F431968

General Info

Members Datasets Scaffolds Average Seq Length
391 190 782 228

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100307999|Ga0070698_1003079992
Length 277
Sequence MSFLQGDHALTGRDGRVRGKDAGSADSPSYRRDRGRRIAPPSATGQPVLHPEGSSKPRVGVVTYPGSQDDRDALWALAALDAEAVSVWHAESELPPLDAIVLPGGFSYGDYLRCGAIARFSPATRAVCEFAEAGGLVLGICNGFQVLCEAGLLPGVLLRNESLRFVCRDVPLVVERDDLPFTSHCTIGQTLVIPVKHGDGRYVPPPGLDPAQVVFRYADNPNGSVDDIAGVCNERGNVLGLMPHPEHAVDPLLGSDDGAFILASLVDAARDRAPAAA

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
77 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
78 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
79 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
80 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
83 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
86 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
87 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
94 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
95 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
110 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 1.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.67
Rhizosphere 92.07
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100307999 3300005471 Bacteria 1515
2 Ga0070658_10041042 3300005327 Bacteria 3733
3 Ga0070658_10429591 3300005327 Bacteria 1137
4 Ga0070683_100042475 3300005329 Bacteria 4186
5 Ga0070683_100642644 3300005329 Bacteria 1016
6 Ga0070680_100349693 3300005336 Bacteria 1257
7 Ga0070680_100422080 3300005336 Bacteria 1138
8 Ga0070680_100436291 3300005336 Bacteria 1118
9 Ga0070682_100081981 3300005337 Bacteria 2090
10 Ga0070682_100153710 3300005337 Bacteria 1582
11 Ga0070660_100031065 3300005339 Bacteria 4009
12 Ga0070660_100036640 3300005339 Bacteria 3716
13 Ga0070660_100105719 3300005339 Bacteria 2234
14 Ga0070659_100114834 3300005366 Bacteria 2176
15 Ga0070709_10011315 3300005434 Bacteria 4968
16 Ga0070714_100034199 3300005435 Bacteria 4255
17 Ga0070714_100069917 3300005435 Bacteria 3033
18 Ga0070714_100144330 3300005435 Bacteria 2140
19 Ga0070714_100145945 3300005435 Bacteria 2128
20 Ga0070714_100166254 3300005435 Bacteria 1999
21 Ga0070714_100216149 3300005435 Bacteria 1760
22 Ga0070710_10031605 3300005437 Bacteria 2860
23 Ga0070710_10448706 3300005437 Bacteria 874
24 Ga0070708_100478703 3300005445 Bacteria 1175
25 Ga0070663_100589206 3300005455 Bacteria 934
26 Ga0070681_10032707 3300005458 Bacteria 5222
27 Ga0070681_10106934 3300005458 Bacteria 2739
28 Ga0070681_10123201 3300005458 Bacteria 2525
29 Ga0070681_10132732 3300005458 Bacteria 2422
30 Ga0070681_10149121 3300005458 Bacteria 2266
31 Ga0070681_10233780 3300005458 Bacteria 1752
32 Ga0070681_10496961 3300005458 Bacteria 1133
33 Ga0070707_100000570 3300005468 Bacteria 37054
34 Ga0070707_100123638 3300005468 Bacteria 2513
35 Ga0070707_100434795 3300005468 Bacteria 1273
36 Ga0070698_100015489 3300005471 Bacteria 8053
37 Ga0070699_100166587 3300005518 Bacteria 1952
38 Ga0070679_100019458 3300005530 Bacteria 6601
39 Ga0070679_100155445 3300005530 Bacteria 2262
40 Ga0070679_100156105 3300005530 Bacteria 2257
41 Ga0070679_100241496 3300005530 Bacteria 1763
42 Ga0070679_100461403 3300005530 Bacteria 1215
43 Ga0070684_100023081 3300005535 Bacteria 5196
44 Ga0070684_100070847 3300005535 Bacteria 3069
45 Ga0070684_100202362 3300005535 Bacteria 1809
46 Ga0070697_100473795 3300005536 Bacteria 1093
47 Ga0068853_100476887 3300005539 Bacteria 1176
48 Ga0070695_100000253 3300005545 Bacteria 26811
49 Ga0070696_100184619 3300005546 Bacteria 1549
50 Ga0070665_100565156 3300005548 Bacteria 1150
51 Ga0070704_100067894 3300005549 Bacteria 2577
52 Ga0068855_100052596 3300005563 Bacteria 4794
53 Ga0070664_100628740 3300005564 Bacteria 997
54 Ga0068854_100711496 3300005578 Bacteria 868
55 Ga0068852_100317143 3300005616 Bacteria 1513
56 Ga0070717_10006656 3300006028 Bacteria 8519
57 Ga0070717_10012809 3300006028 Bacteria 6403
58 Ga0070717_10042171 3300006028 Bacteria 3722
59 Ga0070717_10052786 3300006028 Bacteria 3350
60 Ga0070717_10147034 3300006028 Bacteria 2036
