F431930

General Info

Members Datasets Scaffolds Average Seq Length
391 194 782 114

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10426619|Ga0070666_104266192
Length 129
Sequence VIAAPNSRIRRLGRGAGPAALLAFVALAAIGCASSNAGGPNASPVATTSVDLPKSYKFEPAAITVKAGSTVTWTNDDNFTHSVRLAGAQPLVMKPGEHVTQTFATPGTYQYDCSFHPQDMKGTVVVTGG

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
114 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
115 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
123 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
124 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
125 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
126 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
127 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
128 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 7.16
Rhizosphere 91.82
Stem 0
Stem Tuber 0
Unclassified 20.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10426619 3300005335 Unclassified 956
2 2214584978 2209111006 Bacteria 524
3 Ga0070658_10621408 3300005327 Bacteria 937
4 Ga0070658_11683963 3300005327 Bacteria 549
5 Ga0070683_100003946 3300005329 Bacteria 12140
6 Ga0070683_100150434 3300005329 Bacteria 2207
7 Ga0070683_100875109 3300005329 Bacteria 862
8 Ga0070670_101584903 3300005331 Bacteria 602
9 Ga0068869_100325973 3300005334 Bacteria 1247
10 Ga0070680_100028376 3300005336 Bacteria 4488
11 Ga0070682_100135908 3300005337 Bacteria 1670
12 Ga0070682_100715221 3300005337 Bacteria 805
13 Ga0070660_100163465 3300005339 Bacteria 1795
14 Ga0070660_100187343 3300005339 Bacteria 1676
15 Ga0070691_10326433 3300005341 Bacteria 846
16 Ga0070661_100146155 3300005344 Bacteria 1785
17 Ga0070673_100128942 3300005364 Bacteria 2120
18 Ga0070673_101297487 3300005364 Unclassified 684
19 Ga0070701_10493421 3300005438 Unclassified 794
20 Ga0070705_100041857 3300005440 Bacteria 2615
21 Ga0070705_101547385 3300005440 Unclassified 557
22 Ga0070700_100921819 3300005441 Bacteria 713
23 Ga0070663_101948096 3300005455 Bacteria 528
24 Ga0070678_100071909 3300005456 Bacteria 2591
25 Ga0070678_100379115 3300005456 Bacteria 1223
26 Ga0070678_100602082 3300005456 Unclassified 981
27 Ga0070678_100924325 3300005456 Unclassified 799
28 Ga0070678_101832438 3300005456 Unclassified 572
29 Ga0070681_10063235 3300005458 Bacteria 3673
30 Ga0068867_100214174 3300005459 Bacteria 1549
31 Ga0070679_100164376 3300005530 Bacteria 2193
32 Ga0070684_100004187 3300005535 Bacteria 10926
33 Ga0068853_100563489 3300005539 Bacteria 1080
34 Ga0070686_100255950 3300005544 Bacteria 1281
35 Ga0070695_101585002 3300005545 Bacteria 546
36 Ga0070696_100210767 3300005546 Bacteria 1454
37 Ga0070693_100026835 3300005547 Bacteria 3113
38 Ga0070693_100194243 3300005547 Bacteria 1315
39 Ga0070704_101343105 3300005549 Bacteria 655
40 Ga0070664_100058566 3300005564 Bacteria 3276
41 Ga0068854_100147623 3300005578 Bacteria 1810
42 Ga0068856_100352807 3300005614 Bacteria 1489
43 Ga0068856_101207526 3300005614 Bacteria 772
44 Ga0070702_100023742 3300005615 Bacteria 3262
45 Ga0070702_100028678 3300005615 Bacteria 3018
46 Ga0068864_100154787 3300005618 Bacteria 2080
47 Ga0068861_101232001 3300005719 Unclassified 725
48 Ga0068870_10066960 3300005840 Bacteria 1947
