0081455_10042877 3300005937 Bacteria 3964
50 Ga0075365_10009078 3300006038 Bacteria 5691
51 Ga0075365_10183536 3300006038 Bacteria 1463
52 Ga0075363_100001926 3300006048 Bacteria 8229
53 Ga0075363_100051400 3300006048 Bacteria 2198
54 Ga0075363_100119893 3300006048 Bacteria 1468
55 Ga0075364_10004595 3300006051 Bacteria 7951
56 Ga0075364_10006912 3300006051 Bacteria 6700
57 Ga0075364_10023589 3300006051 Bacteria 3896
58 Ga0075364_10040965 3300006051 Bacteria 3005
59 Ga0070715_10169167 3300006163 Bacteria 1087
60 Ga0075367_10005962 3300006178 Bacteria 6117
61 Ga0075367_10081033 3300006178 Bacteria 1964
62 Ga0075369_10006282 3300006186 Bacteria 4488
63 Ga0075369_10007697 3300006186 Bacteria 4117
64 Ga0075369_10014134 3300006186 Bacteria 3185
65 Ga0075369_10016952 3300006186 Bacteria 2947
66 Ga0075369_10060460 3300006186 Bacteria 1653
67 Ga0075370_10000615 3300006353 Bacteria 13785
68 Ga0068871_100135018 3300006358 Bacteria 2095
69 Ga0075428_100145149 3300006844 Bacteria 2579
70 Ga0075430_100028269 3300006846 Bacteria 4764
71 Ga0075431_100061503 3300006847 Bacteria 3875
72 Ga0097620_100003471 3300006931 Bacteria 16034
73 Ga0105240_10017581 3300009093 Bacteria 9634
74 Ga0105240_10058555 3300009093 Bacteria 4810
75 Ga0105240_10179690 3300009093 Bacteria 2498
76 Ga0105240_10626411 3300009093 Bacteria 1182
77 Ga0105245_10022791 3300009098 Bacteria 5495
78 Ga0105245_10159787 3300009098 Bacteria 2137
79 Ga0105247_10000017 3300009101 Bacteria 260438
80 Ga0105247_10162851 3300009101 Bacteria 1478
81 Ga0105247_10175388 3300009101 Bacteria 1427
82 Ga0114129_10037453 3300009147 Bacteria 6847
83 Ga0105241_10002009 3300009174 Bacteria 15393
84 Ga0105248_10000025 3300009177 Bacteria 259691
85 Ga0105248_10004138 3300009177 Bacteria 16052
86 Ga0105248_10091053 3300009177 Bacteria 3435
87 Ga0105248_10150758 3300009177 Bacteria 2623
88 Ga0105237_10001088 3300009545 Bacteria 36367
89 Ga0105237_10002761 3300009545 Bacteria 21346
90 Ga0105237_10006530 3300009545 Bacteria 12910
91 Ga0105238_10066223 3300009551 Bacteria 3614
92 Ga0105238_10694134 3300009551 Bacteria 1030
93 Ga0105249_10000021 3300009553 Bacteria 260448
94 Ga0105239_10010811 3300010375 Bacteria 10197
95 Ga0105239_10054030 3300010375 Bacteria 4405
96 Ga0105246_10152675 3300011119 Bacteria 1750
97 Ga0157370_10191014 3300013104 Bacteria 1901
98 Ga0157369_10228519 3300013105 Bacteria 1946
99 Ga0157375_10390070 3300013308 Bacteria 1559
100 Ga0157375_10633504 3300013308 Bacteria 1226
101 Ga0163163_10288604 3300014325 Bacteria 1693
102 Ga0157379_10010726 3300014968 Bacteria 7984
103 Ga0157379_10027335 3300014968 Bacteria 5079
104 Ga0209148_1001459 3300025254 Bacteria 11967
105 Ga0209673_1009074 3300025273 Bacteria 4350
106 Ga0209051_1000328 3300025303 Bacteria 71477
107 Ga0209051_1000495 3300025303 Bacteria 50813
108 Ga0209051_1001554 3300025303 Bacteria 19000
109 Ga0209051_1002304 3300025303 Bacteria 13890
110 Ga0209051_1025246 3300025303 Bacteria 2423
111 Ga0209051_1067366 3300025303 Bacteria 1095
112 Ga0207656_10000002 3300025321 Bacteria 792178
113 Ga0207710_10000033 3300025900 Bacteria 260531
114 Ga0207688_10199664 3300025901 Bacteria 1198
115 Ga0207680_10017121 3300025903 Bacteria 3823
116 Ga0207654_10000001 3300025911 Bacteria 1816198
117 Ga0207695_10003333 3300025913 Bacteria 22759
118 Ga0207695_10005723 3300025913 Bacteria 16379
119 Ga0207695_10431240 3300025913 Bacteria 1202
120 Ga0207671_10000002 3300025914 Bacteria 1144816
121 Ga0207671_10004366 3300025914 Bacteria 13558
122 Ga0207671_10020943 3300025914 Bacteria 4971
123 Ga0207693_10002852 3300025915 Bacteria 14966
124 Ga0207657_10033452 3300025919 Bacteria 4634
125 Ga0207681_10001320 3300025923 Bacteria 16003
126 Ga0207694_10000022 3300025924 Bacteria 288900
127 Ga0207687_10024209 3300025927 Bacteria 4053
128 Ga0207687_10124014 3300025927 Bacteria 1936
129 Ga0207690_10006211 3300025932 Bacteria 7074
130 Ga0207669_10086253 3300025937 Bacteria 2029
131 Ga0207665_10008452 3300025939 Bacteria 6785
132 Ga0207665_10195203 3300025939 Bacteria 1473
133 Ga0207711_10000390 3300025941 Bacteria 46512
134 Ga0207711_10005819 3300025941 Bacteria 10415
135 Ga0207711_10018217 3300025941 Bacteria 5837
136 Ga0207711_10025650 3300025941 Bacteria 4943
137 Ga0207667_10000571 3300025949 Bacteria 48073
138 Ga0207667_10136349 3300025949 Bacteria 2527
139 Ga0207667_10217412 3300025949 Bacteria 1958
140 Ga0207667_10231985 3300025949 Bacteria 1890
141 Ga0207712_10000005 3300025961 Bacteria 608697
142 Ga0207668_10000367 3300025972 Bacteria 28871
143 Ga0207658_10000299 3300025986 Bacteria 51661
144 Ga0207658_10039227 3300025986 Bacteria 3416
145 Ga0207658_10122926 3300025986 Bacteria 2072
146 Ga0207677_10168951 3300026023 Bacteria 1708
147 Ga0207703_10000075 3300026035 Bacteria 118422
148 Ga0207703_10117175 3300026035 Bacteria 2281
149 Ga0207703_10279314 3300026035 Bacteria 1516
150 Ga0207639_10023055 3300026041 Bacteria 4491
151 Ga0207678_10088622 3300026067 Bacteria 2644
152 Ga0207702_10142184 3300026078 Bacteria 2173
153 Ga0207702_10555417 3300026078 Bacteria 1123