61 Ga0070717_10366937 3300006028 Bacteria 1289
62 Ga0070712_100142958 3300006175 Bacteria 1828
63 Ga0097621_100431920 3300006237 Bacteria 1184
64 Ga0105240_10050080 3300009093 Bacteria 5268
65 Ga0105240_10180280 3300009093 Bacteria 2493
66 Ga0105245_10009775 3300009098 Bacteria 8356
67 Ga0105248_10344721 3300009177 Bacteria 1677
68 Ga0105237_10172828 3300009545 Bacteria 2161
69 Ga0105237_10772059 3300009545 Bacteria 968
70 Ga0105238_10074304 3300009551 Bacteria 3392
71 Ga0105238_10916165 3300009551 Bacteria 895
72 Ga0105239_10178931 3300010375 Bacteria 2372
73 Ga0157373_10194919 3300013100 Bacteria 1428
74 Ga0157373_10256485 3300013100 Bacteria 1237
75 Ga0157370_10008749 3300013104 Bacteria 10886
76 Ga0157370_10219331 3300013104 Bacteria 1762
77 Ga0157369_10484411 3300013105 Bacteria 1280
78 Ga0157372_10232874 3300013307 Bacteria 2136
79 Ga0182008_10008509 3300014497 Bacteria 5603
80 Ga0182006_1012923 3300015261 Bacteria 3641
81 Ga0182007_10023948 3300015262 Bacteria 2141
82 Ga0197907_10559547 3300020069 Bacteria 2495
83 Ga0206356_10625959 3300020070 Bacteria 2782
84 Ga0206356_11016126 3300020070 Bacteria 5157
85 Ga0206354_10799421 3300020081 Bacteria 1873
86 Ga0206353_10162256 3300020082 Bacteria 4356
87 Ga0206353_11396466 3300020082 Bacteria 9336
88 Ga0213871_10084399 3300021441 Bacteria 914
89 Ga0207692_10176680 3300025898 Bacteria 1241
90 Ga0207699_10019672 3300025906 Bacteria 3605
91 Ga0207699_10130132 3300025906 Bacteria 1640
92 Ga0207705_10042863 3300025909 Bacteria 3250
93 Ga0207705_10102409 3300025909 Bacteria 2108
94 Ga0207705_10309375 3300025909 Bacteria 1213
95 Ga0207684_10258792 3300025910 Bacteria 1501
96 Ga0207707_10082086 3300025912 Bacteria 2814
97 Ga0207707_10092825 3300025912 Bacteria 2637
98 Ga0207707_10092918 3300025912 Bacteria 2636
99 Ga0207707_10151884 3300025912 Bacteria 2024
100 Ga0207707_10610682 3300025912 Bacteria 922
101 Ga0207695_10071466 3300025913 Bacteria 3544
102 Ga0207695_10647346 3300025913 Bacteria 938
103 Ga0207671_10083040 3300025914 Bacteria 2405
104 Ga0207693_10002559 3300025915 Bacteria 15814
105 Ga0207693_10029601 3300025915 Bacteria 4324
106 Ga0207693_10188205 3300025915 Bacteria 1625
107 Ga0207693_10321922 3300025915 Bacteria 1210
108 Ga0207693_10326076 3300025915 Bacteria 1202
109 Ga0207693_10741736 3300025915 Bacteria 759
110 Ga0207663_10002881 3300025916 Bacteria 8308
111 Ga0207660_10162806 3300025917 Bacteria 1722
112 Ga0207657_10001344 3300025919 Bacteria 26151
113 Ga0207657_10009662 3300025919 Bacteria 9679
114 Ga0207657_10015304 3300025919 Bacteria 7436
115 Ga0207652_10044820 3300025921 Bacteria 3769
116 Ga0207652_10080649 3300025921 Bacteria 2845
117 Ga0207652_10119256 3300025921 Bacteria 2346
118 Ga0207652_10462878 3300025921 Bacteria 1143
119 Ga0207646_10000371 3300025922 Bacteria 59994
120 Ga0207646_10057680 3300025922 Bacteria 3469
121 Ga0207700_10035417 3300025928 Bacteria 3595
122 Ga0207700_10084679 3300025928 Bacteria 2486
123 Ga0207700_10138634 3300025928 Bacteria 1996
124 Ga0207664_10004888 3300025929 Bacteria 9110
125 Ga0207664_10034890 3300025929 Bacteria 3877
126 Ga0207664_10038111 3300025929 Bacteria 3725
127 Ga0207664_10058331 3300025929 Bacteria 3071
128 Ga0207664_10059139 3300025929 Bacteria 3051
129 Ga0207664_10091187 3300025929 Bacteria 2498
130 Ga0207664_10514429 3300025929 Bacteria 1073
131 Ga0207644_10045421 3300025931 Bacteria 3125
132 Ga0207690_10075425 3300025932 Bacteria 2339
133 Ga0207665_10009528 3300025939 Bacteria 6377
134 Ga0207661_10107205 3300025944 Bacteria 2356
135 Ga0207661_10220261 3300025944 Bacteria 1677
136 Ga0207661_10479975 3300025944 Bacteria 1135
137 Ga0207679_10580045 3300025945 Bacteria 1009
138 Ga0207667_10061417 3300025949 Bacteria 3931
139 Ga0207677_10771548 3300026023 Bacteria 858
140 Ga0207703_10804221 3300026035 Bacteria 898
141 Ga0207639_10376102 3300026041 Bacteria 1275
142 Ga0207678_10305159 3300026067 Bacteria 1368
143 Ga0207683_10621035 3300026121 Bacteria 1001
144 Ga0207698_10277802 3300026142 Bacteria 1547
145 Ga0265337_1081467 3300028556 Bacteria 885
146 Ga0265319_1001506 3300028563 Bacteria 13842