49 Ga0068858_100292974 3300005842 Bacteria 1551
50 Ga0068860_102322917 3300005843 Unclassified 557
51 Ga0081455_10025710 3300005937 Bacteria 5430
52 Ga0081455_10067580 3300005937 Bacteria 2978
53 Ga0081540_1007593 3300005983 Bacteria 7703
54 Ga0075364_10178380 3300006051 Unclassified 1437
55 Ga0075432_10150640 3300006058 Bacteria 894
56 Ga0075367_10325278 3300006178 Bacteria 969
57 Ga0068871_100496374 3300006358 Unclassified 1100
58 Ga0075428_100488631 3300006844 Bacteria 1317
59 Ga0075428_101140470 3300006844 Bacteria 823
60 Ga0075430_100351283 3300006846 Bacteria 1218
61 Ga0075430_100928236 3300006846 Unclassified 717
62 Ga0075431_100116491 3300006847 Bacteria 2757
63 Ga0075433_10436482 3300006852 Unclassified 1154
64 Ga0075434_100567356 3300006871 Unclassified 1154
65 Ga0075429_100470197 3300006880 Bacteria 1101
66 Ga0075429_101840887 3300006880 Bacteria 525
67 Ga0075435_100768399 3300007076 Bacteria 838
68 Ga0111539_10274247 3300009094 Unclassified 1963
69 Ga0111539_10277835 3300009094 Bacteria 1949
70 Ga0111539_10302864 3300009094 Bacteria 1860
71 Ga0111539_10897468 3300009094 Unclassified 1031
72 Ga0111539_11304217 3300009094 Bacteria 843
73 Ga0105245_10094907 3300009098 Bacteria 2750
74 Ga0105245_10228841 3300009098 Bacteria 1797
75 Ga0105247_10257409 3300009101 Unclassified 1195
76 Ga0114129_10025342 3300009147 Bacteria 8403
77 Ga0114129_10116215 3300009147 Bacteria 3687
78 Ga0114129_10179964 3300009147 Bacteria 2878
79 Ga0114129_10279318 3300009147 Bacteria 2232
80 Ga0114129_10397369 3300009147 Bacteria 1817
81 Ga0114129_11546125 3300009147 Bacteria 814
82 Ga0105243_11052195 3300009148 Unclassified 819
83 Ga0105243_11607220 3300009148 Bacteria 677
84 Ga0105243_12199018 3300009148 Bacteria 588
85 Ga0105241_10154925 3300009174 Bacteria 1878
86 Ga0105242_10880448 3300009176 Bacteria 894
87 Ga0105248_10287240 3300009177 Bacteria 1852
88 Ga0105248_11034112 3300009177 Unclassified 928
89 Ga0105237_11442442 3300009545 Unclassified 695
90 Ga0105237_12614434 3300009545 Unclassified 515
91 Ga0105238_11466927 3300009551 Bacteria 710
92 Ga0105239_12201114 3300010375 Unclassified 641
93 Ga0105246_11449588 3300011119 Unclassified 643
94 Ga0105246_11794425 3300011119 Bacteria 586
95 Ga0157347_1041206 3300012502 Bacteria 611
96 Ga0157370_10151258 3300013104 Unclassified 2160
97 Ga0157378_10205479 3300013297 Bacteria 1865
98 Ga0157372_10337442 3300013307 Bacteria 1756
99 Ga0157375_11210901 3300013308 Bacteria 886
100 Ga0163163_10829302 3300014325 Bacteria 988
101 Ga0163163_12349595 3300014325 Bacteria 592
102 Ga0157380_10213233 3300014326 Unclassified 1722
103 Ga0182008_10074432 3300014497 Bacteria 1671
104 Ga0157377_10390230 3300014745 Bacteria 945
105 Ga0157376_10278706 3300014969 Bacteria 1574
106 Ga0182006_1261102 3300015261 Bacteria 568
107 Ga0206353_11820103 3300020082 Bacteria 652
108 Ga0207680_10706784 3300025903 Unclassified 722
109 Ga0207643_10091007 3300025908 Bacteria 1779
110 Ga0207705_10480133 3300025909 Bacteria 965
111 Ga0207705_11415160 3300025909 Bacteria 528
112 Ga0207684_11528157 3300025910 Bacteria 542
113 Ga0207654_10385784 3300025911 Bacteria 971
114 Ga0207707_10111212 3300025912 Bacteria 2395
115 Ga0207660_10053211 3300025917 Bacteria 2885