154 Ga0207641_10003252 3300026088 Bacteria 14481
155 Ga0207641_10013912 3300026088 Bacteria 6599
156 Ga0207641_10476482 3300026088 Bacteria 1209
157 Ga0207648_10012438 3300026089 Bacteria 7968
158 Ga0207674_10009260 3300026116 Bacteria 11286
159 Ga0207674_10062179 3300026116 Bacteria 3771
160 Ga0207675_100106411 3300026118 Bacteria 2645
161 Ga0207675_100262144 3300026118 Bacteria 1675
162 Ga0207683_10014012 3300026121 Bacteria 6837
163 Ga0207698_10004573 3300026142 Bacteria 8446
164 Ga0207698_10007206 3300026142 Bacteria 6968
165 Ga0268266_10181329 3300028379 Bacteria 1917
166 Ga0268265_10000022 3300028380 Bacteria 270788
167 Ga0268264_10000005 3300028381 Bacteria 934972
168 Ga0265327_10000690 3300031251 Bacteria 53948
169 Ga0265327_10037049 3300031251 Bacteria 2675
170 Ga0307509_10212581 3300031507 Bacteria 1757
171 Ga0307408_100000393 3300031548 Bacteria 39808
172 Ga0307405_10523392 3300031731 Bacteria 955
173 Ga0307410_10096827 3300031852 Bacteria 2107
174 Ga0307409_100281905 3300031995 Bacteria 1536
175 Ga0307414_10096103 3300032004 Bacteria 2216
176 Ga0307411_10095912 3300032005 Bacteria 2084
177 Ga0373939_0093929 3300035114 Bacteria 1018
178 Ga0373931_0006604 3300035691 Bacteria 5431
179 Ga0395898_0000098 3300037466 Bacteria 229806
180 Ga0395901_0636516 3300038443 Bacteria 1071
181 Ga0439461_0002088 3300041410 Bacteria 3163
182 Ga0439466_0003111 3300041411 Bacteria 6453
183 Ga0439466_0010996 3300041411 Bacteria 3355
184 Ga0439465_0001338 3300041413 Bacteria 7919
185 Ga0439465_0003114 3300041413 Bacteria 5421
186 Ga0439465_0009808 3300041413 Bacteria 3016
187 Ga0439465_0012593 3300041413 Bacteria 2645
188 Ga0451787_818198 3300041441 Bacteria 1407
189 Ga0451793_0044552 3300041452 Bacteria 1677
190 Ga0451802_1698670 3300041460 Bacteria 1232
191 Ga0451853_1401339 3300041512 Bacteria 1945
192 Ga0439431_0058607 3300041997 Bacteria 1009
193 Ga0439442_001285 3300042002 Bacteria 5000
194 Ga0439448_0010533 3300042005 Bacteria 2744
195 Ga0439459_0011011 3300042438 Bacteria 1587
196 Ga0466972_0055992 3300044658 Bacteria 1896
197 Ga0466972_0064017 3300044658 Bacteria 1760
198 Ga0466965_0000842 3300044683 Bacteria 11619
199 Ga0466965_0050872 3300044683 Bacteria 2055
200 Ga0466968_0174495 3300044735 Bacteria 997
201 Ga0466970_0004237 3300044765 Bacteria 7057
202 Ga0466970_0045711 3300044765 Bacteria 2332
203 Ga0466960_0003872 3300044901 Bacteria 5802
204 Ga0466960_0102682 3300044901 Bacteria 1475
205 Ga0466959_0165044 3300045049 Bacteria 1555
206 Ga0466967_0033713 3300045976 Bacteria 4338
207 Ga0466967_0371575 3300045976 Bacteria 1387
208 Ga0466967_0592728 3300045976 Bacteria 1093
209 Ga0495638_0006440 3300046460 Bacteria 8542
210 Ga0495638_0008490 3300046460 Bacteria 7280
211 Ga0495650_0001841 3300046471 Bacteria 18974
212 Ga0495583_0081111 3300046506 Bacteria 1409
213 Ga0495648_0056611 3300046524 Bacteria 2357
214 Ga0495625_0109379 3300046660 Bacteria 1891
215 Ga0495671_0140013 3300046692 Bacteria 1179
216 Ga0495649_0079425 3300046694 Bacteria 1755
217 Ga0495672_0019068 3300047320 Bacteria 4535
218 Ga0495672_0076320 3300047320 Bacteria 1882
219 Ga0495673_0002297 3300047469 Bacteria 13687
220 Ga0496100_0000015 3300048903 Bacteria 167108
221 Ga0496100_0033745 3300048903 Bacteria 3205
222 Ga0496101_0000002 3300048904 Bacteria 410971
223 Ga0496101_0000039 3300048904 Bacteria 164695
224 Ga0496101_0000257 3300048904 Bacteria 37750
225 Ga0496101_0035198 3300048904 Bacteria 3541
226 Ga0496102_0000003 3300048905 Bacteria 592263
227 Ga0496102_0000449 3300048905 Bacteria 46890
228 Ga0496102_0028639 3300048905 Bacteria 4977
229 Ga0496102_0046877 3300048905 Bacteria 3926
230 Ga0496102_0047018 3300048905 Bacteria 3920
231 Ga0496102_0216553 3300048905 Bacteria 1805
232 Ga0496103_0000014 3300048906 Bacteria 290397
233 Ga0496103_0000515 3300048906 Bacteria 31901
234 Ga0496103_0003993 3300048906 Bacteria 8964
235 Ga0496103_0111173 3300048906 Bacteria 1741
236 Ga0496103_0247023 3300048906 Bacteria 1148
237 Ga0496104_0000393 3300048907 Bacteria 38237
238 Ga0496105_0011687 3300048908 Bacteria 6946
239 Ga0496106_0001328 3300048909 Bacteria 18541
240 Ga0496106_0003892 3300048909 Bacteria 11140
241 Ga0496106_0007777 3300048909 Bacteria 7932
242 Ga0496106_0092956 3300048909 Bacteria 2330
243 Ga0496107_0008436 3300048910 Bacteria 7130
244 Ga0496107_0034590 3300048910 Bacteria 3619
245 Ga0496107_0064235 3300048910 Bacteria 2661
246 Ga0496108_0026019 3300048911 Bacteria 4826
247 Ga0496108_0077344 3300048911 Bacteria 2814
248 Ga0496108_0146482 3300048911 Bacteria 2036
249 Ga0496109_0000077 3300048912 Bacteria 103492
250 Ga0496110_0021463 3300048913 Bacteria 5468
251 Ga0496111_0037005 3300048914 Bacteria 3491
252 Ga0496111_0037146 3300048914 Bacteria 3486
253 Ga0496112_0271501 3300048915 Bacteria 1644
254 Ga0496113_0008107 3300048916 Bacteria 6821
255 Ga0496113_0174460 3300048916 Bacteria 1703
256 Ga0496113_0560187 3300048916 Bacteria 916
257 Ga0496114_0000505 3300048917 Bacteria 28572
258 Ga0496114_0004211 3300048917 Bacteria 11148
259 Ga0496114_0329894 3300048917 Bacteria 1349