147 Ga0265319_1093652 3300028563 Bacteria 947
148 Ga0265334_10095610 3300028573 Bacteria 1080
149 Ga0265318_10003550 3300028577 Bacteria 7817
150 Ga0265322_10054849 3300028654 Bacteria 1130
151 Ga0265338_10002322 3300028800 Bacteria 28800
152 Ga0265338_10006178 3300028800 Bacteria 15355
153 Ga0265338_10007391 3300028800 Bacteria 13652
154 Ga0265338_10010646 3300028800 Bacteria 10749
155 Ga0265338_10020910 3300028800 Bacteria 6851
156 Ga0265338_10023514 3300028800 Bacteria 6333
157 Ga0265338_10163507 3300028800 Bacteria 1716
158 Ga0265324_10020026 3300029957 Bacteria 2407
159 Ga0265330_10008056 3300031235 Bacteria 5097
160 Ga0265330_10161682 3300031235 Bacteria 951
161 Ga0265332_10092006 3300031238 Bacteria 1282
162 Ga0265328_10120277 3300031239 Bacteria 979
163 Ga0265320_10092187 3300031240 Bacteria 1402
164 Ga0265329_10019552 3300031242 Bacteria 2297
165 Ga0265340_10050887 3300031247 Bacteria 2008
166 Ga0265340_10086174 3300031247 Bacteria 1473
167 Ga0265327_10009229 3300031251 Bacteria 7154
168 Ga0265327_10033558 3300031251 Bacteria 2858
169 Ga0265327_10048597 3300031251 Bacteria 2230
170 Ga0265316_10020572 3300031344 Bacteria 5614
171 Ga0265314_10006166 3300031711 Bacteria 10650
172 Ga0265314_10008434 3300031711 Bacteria 8829
173 Ga0265342_10010787 3300031712 Bacteria 6302
174 Ga0265342_10016006 3300031712 Bacteria 4914
175 Ga0316583_10028303 3300032133 Bacteria 1999
176 Ga0373934_0143557 3300035086 Bacteria 977
177 Ga0373945_0002469 3300035116 Bacteria 5800
178 Ga0373955_0055386 3300035172 Bacteria 2172
179 Ga0373935_0103661 3300035692 Bacteria 1879
180 Ga0373933_0057624 3300035724 Bacteria 2335
181 Ga0373947_0006051 3300035725 Bacteria 7050
182 Ga0373937_0078927 3300036401 Bacteria 3042
183 Ga0373925_0003168 3300037068 Bacteria 12878
184 Ga0395899_0014999 3300037312 Bacteria 5911
185 Ga0395899_0224379 3300037312 Bacteria 1300
186 Ga0395899_0361997 3300037312 Bacteria 968
187 Ga0395900_0046890 3300037418 Bacteria 4449
188 Ga0395900_0151617 3300037418 Bacteria 2368
189 Ga0395900_0226912 3300037418 Bacteria 1880
190 Ga0395900_0287821 3300037418 Bacteria 1633
191 Ga0395898_0035110 3300037466 Bacteria 4990
192 Ga0395898_0072543 3300037466 Bacteria 3326
193 Ga0395898_0163172 3300037466 Bacteria 2131
194 Ga0395898_0639218 3300037466 Bacteria 1006
195 Ga0395905_0320176 3300037471 Bacteria 1440
196 Ga0395905_0591049 3300037471 Bacteria 1012
197 Ga0395901_0135721 3300038443 Bacteria 2586
198 Ga0395901_0286259 3300038443 Bacteria 1711
199 Ga0395901_0479780 3300038443 Bacteria 1268
200 Ga0436360_1015244 3300039438 Bacteria 6330
201 Ga0436360_1281619 3300039438 Bacteria 1057
202 Ga0436363_1002732 3300039450 Bacteria 1321
203 Ga0466969_0016387 3300044656 Bacteria 3877
204 Ga0466965_0158005 3300044683 Bacteria 1188
205 Ga0466966_0020298 3300044684 Bacteria 4372
206 Ga0466966_0383595 3300044684 Bacteria 844
207 Ga0466961_0003166 3300044693 Bacteria 10246
208 Ga0466961_0017573 3300044693 Bacteria 4596
209 Ga0466961_0068244 3300044693 Bacteria 2258
210 Ga0466961_0490754 3300044693 Bacteria 742
211 Ga0466963_0000048 3300044694 Bacteria 39958
212 Ga0466963_0000967 3300044694 Bacteria 14752
213 Ga0466963_0001327 3300044694 Bacteria 13181
214 Ga0466963_0002800 3300044694 Bacteria 9828
215 Ga0466963_0010395 3300044694 Bacteria 5634
216 Ga0466963_0032079 3300044694 Bacteria 3399
217 Ga0466963_0044907 3300044694 Bacteria 2908
218 Ga0466963_0126622 3300044694 Bacteria 1761
219 Ga0466964_0000548 3300044706 Bacteria 11788
220 Ga0466964_0004529 3300044706 Bacteria 5133
221 Ga0466964_0034017 3300044706 Bacteria 2033
222 Ga0466964_0061800 3300044706 Bacteria 1560
223 Ga0466971_0001693 3300044719 Bacteria 9343
224 Ga0466971_0002619 3300044719 Bacteria 7610
225 Ga0466971_0068180 3300044719 Bacteria 1613
226 Ga0466957_0002205 3300044842 Bacteria 10443
227 Ga0466957_0034547 3300044842 Bacteria 3033
228 Ga0466957_0039772 3300044842 Bacteria 2838
229 Ga0466957_0052370 3300044842 Bacteria 2485
230 Ga0466957_0079894 3300044842 Bacteria 2036
231 Ga0466957_0105433 3300044842 Bacteria 1782
232 Ga0466957_0121187 3300044842 Bacteria 1667