116 Ga0207657_10338133 3300025919 Bacteria 1188
117 Ga0207649_11161033 3300025920 Bacteria 610
118 Ga0207652_10022484 3300025921 Bacteria 5217
119 Ga0207646_10411198 3300025922 Bacteria 1222
120 Ga0207659_10122013 3300025926 Bacteria 1998
121 Ga0207687_10036190 3300025927 Bacteria 3362
122 Ga0207687_10280756 3300025927 Bacteria 1335
123 Ga0207686_10918365 3300025934 Unclassified 707
124 Ga0207709_10358367 3300025935 Unclassified 1103
125 Ga0207711_11008383 3300025941 Bacteria 772
126 Ga0207689_10582681 3300025942 Bacteria 940
127 Ga0207661_10194355 3300025944 Bacteria 1780
128 Ga0207661_10466841 3300025944 Bacteria 1151
129 Ga0207661_10557657 3300025944 Bacteria 1050
130 Ga0207679_10253123 3300025945 Bacteria 1498
131 Ga0207667_10507467 3300025949 Unclassified 1223
132 Ga0207651_10687538 3300025960 Bacteria 900
133 Ga0207651_10721204 3300025960 Bacteria 880
134 Ga0207712_11393995 3300025961 Bacteria 627
135 Ga0207640_10096026 3300025981 Bacteria 2065
136 Ga0207640_11466574 3300025981 Bacteria 612
137 Ga0207658_10507591 3300025986 Bacteria 1075
138 Ga0207703_10054303 3300026035 Bacteria 3258
139 Ga0207678_10867145 3300026067 Unclassified 798
140 Ga0207678_11034550 3300026067 Unclassified 727
141 Ga0207708_11138160 3300026075 Unclassified 681
142 Ga0207702_10091066 3300026078 Bacteria 2669
143 Ga0207702_10126499 3300026078 Bacteria 2295
144 Ga0207648_10442815 3300026089 Bacteria 1182
145 Ga0207648_11305328 3300026089 Unclassified 682
146 Ga0207676_11057992 3300026095 Bacteria 801
147 Ga0207674_10001150 3300026116 Bacteria 34275
148 Ga0207674_10104311 3300026116 Bacteria 2814
149 Ga0207675_100089966 3300026118 Bacteria 2885
150 Ga0207683_10140475 3300026121 Bacteria 2176
151 Ga0207683_10152314 3300026121 Bacteria 2087
152 Ga0207683_10313508 3300026121 Bacteria 1436
153 Ga0207428_10040269 3300027907 Bacteria 3792
154 Ga0207428_10067650 3300027907 Bacteria 2812
155 Ga0207428_10896737 3300027907 Bacteria 627
156 Ga0307405_10147919 3300031731 Unclassified 1648
157 Ga0307405_10655925 3300031731 Bacteria 864
158 Ga0307409_100051866 3300031995 Bacteria 3142
159 Ga0307409_100302234 3300031995 Bacteria 1489
160 Ga0307409_101226564 3300031995 Unclassified 774
161 Ga0307416_100031045 3300032002 Bacteria 4018
162 Ga0307411_10996998 3300032005 Unclassified 750
163 Ga0307415_100008142 3300032126 Bacteria 5793
164 Ga0307415_100718311 3300032126 Unclassified 904
165 Ga0373941_0272732 3300035115 Bacteria 667
166 Ga0373960_0235763 3300035121 Bacteria 660
167 Ga0373942_0057167 3300035207 Unclassified 1109
168 Ga0373942_0061139 3300035207 Bacteria 1080
169 Ga0373931_0247622 3300035691 Unclassified 1083
170 Ga0395899_0012697 3300037312 Bacteria 6455
171 Ga0395899_0044760 3300037312 Bacteria 3297
172 Ga0395899_0197053 3300037312 Unclassified 1406
173 Ga0395899_0659624 3300037312 Bacteria 660
174 Ga0395900_0012790 3300037418 Bacteria 8578
175 Ga0395900_0184443 3300037418 Bacteria 2118
176 Ga0395900_0347229 3300037418 Unclassified 1458
177 Ga0395900_0399603 3300037418 Unclassified 1339
178 Ga0395900_0606769 3300037418 Unclassified 1034
179 Ga0395900_0832112 3300037418 Unclassified 849
180 Ga0395898_0013759 3300037466 Bacteria 8320
181 Ga0395898_0020775 3300037466 Bacteria 6665
182 Ga0395898_0027149 3300037466 Bacteria 5750