260 Ga0496115_0009947 3300048918 Bacteria 7087
261 Ga0496115_0035603 3300048918 Bacteria 3939
262 Ga0496115_0220575 3300048918 Bacteria 1565
263 Ga0496116_0000071 3300048919 Bacteria 244521
264 Ga0496116_0004509 3300048919 Bacteria 13254
265 Ga0496116_0045199 3300048919 Bacteria 2983
266 Ga0496117_0000003 3300048920 Bacteria 1881097
267 Ga0496117_0000048 3300048920 Bacteria 295908
268 Ga0496117_0000417 3300048920 Bacteria 71654
269 Ga0496117_0051507 3300048920 Bacteria 2909
270 Ga0496117_0228214 3300048920 Bacteria 1031
271 Ga0496118_0000001 3300048921 Bacteria 1881100
272 Ga0496118_0000350 3300048921 Bacteria 78354
273 Ga0496118_0027345 3300048921 Bacteria 4829
274 Ga0496119_0000880 3300048922 Bacteria 39332
275 Ga0496119_0001473 3300048922 Bacteria 28179
276 Ga0496119_0013395 3300048922 Bacteria 6539
277 Ga0496120_0000157 3300048923 Bacteria 112786
278 Ga0496120_0000899 3300048923 Bacteria 41719
279 Ga0496120_0002191 3300048923 Bacteria 20676
280 Ga0496120_0009239 3300048923 Bacteria 7020
281 Ga0496120_0010639 3300048923 Bacteria 6396
282 Ga0496120_0057468 3300048923 Bacteria 2189
283 Ga0496121_0000002 3300048924 Bacteria 1494588
284 Ga0496121_0000019 3300048924 Bacteria 499976
285 Ga0496121_0035442 3300048924 Bacteria 4473
286 Ga0496121_0203487 3300048924 Bacteria 1409
287 Ga0496122_0000051 3300048925 Bacteria 265104
288 Ga0496122_0002238 3300048925 Bacteria 28126
289 Ga0496122_0024590 3300048925 Bacteria 5265
290 Ga0496123_0008921 3300048926 Bacteria 9117
291 Ga0496123_0105243 3300048926 Bacteria 1629
292 Ga0496124_0000002 3300048927 Bacteria 1494588
293 Ga0496124_0003081 3300048927 Bacteria 20748
294 Ga0496124_0263438 3300048927 Bacteria 1267
295 Ga0496125_0000002 3300048928 Bacteria 1480920
296 Ga0496125_0111041 3300048928 Bacteria 1985
297 Ga0496126_0000011 3300048929 Bacteria 744275
298 Ga0496126_0000186 3300048929 Bacteria 140016
299 Ga0496126_0040067 3300048929 Bacteria 4344
300 Ga0496126_0124286 3300048929 Bacteria 2234
301 Ga0496126_0198814 3300048929 Bacteria 1694
302 Ga0501031_0045816 3300049568 Bacteria 2853
303 Ga0501032_0064611 3300049569 Bacteria 2449
304 Ga0501033_0251290 3300049570 Bacteria 1253
305 Ga0501034_0008501 3300049571 Bacteria 10840
306 Ga0501034_0071967 3300049571 Bacteria 3466
307 Ga0501036_0008832 3300049572 Bacteria 8273
308 Ga0501037_0001541 3300049573 Bacteria 16809
309 Ga0501038_0032315 3300049574 Bacteria 4618
310 Ga0501039_0001154 3300049575 Bacteria 19473
311 Ga0501043_0004655 3300049579 Bacteria 11119
312 Ga0501046_0006705 3300049580 Bacteria 10169
313 Ga0501067_0013101 3300049583 Bacteria 4590
314 Ga0501070_0000598 3300049586 Bacteria 32974
315 Ga0501073_0022032 3300049589 Bacteria 4591
316 Ga0501044_0005126 3300049823 Bacteria 14613
317 Ga0501044_0068412 3300049823 Bacteria 3617
318 Ga0501044_0185540 3300049823 Bacteria 2045
319 nmdc:mga03n38_170396_c1 3300050490 Bacteria 1108
320 nmdc:mga03n38_19974_c1 3300050490 Bacteria 2672
321 nmdc:mga03n38_5411_c1 3300050490 Bacteria 4346
322 nmdc:mga00v17_13095_c1 3300050491 Bacteria 4596
323 nmdc:mga00v17_23729_c1 3300050491 Bacteria 3551
324 nmdc:mga00v17_2600_c1 3300050491 Bacteria 9257
325 nmdc:mga00v17_4248_c1 3300050491 Bacteria 7436
326 nmdc:mga00v17_57579_c1 3300050491 Bacteria 2378
327 nmdc:mga0yw44_31551_c1 3300050492 Bacteria 3082
328 nmdc:mga0yw44_48323_c1 3300050492 Bacteria 2565
329 nmdc:mga0yw44_59816_c1 3300050492 Bacteria 2332
330 nmdc:mga0yw44_820_c1 3300050492 Bacteria 11598
331 nmdc:mga07m45_16344_c1 3300050496 Bacteria 3973
332 nmdc:mga05p37_28387_c1 3300050507 Bacteria 6823
333 nmdc:mga0qj67_39743_c1 3300050509 Bacteria 3696
334 nmdc:mga06r32_79086_c1 3300050510 Bacteria 3198
335 nmdc:mga0sz30_15052_c1 3300050516 Bacteria 3053
336 nmdc:mga0sz30_515_c1 3300050516 Bacteria 14416
337 nmdc:mga0sz30_5889_c1 3300050516 Bacteria 4523
338 nmdc:mga0sz30_85018_c1 3300050516 Bacteria 1372
339 nmdc:mga0sz30_8528_c1 3300050516 Bacteria 3872
340 Ga0500635_0000004 3300053080 Bacteria 210675
341 Ga0500635_0025628 3300053080 Bacteria 1859
342 Ga0500635_0102621 3300053080 Bacteria 1054
343 Ga0500643_008371 3300053087 Bacteria 4066
344 Ga0500643_021340 3300053087 Bacteria 2100
345 Ga0500651_0001679 3300053093 Bacteria 11307
346 Ga0500554_092471 3300053102 Bacteria 1006
347 Ga0500556_0013964 3300053104 Bacteria 2443
348 Ga0500652_036481 3300053131 Bacteria 1957
349 Ga0500590_001523 3300053148 Bacteria 9606
350 Ga0500604_0026522 3300053151 Bacteria 1672
351 Ga0500616_0000040 3300053153 Bacteria 367604
352 Ga0500616_0016229 3300053153 Bacteria 4244
353 Ga0500620_001841 3300053155 Bacteria 4063
354 Ga0500627_0067844 3300053158 Bacteria 1576
355 Ga0500645_000096 3300053730 Bacteria 69252
356 Ga0500645_016542 3300053730 Bacteria 2321
357 Ga0501082_0050043 3300060353 Bacteria 3603

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025901 Ga0207688_10199664 Ga0207688_101996642 201
2 3300026121 Ga0207683_10014012 Ga0207683_100140122 226
3 3300005937 Ga0081455_10042877 Ga0081455_100428773 239
4 iso_pu_bacteria 2896344016 2896347127 241
5 iso_pu_bacteria 2896317667 2896320482 242