233 Ga0466957_0176181 3300044842 Bacteria 1395
234 Ga0466957_0205699 3300044842 Bacteria 1294
235 Ga0466957_0342037 3300044842 Bacteria 1013
236 Ga0466960_0411347 3300044901 Bacteria 781
237 Ga0466959_0035689 3300045049 Bacteria 3675
238 Ga0466959_0612177 3300045049 Bacteria 732
239 Ga0466958_0000428 3300045836 Bacteria 17380
240 Ga0466958_0001308 3300045836 Bacteria 11730
241 Ga0466958_0003345 3300045836 Bacteria 8310
242 Ga0466958_0005432 3300045836 Bacteria 6860
243 Ga0466958_0011964 3300045836 Bacteria 4903
244 Ga0466958_0041709 3300045836 Bacteria 2761
245 Ga0466958_0123235 3300045836 Bacteria 1624
246 Ga0466958_0332364 3300045836 Bacteria 977
247 Ga0466958_0374707 3300045836 Bacteria 917
248 Ga0466967_0000041 3300045976 Bacteria 46227
249 Ga0466967_0000056 3300045976 Bacteria 40207
250 Ga0466967_0001136 3300045976 Bacteria 14841
251 Ga0466967_0009556 3300045976 Bacteria 7205
252 Ga0466967_0010119 3300045976 Bacteria 7052
253 Ga0466967_0016342 3300045976 Bacteria 5850
254 Ga0466967_0025487 3300045976 Bacteria 4878
255 Ga0466967_0041038 3300045976 Bacteria 3986
256 Ga0466967_0064089 3300045976 Bacteria 3267
257 Ga0466967_0098590 3300045976 Bacteria 2668
258 Ga0466967_0122876 3300045976 Bacteria 2401
259 Ga0466967_0160582 3300045976 Bacteria 2109
260 Ga0466967_0227351 3300045976 Bacteria 1775
261 Ga0466967_0306646 3300045976 Bacteria 1528
262 Ga0466967_0311842 3300045976 Bacteria 1515
263 Ga0466967_0337080 3300045976 Bacteria 1457
264 Ga0466967_1265375 3300045976 Bacteria 735
265 Ga0495592_0293713 3300046454 Bacteria 1058
266 Ga0495629_0308517 3300046459 Bacteria 1083
267 Ga0495641_0158729 3300046461 Bacteria 1011
268 Ga0495651_0030418 3300046462 Bacteria 4211
269 Ga0495651_0060470 3300046462 Bacteria 2901
270 Ga0495651_0076324 3300046462 Bacteria 2539
271 Ga0495653_0012796 3300046463 Bacteria 6850
272 Ga0495653_0097907 3300046463 Bacteria 2130
273 Ga0495653_0167405 3300046463 Bacteria 1520
274 Ga0495653_0184709 3300046463 Bacteria 1427
275 Ga0495653_0211775 3300046463 Bacteria 1308
276 Ga0495580_0005739 3300046472 Bacteria 10197
277 Ga0495639_0002012 3300046475 Bacteria 9004
278 Ga0495662_0031529 3300046476 Bacteria 2561
279 Ga0495664_0002458 3300046477 Bacteria 9973
280 Ga0495608_0042314 3300046511 Bacteria 3046
281 Ga0495608_0045018 3300046511 Bacteria 2943
282 Ga0495608_0193870 3300046511 Bacteria 1282
283 Ga0495608_0231508 3300046511 Bacteria 1156
284 Ga0495618_0088590 3300046514 Bacteria 1979
285 Ga0495618_0116266 3300046514 Bacteria 1712
286 Ga0495618_0145449 3300046514 Bacteria 1515
287 Ga0495628_0034140 3300046516 Bacteria 4095
288 Ga0495630_0009935 3300046517 Bacteria 6853
289 Ga0495630_0164026 3300046517 Bacteria 1691
290 Ga0495630_0193791 3300046517 Bacteria 1550
291 Ga0495666_0001833 3300046526 Bacteria 10499
292 Ga0495652_0033562 3300046529 Bacteria 4480
293 Ga0495665_0001146 3300046531 Bacteria 14076
294 Ga0495586_0009376 3300046535 Bacteria 5207
295 Ga0495645_0114423 3300046543 Bacteria 1906
296 Ga0495667_0019599 3300046559 Bacteria 4563
297 Ga0495667_0043796 3300046559 Bacteria 2965
298 Ga0495667_0103228 3300046559 Bacteria 1844
299 Ga0495667_0124332 3300046559 Bacteria 1665
300 Ga0495634_0009599 3300046642 Bacteria 7130
301 Ga0495634_0030991 3300046642 Bacteria 3686
302 Ga0495635_0142414 3300046663 Bacteria 1632
303 Ga0495635_0186492 3300046663 Bacteria 1409
304 Ga0495657_0027126 3300046675 Bacteria 4047
305 Ga0495657_0054861 3300046675 Bacteria 2660
306 Ga0495599_0051142 3300046678 Bacteria 2589
307 Ga0495623_0110336 3300046679 Bacteria 1668
308 Ga0495646_0191961 3300046680 Bacteria 1116
309 Ga0495647_0000409 3300046681 Bacteria 12314
310 Ga0495658_0001411 3300046683 Bacteria 12621
311 Ga0495613_0015455 3300046689 Bacteria 5675
312 Ga0495613_0401145 3300046689 Bacteria 935
313 Ga0495624_0001586 3300046690 Bacteria 17481
314 Ga0495624_0032405 3300046690 Bacteria 3389
315 Ga0495600_0154298 3300046809 Bacteria 1486
316 Ga0495581_0000855 3300047315 Bacteria 16229
317 Ga0495604_0166789 3300047317 Bacteria 1552
318 Ga0495674_0011237 3300047319 Bacteria 8453
319 Ga0495674_0198236 3300047319 Bacteria 1666