183 Ga0395898_0054694 3300037466 Bacteria 3894
184 Ga0395898_0264564 3300037466 Bacteria 1640
185 Ga0395905_0011917 3300037471 Bacteria 8383
186 Ga0395905_0337245 3300037471 Bacteria 1398
187 Ga0395901_0009653 3300038443 Bacteria 9789
188 Ga0395901_0080876 3300038443 Bacteria 3393
189 Ga0395901_0125213 3300038443 Bacteria 2700
190 Ga0395901_0195929 3300038443 Bacteria 2118
191 Ga0395901_0256392 3300038443 Bacteria 1821
192 Ga0395901_0751683 3300038443 Bacteria 968
193 Ga0451800_0794986 3300041459 Bacteria 535
194 Ga0439448_0177205 3300042005 Bacteria 744
195 Ga0439455_0051057 3300042012 Unclassified 1081
196 Ga0450905_063951 3300042142 Unclassified 619
197 Ga0450907_029219 3300042146 Unclassified 936
198 Ga0439459_0016448 3300042438 Bacteria 1368
199 Ga0450918_013652 3300042531 Unclassified 1413
200 Ga0453683_0375913 3300044673 Unclassified 914
201 Ga0451576_1314325 3300045051 Bacteria 754
202 Ga0495603_0854514 3300046455 Unclassified 518
203 Ga0495670_0336839 3300046691 Bacteria 811
204 Ga0495674_0263410 3300047319 Bacteria 1416
205 Ga0496101_0126251 3300048904 Bacteria 1939
206 Ga0496101_0243816 3300048904 Bacteria 1399
207 Ga0496102_0099411 3300048905 Bacteria 2700
208 Ga0496103_0064484 3300048906 Bacteria 2284
209 Ga0496103_0151035 3300048906 Bacteria 1488
210 Ga0496104_0014291 3300048907 Bacteria 7168
211 Ga0496105_0003231 3300048908 Bacteria 12008
212 Ga0496106_0254808 3300048909 Unclassified 1404
213 Ga0496106_0487053 3300048909 Bacteria 991
214 Ga0496106_0639123 3300048909 Unclassified 851
215 Ga0496107_0446154 3300048910 Bacteria 961
216 Ga0496107_0963104 3300048910 Bacteria 620
217 Ga0496108_0000770 3300048911 Bacteria 25016
218 Ga0496109_0004561 3300048912 Bacteria 11562
219 Ga0496109_0051301 3300048912 Bacteria 3758
220 Ga0496109_1106269 3300048912 Bacteria 729
221 Ga0496110_0070257 3300048913 Bacteria 3102
222 Ga0496110_0130491 3300048913 Bacteria 2269
223 Ga0496111_0001302 3300048914 Bacteria 14003
224 Ga0496111_0132696 3300048914 Bacteria 1844
225 Ga0496111_0783344 3300048914 Bacteria 691
226 Ga0496112_0000565 3300048915 Bacteria 25453
227 Ga0496112_0478419 3300048915 Bacteria 1182
228 Ga0496113_0005284 3300048916 Bacteria 8040
229 Ga0496113_0413591 3300048916 Unclassified 1083
230 Ga0496114_0160227 3300048917 Bacteria 1956
231 Ga0496114_0643467 3300048917 Unclassified 933
232 Ga0501031_0012417 3300049568 Bacteria 5556
233 Ga0501031_0078217 3300049568 Bacteria 2155
234 Ga0501031_0080044 3300049568 Bacteria 2129
235 Ga0501032_0030995 3300049569 Bacteria 3668
236 Ga0501032_0084967 3300049569 Bacteria 2104
237 Ga0501032_0190746 3300049569 Bacteria 1340
238 Ga0501033_0099903 3300049570 Bacteria 2118
239 Ga0501033_0109994 3300049570 Bacteria 2006
240 Ga0501033_0374420 3300049570 Bacteria 995
241 Ga0501036_0001385 3300049572 Bacteria 18625
242 Ga0501036_0065180 3300049572 Bacteria 3083
243 Ga0501036_0069572 3300049572 Bacteria 2977
244 Ga0501036_0399976 3300049572 Bacteria 1146
245 Ga0501037_0090487 3300049573 Unclassified 2213
246 Ga0501037_0225076 3300049573 Bacteria 1318
247 Ga0501038_0066207 3300049574 Bacteria 3077
248 Ga0501038_0115110 3300049574 Bacteria 2223
249 Ga0501038_0382438 3300049574 Unclassified 1092
250 Ga0501039_0028790 3300049575 Bacteria 4277