6 3300003792 Ga0055540_1020604 Ga0055540_10206042 243
7 3300005337 Ga0070682_100060544 Ga0070682_1000605442 243
8 3300025303 Ga0209051_1001554 Ga0209051_100155415 243
9 3300026067 Ga0207678_10088622 Ga0207678_100886222 243
10 3300041441 Ga0451787_818198 Ga0451787_818198_275_1075 243
11 3300041452 Ga0451793_0044552 Ga0451793_0044552_350_1150 243
12 3300003792 Ga0055540_1001003 Ga0055540_10010034 244
13 3300025303 Ga0209051_1000495 Ga0209051_100049518 244
14 3300025303 Ga0209051_1025246 Ga0209051_10252462 244
15 3300053080 Ga0500635_0102621 Ga0500635_0102621_16_783 244
16 3300053087 Ga0500643_021340 Ga0500643_021340_837_1637 244
17 3300032004 Ga0307414_10096103 Ga0307414_100961032 245
18 3300045976 Ga0466967_0592728 Ga0466967_0592728_175_990 245
19 3300005289 Ga0065704_10003446 Ga0065704_100034461 246
20 3300006051 Ga0075364_10023589 Ga0075364_100235893 246
21 3300031548 Ga0307408_100000393 Ga0307408_10000039326 246
22 3300048918 Ga0496115_0220575 Ga0496115_0220575_155_934 246
23 3300049823 Ga0501044_0068412 Ga0501044_0068412_28_768 246
24 3300050491 nmdc:mga00v17_4248_c1 nmdc:mga00v17_4248_c1_583_1383 246
25 iso_pu_bacteria 2842134933 2842136958 246
26 3300048909 Ga0496106_0007777 Ga0496106_0007777_2404_3204 247
27 3300048905 Ga0496102_0047018 Ga0496102_0047018_2582_3403 248
28 3300006186 Ga0075369_10014134 Ga0075369_100141342 249
29 3300050491 nmdc:mga00v17_23729_c1 nmdc:mga00v17_23729_c1_1700_2488 249
30 3300050492 nmdc:mga0yw44_31551_c1 nmdc:mga0yw44_31551_c1_72_860 249
31 3300050516 nmdc:mga0sz30_15052_c1 nmdc:mga0sz30_15052_c1_388_1215 249
32 iso_pu_bacteria 2643221687 2644489895 249
33 iso_pu_bacteria 2643221715 2644635507 249
34 iso_pu_bacteria 2738541264 2738664558 249
35 iso_pu_bacteria 2738541356 2739143693 249
36 iso_pu_bacteria 2902810491 2902813453 249
37 iso_pu_bacteria 2902837492 2902841520 249
38 iso_pu_bacteria 2929212328 2929214012 249
39 iso_pu_bacteria 2862705112 2862705752 250
40 iso_pu_bacteria 2990044586 2990046920 250
41 iso_pu_bacteria 8008485437 8008485619 250
42 iso_pu_bacteria 8025524527 8025530093 250
43 3300005456 Ga0070678_100215588 Ga0070678_1002155882 251
44 iso_pu_bacteria 2551306166 2552106032 251
45 iso_pu_bacteria 2738541274 2738707531 251
46 iso_pu_bacteria 2738543028 2739334020 251
47 3300005353 Ga0070669_100001172 Ga0070669_1000011723 252
48 3300005355 Ga0070671_100001179 Ga0070671_10000117919 252
49 3300005367 Ga0070667_100000447 Ga0070667_10000044726 252
50 3300005367 Ga0070667_100038761 Ga0070667_1000387612 252
51 3300005548 Ga0070665_100014959 Ga0070665_1000149595 252
52 3300005617 Ga0068859_100003471 Ga0068859_10000347111 252
53 3300005841 Ga0068863_100001461 Ga0068863_10000146115 252
54 3300005841 Ga0068863_100003619 Ga0068863_1000036195 252
55 3300005842 Ga0068858_100064097 Ga0068858_1000640973 252
56 3300005843 Ga0068860_100000016 Ga0068860_100000016175 252
57 3300005844 Ga0068862_100000051 Ga0068862_10000005120 252
58 3300006051 Ga0075364_10004595 Ga0075364_100045954 252
59 3300006186 Ga0075369_10007697 Ga0075369_100076974 252
60 3300006844 Ga0075428_100145149 Ga0075428_1001451492 252
61 3300006846 Ga0075430_100028269 Ga0075430_1000282694 252
62 3300006847 Ga0075431_100061503 Ga0075431_1000615034 252
63 3300006931 Ga0097620_100003471 Ga0097620_10000347111 252
64 3300009101 Ga0105247_10000017 Ga0105247_10000017250 252
65 3300009147 Ga0114129_10037453 Ga0114129_100374532 252
66 3300009177 Ga0105248_10000025 Ga0105248_10000025127 252
67 3300009553 Ga0105249_10000021 Ga0105249_10000021127 252
68 3300014968 Ga0157379_10010726 Ga0157379_100107263 252
69 3300025900 Ga0207710_10000033 Ga0207710_1000003315 252
70 3300025923 Ga0207681_10001320 Ga0207681_1000132016 252
71 3300025941 Ga0207711_10000390 Ga0207711_100003909 252
72 3300025961 Ga0207712_10000005 Ga0207712_10000005505 252
73 3300025986 Ga0207658_10000299 Ga0207658_1000029933 252
74 3300025986 Ga0207658_10122926 Ga0207658_101229262 252
75 3300026035 Ga0207703_10117175 Ga0207703_101171753 252
76 3300026088 Ga0207641_10003252 Ga0207641_100032529 252
77 3300026088 Ga0207641_10013912 Ga0207641_100139125 252
78 3300026118 Ga0207675_100262144 Ga0207675_1002621442 252
79 3300028379 Ga0268266_10181329 Ga0268266_101813292 252
80 3300028380 Ga0268265_10000022 Ga0268265_10000022252 252
81 3300028381 Ga0268264_10000005 Ga0268264_10000005500 252
82 3300041413 Ga0439465_0012593 Ga0439465_0012593_1617_2414 252
83 3300044658 Ga0466972_0055992 Ga0466972_0055992_252_1043 252
84 3300044658 Ga0466972_0064017 Ga0466972_0064017_240_1037 252
85 3300044683 Ga0466965_0000842 Ga0466965_0000842_1300_2097 252
86 3300044735 Ga0466968_0174495 Ga0466968_0174495_102_893 252
87 3300044765 Ga0466970_0004237 Ga0466970_0004237_240_1037 252
88 3300044901 Ga0466960_0003872 Ga0466960_0003872_780_1577 252
89 3300045049 Ga0466959_0165044 Ga0466959_0165044_367_1164 252
90 3300045976 Ga0466967_0033713 Ga0466967_0033713_174_971 252
91 3300048904 Ga0496101_0035198 Ga0496101_0035198_2396_3193 252
92 3300048905 Ga0496102_0000449 Ga0496102_0000449_33263_34063 252