320 Ga0495674_0292541 3300047319 Bacteria 1332
321 Ga0495676_0013093 3300047321 Bacteria 7463
322 Ga0495676_0335414 3300047321 Bacteria 1013
323 Ga0495680_0085626 3300047322 Bacteria 2373
324 Ga0495675_0085883 3300047444 Bacteria 1978
325 Ga0495684_0004610 3300047471 Bacteria 10764
326 Ga0495684_0012175 3300047471 Bacteria 6635
327 Ga0495684_0036579 3300047471 Bacteria 3763
328 Ga0495593_0000420 3300047673 Bacteria 23646
329 Ga0495614_0000273 3300048089 Bacteria 20182
330 Ga0496100_0428186 3300048903 Bacteria 1012
331 Ga0496101_0180543 3300048904 Bacteria 1625
332 Ga0496102_0125468 3300048905 Bacteria 2399
333 Ga0496102_0181644 3300048905 Bacteria 1982
334 Ga0496102_0298343 3300048905 Bacteria 1519
335 Ga0496104_0007553 3300048907 Bacteria 9614
336 Ga0496104_0834369 3300048907 Bacteria 827
337 Ga0496105_0004615 3300048908 Bacteria 10382
338 Ga0496105_0056268 3300048908 Bacteria 3246
339 Ga0496106_0002736 3300048909 Bacteria 13066
340 Ga0496107_0004538 3300048910 Bacteria 9401
341 Ga0496107_0445436 3300048910 Bacteria 962
342 Ga0496108_0132376 3300048911 Bacteria 2143
343 Ga0496109_0010128 3300048912 Bacteria 8044
344 Ga0496109_0091756 3300048912 Bacteria 2809
345 Ga0496109_0136341 3300048912 Bacteria 2293
346 Ga0496110_0014684 3300048913 Bacteria 6510
347 Ga0496110_0168575 3300048913 Bacteria 1986
348 Ga0496111_0255455 3300048914 Bacteria 1300
349 Ga0496111_0488058 3300048914 Bacteria 907
350 Ga0496111_0511830 3300048914 Bacteria 883
351 Ga0496112_0003763 3300048915 Bacteria 12665
352 Ga0496112_0065565 3300048915 Bacteria 3584
353 Ga0496112_0130281 3300048915 Bacteria 2486
354 Ga0496112_0234255 3300048915 Bacteria 1790
355 Ga0496113_0398751 3300048916 Bacteria 1105
356 Ga0496114_0295165 3300048917 Bacteria 1430
357 Ga0496114_0394305 3300048917 Bacteria 1226
358 Ga0496114_0673800 3300048917 Bacteria 908
359 Ga0496115_0014102 3300048918 Bacteria 6051
360 Ga0501034_0050743 3300049571 Bacteria 4184
361 Ga0501047_0351479 3300049581 Bacteria 1311
362 Ga0501067_0024113 3300049583 Bacteria 3373
363 Ga0501067_0058895 3300049583 Bacteria 2127
364 Ga0501067_0068225 3300049583 Bacteria 1969
365 Ga0501067_0074363 3300049583 Bacteria 1883
366 Ga0501069_0005142 3300049585 Bacteria 6793
367 Ga0501069_0044655 3300049585 Bacteria 2453
368 Ga0501069_0143556 3300049585 Bacteria 1370
369 Ga0501070_0057816 3300049586 Bacteria 3216
370 Ga0501070_0170893 3300049586 Bacteria 1790
371 Ga0501072_0003578 3300049588 Bacteria 11692
372 Ga0501073_0006396 3300049589 Bacteria 8770
373 Ga0501074_0044191 3300049590 Bacteria 3225
374 Ga0501074_0137243 3300049590 Bacteria 1749
375 Ga0501080_0018701 3300049742 Bacteria 6412
376 Ga0501083_0000290 3300049744 Bacteria 31698
377 Ga0501083_0328701 3300049744 Bacteria 994
378 nmdc:mga0n895_4986_c1 3300050512 Bacteria 11015
379 nmdc:mga0rr50_22727_c1 3300050513 Bacteria 4309
380 Ga0495601_0037198 3300053077 Bacteria 3042
381 Ga0495601_0038673 3300053077 Bacteria 2984
382 Ga0495595_0004782 3300053084 Bacteria 5456
383 Ga0495595_0033428 3300053084 Bacteria 2320
384 Ga0495595_0202011 3300053084 Bacteria 990
385 Ga0495619_0161170 3300053085 Bacteria 1549
386 Ga0495619_0198632 3300053085 Bacteria 1388
387 Ga0466962_0006487 3300061719 Bacteria 5616
388 Ga0466962_0006824 3300061719 Bacteria 5480
389 Ga0466962_0028637 3300061719 Bacteria 2667
390 Ga0466962_0069210 3300061719 Bacteria 1686
391 Ga0466962_0070208 3300061719 Bacteria 1673
392 Ga0070698_100307999
393 Ga0070658_10041042
394 Ga0070658_10429591
395 Ga0070683_100042475
396 Ga0070683_100642644
397 Ga0070680_100349693
398 Ga0070680_100422080
399 Ga0070680_100436291
400 Ga0070682_100081981
401 Ga0070682_100153710
402 Ga0070660_100031065
403 Ga0070660_100036640
404 Ga0070660_100105719
405 Ga0070659_100114834
406 Ga0070709_10011315
407 Ga0070714_100034199
408 Ga0070714_100069917
409 Ga0070714_100144330
410 Ga0070714_100145945
411 Ga0070714_100166254
412 Ga0070714_100216149
413 Ga0070710_10031605
414 Ga0070710_10448706
415 Ga0070708_100478703
416 Ga0070663_100589206
417 Ga0070681_10032707
418 Ga0070681_10106934
419 Ga0070681_10123201