251 Ga0501039_0029319 3300049575 Bacteria 4238
252 Ga0501039_0085443 3300049575 Bacteria 2458
253 Ga0501039_0130075 3300049575 Bacteria 1976
254 Ga0501039_0767095 3300049575 Bacteria 753
255 Ga0501039_0857442 3300049575 Bacteria 708
256 Ga0501040_0001203 3300049576 Bacteria 16471
257 Ga0501040_0031393 3300049576 Bacteria 3590
258 Ga0501040_0439563 3300049576 Unclassified 938
259 Ga0501041_0000785 3300049577 Bacteria 17022
260 Ga0501041_0118435 3300049577 Unclassified 1645
261 Ga0501041_0119808 3300049577 Bacteria 1635
262 Ga0501041_0437906 3300049577 Unclassified 829
263 Ga0501042_0006461 3300049578 Bacteria 7611
264 Ga0501042_0045797 3300049578 Unclassified 3118
265 Ga0501042_0197195 3300049578 Bacteria 1452
266 Ga0501042_0239309 3300049578 Unclassified 1310
267 Ga0501043_0065596 3300049579 Bacteria 2851
268 Ga0501043_0073443 3300049579 Bacteria 2687
269 Ga0501046_0027813 3300049580 Bacteria 4609
270 Ga0501046_0034295 3300049580 Bacteria 4097
271 Ga0501046_0925359 3300049580 Bacteria 607
272 Ga0501048_0001666 3300049582 Bacteria 16920
273 Ga0501048_0025426 3300049582 Bacteria 4314
274 Ga0501068_0005891 3300049584 Bacteria 6728
275 Ga0501068_0043605 3300049584 Bacteria 2699
276 Ga0501068_0075285 3300049584 Bacteria 2065
277 Ga0501068_0294619 3300049584 Bacteria 1038
278 Ga0501068_0411347 3300049584 Bacteria 873
279 Ga0501068_0750363 3300049584 Unclassified 639
280 Ga0501069_0037413 3300049585 Bacteria 2678
281 Ga0501069_0186582 3300049585 Bacteria 1199
282 Ga0501069_0219082 3300049585 Unclassified 1105
283 Ga0501070_0055821 3300049586 Bacteria 3274
284 Ga0501070_0077947 3300049586 Bacteria 2742
285 Ga0501070_0083797 3300049586 Bacteria 2640
286 Ga0501070_0089964 3300049586 Unclassified 2541
287 Ga0501070_1297489 3300049586 Unclassified 556
288 Ga0501071_0022274 3300049587 Bacteria 4416
289 Ga0501071_0039884 3300049587 Bacteria 3360
290 Ga0501071_0164513 3300049587 Unclassified 1659
291 Ga0501071_0242761 3300049587 Unclassified 1358
292 Ga0501072_0000766 3300049588 Bacteria 23429
293 Ga0501072_0018508 3300049588 Bacteria 5366
294 Ga0501072_0039577 3300049588 Bacteria 3701
295 Ga0501072_0128420 3300049588 Bacteria 2020
296 Ga0501072_0173493 3300049588 Bacteria 1720
297 Ga0501072_0509102 3300049588 Bacteria 952
298 Ga0501072_1047742 3300049588 Bacteria 635
299 Ga0501073_0120169 3300049589 Bacteria 1821
300 Ga0501073_0366710 3300049589 Bacteria 995
301 Ga0501073_0429629 3300049589 Bacteria 913
302 Ga0501073_0782751 3300049589 Unclassified 658
303 Ga0501074_0030753 3300049590 Bacteria 3890
304 Ga0501074_0088296 3300049590 Bacteria 2220
305 Ga0501074_0334748 3300049590 Bacteria 1074
306 Ga0501074_0360611 3300049590 Unclassified 1031
307 Ga0501075_0001809 3300049591 Bacteria 14081
308 Ga0501075_0023783 3300049591 Bacteria 4487
309 Ga0501075_0113644 3300049591 Unclassified 2058
310 Ga0501075_0210513 3300049591 Bacteria 1483
311 Ga0501075_0239754 3300049591 Unclassified 1382
312 Ga0501076_0000345 3300049592 Bacteria 28556
313 Ga0501076_0015173 3300049592 Bacteria 5818
314 Ga0501076_0087914 3300049592 Bacteria 2498
315 Ga0501076_0194753 3300049592 Unclassified 1654
316 Ga0501076_0326736 3300049592 Bacteria 1258
317 Ga0501077_0014396 3300049593 Bacteria 4970