93 3300048905 Ga0496102_0046877 Ga0496102_0046877_1708_2499 252
94 3300048906 Ga0496103_0000515 Ga0496103_0000515_791_1591 252
95 3300048911 Ga0496108_0077344 Ga0496108_0077344_191_982 252
96 3300048916 Ga0496113_0008107 Ga0496113_0008107_4509_5306 252
97 3300048919 Ga0496116_0045199 Ga0496116_0045199_1134_1934 252
98 3300048920 Ga0496117_0000417 Ga0496117_0000417_69662_70462 252
99 3300048920 Ga0496117_0228214 Ga0496117_0228214_101_898 252
100 3300048921 Ga0496118_0000350 Ga0496118_0000350_18176_18976 252
101 3300048922 Ga0496119_0001473 Ga0496119_0001473_8367_9167 252
102 3300048923 Ga0496120_0002191 Ga0496120_0002191_16657_17457 252
103 3300048923 Ga0496120_0057468 Ga0496120_0057468_882_1679 252
104 3300048924 Ga0496121_0035442 Ga0496121_0035442_2306_3106 252
105 3300048925 Ga0496122_0024590 Ga0496122_0024590_3712_4509 252
106 3300048926 Ga0496123_0008921 Ga0496123_0008921_1516_2313 252
107 3300048928 Ga0496125_0111041 Ga0496125_0111041_519_1319 252
108 3300048929 Ga0496126_0124286 Ga0496126_0124286_148_948 252
109 3300050491 nmdc:mga00v17_13095_c1 nmdc:mga00v17_13095_c1_3563_4354 252
110 3300050507 nmdc:mga05p37_28387_c1 nmdc:mga05p37_28387_c1_4549_5340 252
111 3300050509 nmdc:mga0qj67_39743_c1 nmdc:mga0qj67_39743_c1_1048_1839 252
112 3300050510 nmdc:mga06r32_79086_c1 nmdc:mga06r32_79086_c1_418_1209 252
113 3300050516 nmdc:mga0sz30_515_c1 nmdc:mga0sz30_515_c1_3339_4130 252
114 iso_pu_bacteria 2904479285 2904481543 252
115 3300003792 Ga0055540_1000143 Ga0055540_100014321 253
116 3300003792 Ga0055540_1002822 Ga0055540_10028224 253
117 3300005335 Ga0070666_10043607 Ga0070666_100436072 253
118 3300005347 Ga0070668_100000664 Ga0070668_10000066419 253
119 3300005353 Ga0070669_100221312 Ga0070669_1002213122 253
120 3300005356 Ga0070674_100261538 Ga0070674_1002615382 253
121 3300005366 Ga0070659_100059439 Ga0070659_1000594393 253
122 3300005367 Ga0070667_100000722 Ga0070667_10000072230 253
123 3300005436 Ga0070713_100245945 Ga0070713_1002459452 253
124 3300005437 Ga0070710_10010954 Ga0070710_100109541 253
125 3300005456 Ga0070678_100038703 Ga0070678_1000387032 253
126 3300005543 Ga0070672_100061261 Ga0070672_1000612613 253
127 3300006038 Ga0075365_10009078 Ga0075365_100090784 253
128 3300006048 Ga0075363_100001926 Ga0075363_1000019263 253
129 3300006048 Ga0075363_100119893 Ga0075363_1001198931 253
130 3300006051 Ga0075364_10006912 Ga0075364_100069125 253
131 3300006051 Ga0075364_10040965 Ga0075364_100409652 253
132 3300006178 Ga0075367_10005962 Ga0075367_100059623 253
133 3300006178 Ga0075367_10081033 Ga0075367_100810332 253
134 3300006186 Ga0075369_10006282 Ga0075369_100062821 253
135 3300006353 Ga0075370_10000615 Ga0075370_100006155 253
136 3300006358 Ga0068871_100135018 Ga0068871_1001350182 253
137 3300009545 Ga0105237_10006530 Ga0105237_100065308 253
138 3300013308 Ga0157375_10633504 Ga0157375_106335042 253
139 3300025273 Ga0209673_1009074 Ga0209673_10090743 253
140 3300025303 Ga0209051_1000328 Ga0209051_100032855 253
141 3300025303 Ga0209051_1002304 Ga0209051_10023046 253
142 3300025903 Ga0207680_10017121 Ga0207680_100171212 253
143 3300025914 Ga0207671_10004366 Ga0207671_100043667 253
144 3300025915 Ga0207693_10002852 Ga0207693_100028524 253
145 3300025937 Ga0207669_10086253 Ga0207669_100862532 253
146 3300025939 Ga0207665_10008452 Ga0207665_100084522 253
147 3300025939 Ga0207665_10195203 Ga0207665_101952032 253
148 3300025941 Ga0207711_10018217 Ga0207711_100182175 253
149 3300025972 Ga0207668_10000367 Ga0207668_1000036722 253
150 3300025986 Ga0207658_10039227 Ga0207658_100392272 253
151 3300026035 Ga0207703_10279314 Ga0207703_102793142 253
152 3300026089 Ga0207648_10012438 Ga0207648_100124383 253
153 3300026118 Ga0207675_100106411 Ga0207675_1001064111 253
154 3300031251 Ga0265327_10037049 Ga0265327_100370492 253
155 3300035114 Ga0373939_0093929 Ga0373939_0093929_13_861 253
156 3300035691 Ga0373931_0006604 Ga0373931_0006604_2862_3710 253
157 3300041410 Ga0439461_0002088 Ga0439461_0002088_520_1338 253
158 3300041411 Ga0439466_0003111 Ga0439466_0003111_3684_4502 253
159 3300041411 Ga0439466_0010996 Ga0439466_0010996_1063_1863 253
160 3300041413 Ga0439465_0001338 Ga0439465_0001338_1938_2732 253
161 3300041413 Ga0439465_0003114 Ga0439465_0003114_4013_4831 253
162 3300041997 Ga0439431_0058607 Ga0439431_0058607_157_951 253
163 3300042002 Ga0439442_001285 Ga0439442_001285_498_1316 253
164 3300042005 Ga0439448_0010533 Ga0439448_0010533_1008_1811 253
165 3300044683 Ga0466965_0050872 Ga0466965_0050872_163_966 253
166 3300045976 Ga0466967_0371575 Ga0466967_0371575_527_1330 253
167 3300046460 Ga0495638_0006440 Ga0495638_0006440_6055_6855 253
168 3300046660 Ga0495625_0109379 Ga0495625_0109379_745_1545 253
169 3300046692 Ga0495671_0140013 Ga0495671_0140013_127_927 253
170 3300048903 Ga0496100_0000015 Ga0496100_0000015_163302_164105 253
171 3300048904 Ga0496101_0000039 Ga0496101_0000039_160751_161554 253
172 3300048905 Ga0496102_0028639 Ga0496102_0028639_2158_2961 253
173 3300048906 Ga0496103_0003993 Ga0496103_0003993_1889_2692 253
174 3300048906 Ga0496103_0111173 Ga0496103_0111173_772_1578 253