420 Ga0070681_10132732
421 Ga0070681_10149121
422 Ga0070681_10233780
423 Ga0070681_10496961
424 Ga0070707_100000570
425 Ga0070707_100123638
426 Ga0070707_100434795
427 Ga0070698_100015489
428 Ga0070699_100166587
429 Ga0070679_100019458
430 Ga0070679_100155445
431 Ga0070679_100156105
432 Ga0070679_100241496
433 Ga0070679_100461403
434 Ga0070684_100023081
435 Ga0070684_100070847
436 Ga0070684_100202362
437 Ga0070697_100473795
438 Ga0068853_100476887
439 Ga0070695_100000253
440 Ga0070696_100184619
441 Ga0070665_100565156
442 Ga0070704_100067894
443 Ga0068855_100052596
444 Ga0070664_100628740
445 Ga0068854_100711496
446 Ga0068852_100317143
447 Ga0070717_10006656
448 Ga0070717_10012809
449 Ga0070717_10042171
450 Ga0070717_10052786
451 Ga0070717_10147034
452 Ga0070717_10366937
453 Ga0070712_100142958
454 Ga0097621_100431920
455 Ga0105240_10050080
456 Ga0105240_10180280
457 Ga0105245_10009775
458 Ga0105248_10344721
459 Ga0105237_10172828
460 Ga0105237_10772059
461 Ga0105238_10074304
462 Ga0105238_10916165
463 Ga0105239_10178931
464 Ga0157373_10194919
465 Ga0157373_10256485
466 Ga0157370_10008749
467 Ga0157370_10219331
468 Ga0157369_10484411
469 Ga0157372_10232874
470 Ga0182008_10008509
471 Ga0182006_1012923
472 Ga0182007_10023948
473 Ga0197907_10559547
474 Ga0206356_10625959
475 Ga0206356_11016126
476 Ga0206354_10799421
477 Ga0206353_10162256
478 Ga0206353_11396466
479 Ga0213871_10084399
480 Ga0207692_10176680
481 Ga0207699_10019672
482 Ga0207699_10130132
483 Ga0207705_10042863
484 Ga0207705_10102409
485 Ga0207705_10309375
486 Ga0207684_10258792
487 Ga0207707_10082086
488 Ga0207707_10092825
489 Ga0207707_10092918
490 Ga0207707_10151884
491 Ga0207707_10610682
492 Ga0207695_10071466
493 Ga0207695_10647346
494 Ga0207671_10083040
495 Ga0207693_10002559
496 Ga0207693_10029601
497 Ga0207693_10188205
498 Ga0207693_10321922
499 Ga0207693_10326076
500 Ga0207693_10741736
501 Ga0207663_10002881
502 Ga0207660_10162806
503 Ga0207657_10001344
504 Ga0207657_10009662
505 Ga0207657_10015304
506 Ga0207652_10044820
507 Ga0207652_10080649
508 Ga0207652_10119256
509 Ga0207652_10462878
510 Ga0207646_10000371
511 Ga0207646_10057680
512 Ga0207700_10035417
513 Ga0207700_10084679
514 Ga0207700_10138634
515 Ga0207664_10004888
516 Ga0207664_10034890
517 Ga0207664_10038111
518 Ga0207664_10058331
519 Ga0207664_10059139
520 Ga0207664_10091187
521 Ga0207664_10514429
522 Ga0207644_10045421
523 Ga0207690_10075425
524 Ga0207665_10009528
525 Ga0207661_10107205
526 Ga0207661_10220261
527 Ga0207661_10479975
528 Ga0207679_10580045
529 Ga0207667_10061417
530 Ga0207677_10771548
531 Ga0207703_10804221
532 Ga0207639_10376102
533 Ga0207678_10305159
534 Ga0207683_10621035
535 Ga0207698_10277802
536 Ga0265337_1081467
537 Ga0265319_1001506
538 Ga0265319_1093652
539 Ga0265334_10095610
540 Ga0265318_10003550
541 Ga0265322_10054849
542 Ga0265338_10002322
543 Ga0265338_10006178
544 Ga0265338_10007391
545 Ga0265338_10010646
546 Ga0265338_10020910
547 Ga0265338_10023514
548 Ga0265338_10163507
549 Ga0265324_10020026
550 Ga0265330_10008056
551 Ga0265330_10161682
552 Ga0265332_10092006
553 Ga0265328_10120277
554 Ga0265320_10092187
555 Ga0265329_10019552
556 Ga0265340_10050887
557 Ga0265340_10086174
558 Ga0265327_10009229
559 Ga0265327_10033558
560 Ga0265327_10048597
561 Ga0265316_10020572
562 Ga0265314_10006166
563 Ga0265314_10008434
564 Ga0265342_10010787
565 Ga0265342_10016006
566 Ga0316583_10028303
567 Ga0373934_0143557
568 Ga0373945_0002469
569 Ga0373955_0055386
570 Ga0373935_0103661
571 Ga0373933_0057624
572 Ga0373947_0006051
573 Ga0373937_0078927
574 Ga0373925_0003168
575 Ga0395899_0014999
576 Ga0395899_0224379
577 Ga0395899_0361997
578 Ga0395900_0046890
579 Ga0395900_0151617
580 Ga0395900_0226912
581 Ga0395900_0287821
582 Ga0395898_0035110
583 Ga0395898_0072543
584 Ga0395898_0163172
585 Ga0395898_0639218
586 Ga0395905_0320176
587 Ga0395905_0591049
588 Ga0395901_0135721
589 Ga0395901_0286259
590 Ga0395901_0479780
591 Ga0436360_1015244
592 Ga0436360_1281619
593 Ga0436363_1002732
594 Ga0466969_0016387
595 Ga0466965_0158005
596 Ga0466966_0020298
597 Ga0466966_0383595