318 Ga0501077_0073209 3300049593 Bacteria 2170
319 Ga0501077_0158836 3300049593 Bacteria 1435
320 Ga0501077_0168580 3300049593 Unclassified 1391
321 Ga0501079_0001649 3300049741 Bacteria 15899
322 Ga0501079_0138042 3300049741 Bacteria 1899
323 Ga0501079_0152140 3300049741 Bacteria 1803
324 Ga0501079_0241955 3300049741 Bacteria 1410
325 Ga0501079_0391751 3300049741 Bacteria 1089
326 Ga0501079_0494979 3300049741 Unclassified 961
327 Ga0501080_0015552 3300049742 Bacteria 7017
328 Ga0501080_0019210 3300049742 Bacteria 6328
329 Ga0501080_0029207 3300049742 Bacteria 5133
330 Ga0501080_0292896 3300049742 Unclassified 1478
331 Ga0501080_1027314 3300049742 Unclassified 714
332 Ga0501081_0006704 3300049743 Bacteria 7487
333 Ga0501081_0082240 3300049743 Unclassified 2256
334 Ga0501081_0173568 3300049743 Bacteria 1557
335 Ga0501083_0054253 3300049744 Bacteria 2690
336 Ga0501083_0302596 3300049744 Bacteria 1040
337 Ga0501083_0395633 3300049744 Bacteria 899
338 Ga0501035_0046803 3300049822 Bacteria 3889
339 Ga0501035_0190672 3300049822 Unclassified 1762
340 Ga0501035_0289803 3300049822 Bacteria 1382
341 Ga0501035_0553088 3300049822 Bacteria 942
342 Ga0501044_0428442 3300049823 Bacteria 1232
343 Ga0501045_0001369 3300049824 Bacteria 16226
344 Ga0501045_0022491 3300049824 Bacteria 4515
345 Ga0501045_0065997 3300049824 Bacteria 2657
346 Ga0501045_0196283 3300049824 Bacteria 1504
347 nmdc:mga03n38_220573_c1 3300050490 Bacteria 989
348 nmdc:mga06z11_554170_c1 3300050494 Archaea 698
349 nmdc:mga05p37_103887_c1 3300050507 Bacteria 3496
350 nmdc:mga05p37_106964_c1 3300050507 Bacteria 3441
351 nmdc:mga05p37_238976_c1 3300050507 Bacteria 2185
352 nmdc:mga05p37_43526_c1 3300050507 Bacteria 5524
353 nmdc:mga05p37_917216_c1 3300050507 Bacteria 942
354 nmdc:mga09592_1365438_c1 3300050508 Bacteria 580
355 nmdc:mga09592_412669_c1 3300050508 Bacteria 1167
356 nmdc:mga09592_707597_c1 3300050508 Bacteria 857
357 nmdc:mga0qj67_345560_c1 3300050509 Unclassified 1203
358 nmdc:mga0qj67_399158_c1 3300050509 Bacteria 1110
359 nmdc:mga06r32_1150203_c1 3300050510 Bacteria 724
360 nmdc:mga08y16_266401_c1 3300050511 Bacteria 1769
361 nmdc:mga08y16_274481_c1 3300050511 Bacteria 1740
362 nmdc:mga08y16_33642_c1 3300050511 Bacteria 5382
363 nmdc:mga08y16_39767_c1 3300050511 Bacteria 4933
364 nmdc:mga08y16_617171_c1 3300050511 Bacteria 1092
365 nmdc:mga08y16_692689_c1 3300050511 Bacteria 1020
366 nmdc:mga0n895_208938_c1 3300050512 Bacteria 1983
367 nmdc:mga0n895_650811_c1 3300050512 Bacteria 1053
368 nmdc:mga0rr50_402296_c1 3300050513 Bacteria 1157
369 nmdc:mga0rr50_68721_c1 3300050513 Bacteria 2695
370 nmdc:mga08x19_586254_c1 3300050514 Bacteria 790
371 nmdc:mga08x19_63205_c1 3300050514 Bacteria 2402
372 nmdc:mga0a205_271532_c1 3300050515 Bacteria 1573
373 nmdc:mga0a205_303364_c1 3300050515 Bacteria 1470
374 Ga0501084_0000701 3300054114 Bacteria 25651
375 Ga0501084_0015085 3300054114 Bacteria 6408
376 Ga0501084_0035880 3300054114 Bacteria 4145
377 Ga0501084_0039459 3300054114 Bacteria 3949
378 Ga0501084_0049147 3300054114 Bacteria 3531
379 Ga0501084_0369409 3300054114 Unclassified 1212
380 Ga0501084_0577889 3300054114 Bacteria 950
381 Ga0590071_002152 3300059421 Bacteria 5015
382 Ga0590075_012695 3300059424 Bacteria 2048