175 3300048909 Ga0496106_0001328 Ga0496106_0001328_17594_18397 253
176 3300048909 Ga0496106_0092956 Ga0496106_0092956_1144_1992 253
177 3300048910 Ga0496107_0034590 Ga0496107_0034590_2801_3604 253
178 3300048910 Ga0496107_0064235 Ga0496107_0064235_683_1531 253
179 3300048911 Ga0496108_0026019 Ga0496108_0026019_2966_3769 253
180 3300048912 Ga0496109_0000077 Ga0496109_0000077_61398_62201 253
181 3300048913 Ga0496110_0021463 Ga0496110_0021463_1524_2327 253
182 3300048914 Ga0496111_0037146 Ga0496111_0037146_1040_1843 253
183 3300048916 Ga0496113_0174460 Ga0496113_0174460_412_1215 253
184 3300048917 Ga0496114_0004211 Ga0496114_0004211_4901_5704 253
185 3300048918 Ga0496115_0035603 Ga0496115_0035603_128_931 253
186 3300048919 Ga0496116_0004509 Ga0496116_0004509_4555_5358 253
187 3300048920 Ga0496117_0051507 Ga0496117_0051507_70_873 253
188 3300048921 Ga0496118_0027345 Ga0496118_0027345_3009_3812 253
189 3300048922 Ga0496119_0013395 Ga0496119_0013395_2092_2895 253
190 3300048924 Ga0496121_0000002 Ga0496121_0000002_1150311_1151114 253
191 3300048925 Ga0496122_0000051 Ga0496122_0000051_208099_208902 253
192 3300048926 Ga0496123_0105243 Ga0496123_0105243_550_1353 253
193 3300048927 Ga0496124_0000002 Ga0496124_0000002_343475_344278 253
194 3300048928 Ga0496125_0000002 Ga0496125_0000002_1150311_1151114 253
195 3300048929 Ga0496126_0000011 Ga0496126_0000011_343475_344278 253
196 3300049569 Ga0501032_0064611 Ga0501032_0064611_200_1015 253
197 3300049570 Ga0501033_0251290 Ga0501033_0251290_288_1103 253
198 3300049571 Ga0501034_0008501 Ga0501034_0008501_7932_8747 253
199 3300049572 Ga0501036_0008832 Ga0501036_0008832_2252_3067 253
200 3300049573 Ga0501037_0001541 Ga0501037_0001541_8609_9424 253
201 3300049575 Ga0501039_0001154 Ga0501039_0001154_16272_17087 253
202 3300049579 Ga0501043_0004655 Ga0501043_0004655_9933_10748 253
203 3300049583 Ga0501067_0013101 Ga0501067_0013101_2906_3721 253
204 3300049586 Ga0501070_0000598 Ga0501070_0000598_22242_23057 253
205 3300049589 Ga0501073_0022032 Ga0501073_0022032_1701_2516 253
206 3300049823 Ga0501044_0185540 Ga0501044_0185540_591_1406 253
207 3300050490 nmdc:mga03n38_170396_c1 nmdc:mga03n38_170396_c1_184_1002 253
208 3300050490 nmdc:mga03n38_5411_c1 nmdc:mga03n38_5411_c1_234_1034 253
209 3300050491 nmdc:mga00v17_2600_c1 nmdc:mga00v17_2600_c1_2358_3182 253
210 3300050491 nmdc:mga00v17_57579_c1 nmdc:mga00v17_57579_c1_1340_2140 253
211 3300050492 nmdc:mga0yw44_59816_c1 nmdc:mga0yw44_59816_c1_492_1316 253
212 3300050492 nmdc:mga0yw44_820_c1 nmdc:mga0yw44_820_c1_1438_2238 253
213 3300050496 nmdc:mga07m45_16344_c1 nmdc:mga07m45_16344_c1_2829_3653 253
214 3300050516 nmdc:mga0sz30_5889_c1 nmdc:mga0sz30_5889_c1_65_859 253
215 3300053104 Ga0500556_0013964 Ga0500556_0013964_376_1176 253
216 3300053151 Ga0500604_0026522 Ga0500604_0026522_783_1583 253
217 iso_pu_bacteria 2643221692 2644515200 253
218 iso_pu_bacteria 2939582691 2939587814 253
219 3300006038 Ga0075365_10183536 Ga0075365_101835362 254
220 3300006163 Ga0070715_10169167 Ga0070715_101691671 254
221 3300006186 Ga0075369_10060460 Ga0075369_100604602 254
222 3300009101 Ga0105247_10175388 Ga0105247_101753883 254
223 3300009177 Ga0105248_10091053 Ga0105248_100910534 254
224 3300011119 Ga0105246_10152675 Ga0105246_101526752 254
225 3300031251 Ga0265327_10000690 Ga0265327_1000069036 254
226 3300046506 Ga0495583_0081111 Ga0495583_0081111_383_1195 254
227 3300046524 Ga0495648_0056611 Ga0495648_0056611_173_985 254
228 3300047320 Ga0495672_0019068 Ga0495672_0019068_45_857 254
229 3300047469 Ga0495673_0002297 Ga0495673_0002297_173_985 254
230 3300048904 Ga0496101_0000257 Ga0496101_0000257_23665_24474 254
231 3300048905 Ga0496102_0216553 Ga0496102_0216553_460_1269 254
232 3300048906 Ga0496103_0247023 Ga0496103_0247023_62_871 254
233 3300048907 Ga0496104_0000393 Ga0496104_0000393_4117_4926 254
234 3300048908 Ga0496105_0011687 Ga0496105_0011687_2568_3377 254
235 3300048909 Ga0496106_0003892 Ga0496106_0003892_6065_6874 254
236 3300048910 Ga0496107_0008436 Ga0496107_0008436_2124_2933 254
237 3300048917 Ga0496114_0000505 Ga0496114_0000505_7052_7861 254
238 3300048918 Ga0496115_0009947 Ga0496115_0009947_3539_4348 254
239 3300048924 Ga0496121_0203487 Ga0496121_0203487_51_872 254
240 3300048929 Ga0496126_0040067 Ga0496126_0040067_383_1186 254
241 3300048929 Ga0496126_0198814 Ga0496126_0198814_279_1082 254
242 3300049823 Ga0501044_0005126 Ga0501044_0005126_11028_11831 254
243 3300050492 nmdc:mga0yw44_48323_c1 nmdc:mga0yw44_48323_c1_378_1181 254
244 3300050516 nmdc:mga0sz30_85018_c1 nmdc:mga0sz30_85018_c1_455_1282 254
245 3300053087 Ga0500643_008371 Ga0500643_008371_1764_2576 254
246 3300053153 Ga0500616_0016229 Ga0500616_0016229_3294_4106 254
247 iso_pu_bacteria 2902799365 2902802866 254
248 3300005563 Ga0068855_100257471 Ga0068855_1002574712 255
249 3300009545 Ga0105237_10002761 Ga0105237_1000276121 255
250 3300010375 Ga0105239_10010811 Ga0105239_1001081112 255
251 3300025303 Ga0209051_1067366 Ga0209051_10673662 255
252 3300025949 Ga0207667_10231985 Ga0207667_102319852 255