598 Ga0466961_0003166
599 Ga0466961_0017573
600 Ga0466961_0068244
601 Ga0466961_0490754
602 Ga0466963_0000048
603 Ga0466963_0000967
604 Ga0466963_0001327
605 Ga0466963_0002800
606 Ga0466963_0010395
607 Ga0466963_0032079
608 Ga0466963_0044907
609 Ga0466963_0126622
610 Ga0466964_0000548
611 Ga0466964_0004529
612 Ga0466964_0034017
613 Ga0466964_0061800
614 Ga0466971_0001693
615 Ga0466971_0002619
616 Ga0466971_0068180
617 Ga0466957_0002205
618 Ga0466957_0034547
619 Ga0466957_0039772
620 Ga0466957_0052370
621 Ga0466957_0079894
622 Ga0466957_0105433
623 Ga0466957_0121187
624 Ga0466957_0176181
625 Ga0466957_0205699
626 Ga0466957_0342037
627 Ga0466960_0411347
628 Ga0466959_0035689
629 Ga0466959_0612177
630 Ga0466958_0000428
631 Ga0466958_0001308
632 Ga0466958_0003345
633 Ga0466958_0005432
634 Ga0466958_0011964
635 Ga0466958_0041709
636 Ga0466958_0123235
637 Ga0466958_0332364
638 Ga0466958_0374707
639 Ga0466967_0000041
640 Ga0466967_0000056
641 Ga0466967_0001136
642 Ga0466967_0009556
643 Ga0466967_0010119
644 Ga0466967_0016342
645 Ga0466967_0025487
646 Ga0466967_0041038
647 Ga0466967_0064089
648 Ga0466967_0098590
649 Ga0466967_0122876
650 Ga0466967_0160582
651 Ga0466967_0227351
652 Ga0466967_0306646
653 Ga0466967_0311842
654 Ga0466967_0337080
655 Ga0466967_1265375
656 Ga0495592_0293713
657 Ga0495629_0308517
658 Ga0495641_0158729
659 Ga0495651_0030418
660 Ga0495651_0060470
661 Ga0495651_0076324
662 Ga0495653_0012796
663 Ga0495653_0097907
664 Ga0495653_0167405
665 Ga0495653_0184709
666 Ga0495653_0211775
667 Ga0495580_0005739
668 Ga0495639_0002012
669 Ga0495662_0031529
670 Ga0495664_0002458
671 Ga0495608_0042314
672 Ga0495608_0045018
673 Ga0495608_0193870
674 Ga0495608_0231508
675 Ga0495618_0088590
676 Ga0495618_0116266
677 Ga0495618_0145449
678 Ga0495628_0034140
679 Ga0495630_0009935
680 Ga0495630_0164026
681 Ga0495630_0193791
682 Ga0495666_0001833
683 Ga0495652_0033562
684 Ga0495665_0001146
685 Ga0495586_0009376
686 Ga0495645_0114423
687 Ga0495667_0019599
688 Ga0495667_0043796
689 Ga0495667_0103228
690 Ga0495667_0124332
691 Ga0495634_0009599
692 Ga0495634_0030991
693 Ga0495635_0142414
694 Ga0495635_0186492
695 Ga0495657_0027126
696 Ga0495657_0054861
697 Ga0495599_0051142
698 Ga0495623_0110336
699 Ga0495646_0191961
700 Ga0495647_0000409
701 Ga0495658_0001411
702 Ga0495613_0015455
703 Ga0495613_0401145
704 Ga0495624_0001586
705 Ga0495624_0032405
706 Ga0495600_0154298
707 Ga0495581_0000855
708 Ga0495604_0166789
709 Ga0495674_0011237
710 Ga0495674_0198236
711 Ga0495674_0292541
712 Ga0495676_0013093
713 Ga0495676_0335414
714 Ga0495680_0085626
715 Ga0495675_0085883
716 Ga0495684_0004610
717 Ga0495684_0012175
718 Ga0495684_0036579
719 Ga0495593_0000420
720 Ga0495614_0000273
721 Ga0496100_0428186
722 Ga0496101_0180543
723 Ga0496102_0125468
724 Ga0496102_0181644
725 Ga0496102_0298343
726 Ga0496104_0007553
727 Ga0496104_0834369
728 Ga0496105_0004615
729 Ga0496105_0056268
730 Ga0496106_0002736
731 Ga0496107_0004538
732 Ga0496107_0445436
733 Ga0496108_0132376
734 Ga0496109_0010128
735 Ga0496109_0091756
736 Ga0496109_0136341
737 Ga0496110_0014684
738 Ga0496110_0168575
739 Ga0496111_0255455
740 Ga0496111_0488058
741 Ga0496111_0511830
742 Ga0496112_0003763
743 Ga0496112_0065565
744 Ga0496112_0130281
745 Ga0496112_0234255
746 Ga0496113_0398751
747 Ga0496114_0295165
748 Ga0496114_0394305
749 Ga0496114_0673800
750 Ga0496115_0014102
751 Ga0501034_0050743
752 Ga0501047_0351479
753 Ga0501067_0024113
754 Ga0501067_0058895
755 Ga0501067_0068225
756 Ga0501067_0074363
757 Ga0501069_0005142
758 Ga0501069_0044655
759 Ga0501069_0143556
760 Ga0501070_0057816
761 Ga0501070_0170893
762 Ga0501072_0003578
763 Ga0501073_0006396
764 Ga0501074_0044191
765 Ga0501074_0137243
766 Ga0501080_0018701
767 Ga0501083_0000290
768 Ga0501083_0328701
769 nmdc:mga0n895_4986_c1
770 nmdc:mga0rr50_22727_c1
771 Ga0495601_0037198
772 Ga0495601_0038673
773 Ga0495595_0004782
774 Ga0495595_0033428
775 Ga0495595_0202011
776 Ga0495619_0161170
777 Ga0495619_0198632
778 Ga0466962_0006487
779 Ga0466962_0006824
780 Ga0466962_0028637
781 Ga0466962_0069210
782 Ga0466962_0070208