383 Ga0590077_026599 3300059426 Unclassified 1251
384 Ga0501082_0000579 3300060353 Bacteria 32433
385 Ga0501082_0068763 3300060353 Bacteria 3049
386 Ga0530510_0011186 3300061734 Bacteria 6295
387 Ga0530510_0102439 3300061734 Bacteria 2093
388 Ga0530510_0142325 3300061734 Bacteria 1768
389 Ga0530510_0151464 3300061734 Bacteria 1713
390 Ga0530510_0285327 3300061734 Bacteria 1234
391 Ga0530510_0786152 3300061734 Unclassified 726
392 Ga0070666_10426619
393 2214584978
394 Ga0070658_10621408
395 Ga0070658_11683963
396 Ga0070683_100003946
397 Ga0070683_100150434
398 Ga0070683_100875109
399 Ga0070670_101584903
400 Ga0068869_100325973
401 Ga0070680_100028376
402 Ga0070682_100135908
403 Ga0070682_100715221
404 Ga0070660_100163465
405 Ga0070660_100187343
406 Ga0070691_10326433
407 Ga0070661_100146155
408 Ga0070673_100128942
409 Ga0070673_101297487
410 Ga0070701_10493421
411 Ga0070705_100041857
412 Ga0070705_101547385
413 Ga0070700_100921819
414 Ga0070663_101948096
415 Ga0070678_100071909
416 Ga0070678_100379115
417 Ga0070678_100602082
418 Ga0070678_100924325
419 Ga0070678_101832438
420 Ga0070681_10063235
421 Ga0068867_100214174
422 Ga0070679_100164376
423 Ga0070684_100004187
424 Ga0068853_100563489
425 Ga0070686_100255950
426 Ga0070695_101585002
427 Ga0070696_100210767
428 Ga0070693_100026835
429 Ga0070693_100194243
430 Ga0070704_101343105
431 Ga0070664_100058566
432 Ga0068854_100147623
433 Ga0068856_100352807
434 Ga0068856_101207526
435 Ga0070702_100023742
436 Ga0070702_100028678
437 Ga0068864_100154787
438 Ga0068861_101232001
439 Ga0068870_10066960
440 Ga0068858_100292974
441 Ga0068860_102322917
442 Ga0081455_10025710
443 Ga0081455_10067580
444 Ga0081540_1007593
445 Ga0075364_10178380
446 Ga0075432_10150640
447 Ga0075367_10325278
448 Ga0068871_100496374
449 Ga0075428_100488631
450 Ga0075428_101140470
451 Ga0075430_100351283
452 Ga0075430_100928236
453 Ga0075431_100116491
454 Ga0075433_10436482
455 Ga0075434_100567356
456 Ga0075429_100470197
457 Ga0075429_101840887
458 Ga0075435_100768399
459 Ga0111539_10274247
460 Ga0111539_10277835
461 Ga0111539_10302864
462 Ga0111539_10897468
463 Ga0111539_11304217
464 Ga0105245_10094907
465 Ga0105245_10228841
466 Ga0105247_10257409
467 Ga0114129_10025342
468 Ga0114129_10116215
469 Ga0114129_10179964
470 Ga0114129_10279318
471 Ga0114129_10397369
472 Ga0114129_11546125
473 Ga0105243_11052195
474 Ga0105243_11607220
475 Ga0105243_12199018
476 Ga0105241_10154925
477 Ga0105242_10880448
478 Ga0105248_10287240
479 Ga0105248_11034112
480 Ga0105237_11442442
481 Ga0105237_12614434
482 Ga0105238_11466927
483 Ga0105239_12201114
484 Ga0105246_11449588
485 Ga0105246_11794425
486 Ga0157347_1041206
487 Ga0157370_10151258
488 Ga0157378_10205479
489 Ga0157372_10337442
490 Ga0157375_11210901
491 Ga0163163_10829302
492 Ga0163163_12349595
493 Ga0157380_10213233
494 Ga0182008_10074432
495 Ga0157377_10390230
496 Ga0157376_10278706
497 Ga0182006_1261102
498 Ga0206353_11820103
499 Ga0207680_10706784
500 Ga0207643_10091007
501 Ga0207705_10480133
502 Ga0207705_11415160
503 Ga0207684_11528157
504 Ga0207654_10385784
505 Ga0207707_10111212
506 Ga0207660_10053211
507 Ga0207657_10338133
508 Ga0207649_11161033
509 Ga0207652_10022484
510 Ga0207646_10411198
511 Ga0207659_10122013