253 3300032005 Ga0307411_10095912 Ga0307411_100959122 255
254 3300042438 Ga0439459_0011011 Ga0439459_0011011_675_1511 255
255 3300046460 Ga0495638_0008490 Ga0495638_0008490_892_1701 255
256 3300047320 Ga0495672_0076320 Ga0495672_0076320_667_1494 255
257 3300048903 Ga0496100_0033745 Ga0496100_0033745_2030_2845 255
258 3300048904 Ga0496101_0000002 Ga0496101_0000002_298877_299692 255
259 3300048905 Ga0496102_0000003 Ga0496102_0000003_24571_25386 255
260 3300048906 Ga0496103_0000014 Ga0496103_0000014_265230_266045 255
261 3300048919 Ga0496116_0000071 Ga0496116_0000071_23706_24521 255
262 3300048920 Ga0496117_0000003 Ga0496117_0000003_566878_567693 255
263 3300048921 Ga0496118_0000001 Ga0496118_0000001_566881_567696 255
264 3300048922 Ga0496119_0000880 Ga0496119_0000880_13988_14803 255
265 3300048923 Ga0496120_0000157 Ga0496120_0000157_87657_88472 255
266 3300048924 Ga0496121_0000019 Ga0496121_0000019_33609_34424 255
267 3300048929 Ga0496126_0000186 Ga0496126_0000186_24214_25029 255
268 3300053080 Ga0500635_0025628 Ga0500635_0025628_937_1749 255
269 3300053131 Ga0500652_036481 Ga0500652_036481_323_1135 255
270 3300053158 Ga0500627_0067844 Ga0500627_0067844_32_841 255
271 3300053730 Ga0500645_000096 Ga0500645_000096_8063_8872 255
272 3300053730 Ga0500645_016542 Ga0500645_016542_131_940 255
273 3300041413 Ga0439465_0009808 Ga0439465_0009808_1624_2436 256
274 3300044901 Ga0466960_0102682 Ga0466960_0102682_250_1053 256
275 3300006048 Ga0075363_100051400 Ga0075363_1000514002 257
276 3300006186 Ga0075369_10016952 Ga0075369_100169522 257
277 3300041512 Ga0451853_1401339 Ga0451853_1401339_539_1360 257
278 3300046694 Ga0495649_0079425 Ga0495649_0079425_286_1098 257
279 3300050490 nmdc:mga03n38_19974_c1 nmdc:mga03n38_19974_c1_158_970 257
280 3300050516 nmdc:mga0sz30_8528_c1 nmdc:mga0sz30_8528_c1_1287_2183 257
281 iso_pu_bacteria 2883821847 2883822752 257
282 iso_pu_bacteria 2956939328 2956941099 257
283 iso_pu_bacteria 3001119090 3001120788 257
284 3300009551 Ga0105238_10694134 Ga0105238_106941341 258
285 3300005435 Ga0070714_100442318 Ga0070714_1004423181 259
286 3300044765 Ga0466970_0045711 Ga0466970_0045711_762_1583 261
287 3300038443 Ga0395901_0636516 Ga0395901_0636516_245_1054 262
288 3300048915 Ga0496112_0271501 Ga0496112_0271501_468_1265 262
289 3300048916 Ga0496113_0560187 Ga0496113_0560187_42_839 262
290 3300053102 Ga0500554_092471 Ga0500554_092471_83_913 262
291 3300003762 Ga0055542_1012829 Ga0055542_10128292 263
292 3300005335 Ga0070666_10323478 Ga0070666_103234781 263
293 3300005344 Ga0070661_100072310 Ga0070661_1000723102 263
294 3300005366 Ga0070659_100000308 Ga0070659_10000030821 263
295 3300005539 Ga0068853_100223211 Ga0068853_1002232112 263
296 3300005563 Ga0068855_100006470 Ga0068855_10000647014 263
297 3300005563 Ga0068855_100397669 Ga0068855_1003976692 263
298 3300005577 Ga0068857_100055705 Ga0068857_1000557052 263
299 3300005614 Ga0068856_100051516 Ga0068856_1000515163 263
300 3300005614 Ga0068856_100095482 Ga0068856_1000954823 263
301 3300005616 Ga0068852_100031385 Ga0068852_1000313854 263
302 3300005616 Ga0068852_100041164 Ga0068852_1000411645 263
303 3300005616 Ga0068852_100042157 Ga0068852_1000421573 263
304 3300005834 Ga0068851_10000001 Ga0068851_10000001188 263
305 3300005841 Ga0068863_100024574 Ga0068863_1000245747 263
306 3300005842 Ga0068858_100000016 Ga0068858_100000016164 263
307 3300009093 Ga0105240_10017581 Ga0105240_100175812 263
308 3300009093 Ga0105240_10058555 Ga0105240_100585552 263
309 3300009093 Ga0105240_10179690 Ga0105240_101796902 263
310 3300009093 Ga0105240_10626411 Ga0105240_106264112 263
311 3300009098 Ga0105245_10022791 Ga0105245_100227912 263
312 3300009098 Ga0105245_10159787 Ga0105245_101597872 263
313 3300009101 Ga0105247_10162851 Ga0105247_101628511 263
314 3300009174 Ga0105241_10002009 Ga0105241_1000200911 263
315 3300009177 Ga0105248_10004138 Ga0105248_1000413815 263
316 3300009177 Ga0105248_10150758 Ga0105248_101507583 263
317 3300009545 Ga0105237_10001088 Ga0105237_1000108814 263
318 3300009551 Ga0105238_10066223 Ga0105238_100662233 263
319 3300010375 Ga0105239_10054030 Ga0105239_100540302 263
320 3300014325 Ga0163163_10288604 Ga0163163_102886041 263
321 3300014968 Ga0157379_10027335 Ga0157379_100273352 263
322 3300025254 Ga0209148_1001459 Ga0209148_100145912 263
323 3300025321 Ga0207656_10000002 Ga0207656_10000002739 263
324 3300025911 Ga0207654_10000001 Ga0207654_100000011138 263
325 3300025913 Ga0207695_10003333 Ga0207695_100033335 263
326 3300025913 Ga0207695_10005723 Ga0207695_100057233 263
327 3300025913 Ga0207695_10431240 Ga0207695_104312402 263
328 3300025914 Ga0207671_10000002 Ga0207671_100000021033 263
329 3300025914 Ga0207671_10020943 Ga0207671_100209437 263
330 3300025919 Ga0207657_10033452 Ga0207657_100334523 263
331 3300025924 Ga0207694_10000022 Ga0207694_10000022141 263
332 3300025927 Ga0207687_10024209 Ga0207687_100242092 263
333 3300025927 Ga0207687_10124014 Ga0207687_101240142 263
334 3300025932 Ga0207690_10006211 Ga0207690_100062117 263
335 3300025941 Ga0207711_10005819 Ga0207711_100058198 263