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13507

GATase_5

CobB/CobQ-like glutamine amidotransferase domain

56

256

0.87

PF01965

DJ-1_PfpI

DJ-1/PfpI family

84

158

0.86

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

58

154

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9399 4 216
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9229 4 216
3ujn-assembly1.cif.gz_A formyl glycinamide ribonucleotide amidotransferase from salmonella typhimurium : role of the atp complexation and glutaminase domain in catalytic coupling 0.8632 4 218
4r7g-assembly1.cif.gz_A determination of the formylglycinamide ribonucleotide amidotransferase ammonia pathway by combining 3d-rism theory with experiment 0.8601 4 217
4lgy-assembly1.cif.gz_A importance of hydrophobic cavities in allosteric regulation of formylglycinamide synthetase: insight from xenon trapping and statistical coupling analysis 0.8523 4 217
ID Description Score Start End Superfamily
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.95 4 218 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9471 7 218 3.40.50.880
af_Q59042_1_229_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9409 7 219 3.40.50.880
3d54L00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.94 4 216 3.40.50.880
3d54L00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.923 4 216 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7V9P6S3-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurQ 0.9656 78 225 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
GO:0016787
AF-A0A6J7KM29-F1-model_v4 Unannotated protein 0.9642 74 227 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A6J6JNV2-F1-model_v4 Unannotated protein 0.964 74 216 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A7Z8PE90-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurQ 0.9599 90 216 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
GO:0016787
AF-A0A5E6MCS1-F1-model_v4 Partial phosphoribosylformylglycinamidine synthase (EC 6.3.5.3) 0.9587 71 214 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
GO:0016787

Map