336 3300025941 Ga0207711_10025650 Ga0207711_100256503 263
337 3300025949 Ga0207667_10000571 Ga0207667_1000057122 263
338 3300025949 Ga0207667_10136349 Ga0207667_101363493 263
339 3300025949 Ga0207667_10217412 Ga0207667_102174122 263
340 3300026023 Ga0207677_10168951 Ga0207677_101689512 263
341 3300026035 Ga0207703_10000075 Ga0207703_10000075100 263
342 3300026041 Ga0207639_10023055 Ga0207639_100230552 263
343 3300026078 Ga0207702_10142184 Ga0207702_101421842 263
344 3300026078 Ga0207702_10555417 Ga0207702_105554171 263
345 3300026088 Ga0207641_10476482 Ga0207641_104764822 263
346 3300026116 Ga0207674_10009260 Ga0207674_100092602 263
347 3300026116 Ga0207674_10062179 Ga0207674_100621792 263
348 3300026142 Ga0207698_10004573 Ga0207698_100045732 263
349 3300026142 Ga0207698_10007206 Ga0207698_100072064 263
350 3300031507 Ga0307509_10212581 Ga0307509_102125812 263
351 3300031852 Ga0307410_10096827 Ga0307410_100968273 263
352 3300031995 Ga0307409_100281905 Ga0307409_1002819052 263
353 3300037466 Ga0395898_0000098 Ga0395898_0000098_11106_11942 263
354 3300046471 Ga0495650_0001841 Ga0495650_0001841_8819_9652 263
355 3300048920 Ga0496117_0000048 Ga0496117_0000048_290049_290885 263
356 3300048923 Ga0496120_0000899 Ga0496120_0000899_29187_30023 263
357 3300048923 Ga0496120_0009239 Ga0496120_0009239_3696_4532 263
358 3300048923 Ga0496120_0010639 Ga0496120_0010639_835_1668 263
359 3300048925 Ga0496122_0002238 Ga0496122_0002238_16076_16912 263
360 3300053080 Ga0500635_0000004 Ga0500635_0000004_55073_55909 263
361 3300053093 Ga0500651_0001679 Ga0500651_0001679_7650_8483 263
362 3300053148 Ga0500590_001523 Ga0500590_001523_8236_9081 263
363 3300053153 Ga0500616_0000040 Ga0500616_0000040_35985_36821 263
364 3300053155 Ga0500620_001841 Ga0500620_001841_3091_3924 263
365 iso_pu_bacteria 2643221549 2643768233 263
366 iso_pu_bacteria 2721755702 2723642982 263
367 iso_pu_bacteria 2935409751 2935412245 263
368 iso_pu_bacteria 2643221613 2644082245 264
369 iso_pu_bacteria 2643221721 2644664655 264
370 iso_pu_bacteria 2935890801 2935894043 264
371 3300048927 Ga0496124_0003081 Ga0496124_0003081_5473_6279 265
372 3300049568 Ga0501031_0045816 Ga0501031_0045816_19_825 265
373 3300049571 Ga0501034_0071967 Ga0501034_0071967_150_956 265
374 3300049574 Ga0501038_0032315 Ga0501038_0032315_887_1693 265
375 3300049580 Ga0501046_0006705 Ga0501046_0006705_1916_2722 265
376 3300060353 Ga0501082_0050043 Ga0501082_0050043_1185_1991 265
377 iso_pu_bacteria 2643221690 2644503027 266
378 iso_pu_bacteria 2884994152 2884996306 266
379 3300003285 Ga0007423J48922_100328 Ga0007423J48922_1003283 270
380 3300005455 Ga0070663_100233625 Ga0070663_1002336252 270
381 3300013104 Ga0157370_10191014 Ga0157370_101910141 270
382 3300013105 Ga0157369_10228519 Ga0157369_102285192 270
383 3300013308 Ga0157375_10390070 Ga0157375_103900702 270
384 3300031731 Ga0307405_10523392 Ga0307405_105233922 270
385 3300041460 Ga0451802_1698670 Ga0451802_1698670_146_970 270
386 3300048911 Ga0496108_0146482 Ga0496108_0146482_284_1108 270
387 3300048914 Ga0496111_0037005 Ga0496111_0037005_1036_1860 270
388 3300048917 Ga0496114_0329894 Ga0496114_0329894_115_939 270
389 3300048927 Ga0496124_0263438 Ga0496124_0263438_83_907 270
390 iso_pu_bacteria 2643221694 2644525357 270
391 iso_pu_bacteria 2643221722 2644669441 270

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

30

300

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b5h-assembly1.cif.gz_A substate bound inactive mutant of neisseria ap endonuclease in presence of metal ions 0.9419 1 270
4b5m-assembly2.cif.gz_B neisseria ap endonuclease bound to the substrate with a cytosine orphan base 0.9356 1 270
4b5h-assembly1.cif.gz_A substate bound inactive mutant of neisseria ap endonuclease in presence of metal ions 0.9279 1 270
3w2y-assembly2.cif.gz_D crystal structure of dna uridine endonuclease mth212 mutant w205s 0.927 2 270
3g4t-assembly1.cif.gz_A mth0212 (wt) in complex with a 7bp dsdna 0.9241 1 269
ID Description Score Start End Superfamily
4b5gC00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9229 1 270 3.60.10.10
3g3cB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9215 2 270 3.60.10.10
4f1rA00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9167 2 270 3.60.10.10
4b5gC00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9092 1 270 3.60.10.10
3g3cB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9078 2 270 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A7X7J9X9-F1-model_v4 Exodeoxyribonuclease III 0.9876 122 270 GO:0006281
GO:0008311
GO:0046872
AF-A0A6J6RTH3-F1-model_v4 Unannotated protein 0.9871 161 270 GO:0006281
GO:0008311
AF-A0A7X7J9X9-F1-model_v4 Exodeoxyribonuclease III 0.981 122 270 GO:0006281
GO:0008311
GO:0046872
AF-A0A7W4UEF8-F1-model_v4 Exodeoxyribonuclease-3 (EC 3.1.11.2) 0.9788 1 270 GO:0006281
GO:0008311
GO:0046872
AF-A0A542SRB4-F1-model_v4 Exodeoxyribonuclease-3 0.9736 1 270 GO:0006281
GO:0008311
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.81 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map