512 Ga0207687_10036190
513 Ga0207687_10280756
514 Ga0207686_10918365
515 Ga0207709_10358367
516 Ga0207711_11008383
517 Ga0207689_10582681
518 Ga0207661_10194355
519 Ga0207661_10466841
520 Ga0207661_10557657
521 Ga0207679_10253123
522 Ga0207667_10507467
523 Ga0207651_10687538
524 Ga0207651_10721204
525 Ga0207712_11393995
526 Ga0207640_10096026
527 Ga0207640_11466574
528 Ga0207658_10507591
529 Ga0207703_10054303
530 Ga0207678_10867145
531 Ga0207678_11034550
532 Ga0207708_11138160
533 Ga0207702_10091066
534 Ga0207702_10126499
535 Ga0207648_10442815
536 Ga0207648_11305328
537 Ga0207676_11057992
538 Ga0207674_10001150
539 Ga0207674_10104311
540 Ga0207675_100089966
541 Ga0207683_10140475
542 Ga0207683_10152314
543 Ga0207683_10313508
544 Ga0207428_10040269
545 Ga0207428_10067650
546 Ga0207428_10896737
547 Ga0307405_10147919
548 Ga0307405_10655925
549 Ga0307409_100051866
550 Ga0307409_100302234
551 Ga0307409_101226564
552 Ga0307416_100031045
553 Ga0307411_10996998
554 Ga0307415_100008142
555 Ga0307415_100718311
556 Ga0373941_0272732
557 Ga0373960_0235763
558 Ga0373942_0057167
559 Ga0373942_0061139
560 Ga0373931_0247622
561 Ga0395899_0012697
562 Ga0395899_0044760
563 Ga0395899_0197053
564 Ga0395899_0659624
565 Ga0395900_0012790
566 Ga0395900_0184443
567 Ga0395900_0347229
568 Ga0395900_0399603
569 Ga0395900_0606769
570 Ga0395900_0832112
571 Ga0395898_0013759
572 Ga0395898_0020775
573 Ga0395898_0027149
574 Ga0395898_0054694
575 Ga0395898_0264564
576 Ga0395905_0011917
577 Ga0395905_0337245
578 Ga0395901_0009653
579 Ga0395901_0080876
580 Ga0395901_0125213
581 Ga0395901_0195929
582 Ga0395901_0256392
583 Ga0395901_0751683
584 Ga0451800_0794986
585 Ga0439448_0177205
586 Ga0439455_0051057
587 Ga0450905_063951
588 Ga0450907_029219
589 Ga0439459_0016448
590 Ga0450918_013652
591 Ga0453683_0375913
592 Ga0451576_1314325
593 Ga0495603_0854514
594 Ga0495670_0336839
595 Ga0495674_0263410
596 Ga0496101_0126251
597 Ga0496101_0243816
598 Ga0496102_0099411
599 Ga0496103_0064484
600 Ga0496103_0151035
601 Ga0496104_0014291
602 Ga0496105_0003231
603 Ga0496106_0254808
604 Ga0496106_0487053
605 Ga0496106_0639123
606 Ga0496107_0446154
607 Ga0496107_0963104
608 Ga0496108_0000770
609 Ga0496109_0004561
610 Ga0496109_0051301
611 Ga0496109_1106269
612 Ga0496110_0070257
613 Ga0496110_0130491
614 Ga0496111_0001302
615 Ga0496111_0132696
616 Ga0496111_0783344
617 Ga0496112_0000565
618 Ga0496112_0478419
619 Ga0496113_0005284
620 Ga0496113_0413591
621 Ga0496114_0160227
622 Ga0496114_0643467
623 Ga0501031_0012417
624 Ga0501031_0078217
625 Ga0501031_0080044
626 Ga0501032_0030995
627 Ga0501032_0084967
628 Ga0501032_0190746
629 Ga0501033_0099903
630 Ga0501033_0109994
631 Ga0501033_0374420
632 Ga0501036_0001385
633 Ga0501036_0065180
634 Ga0501036_0069572
635 Ga0501036_0399976
636 Ga0501037_0090487
637 Ga0501037_0225076
638 Ga0501038_0066207
639 Ga0501038_0115110
640 Ga0501038_0382438
641 Ga0501039_0028790
642 Ga0501039_0029319
643 Ga0501039_0085443
644 Ga0501039_0130075
645 Ga0501039_0767095
646 Ga0501039_0857442
647 Ga0501040_0001203
648 Ga0501040_0031393
649 Ga0501040_0439563
650 Ga0501041_0000785
651 Ga0501041_0118435
652 Ga0501041_0119808
653 Ga0501041_0437906
654 Ga0501042_0006461
655 Ga0501042_0045797
656 Ga0501042_0197195
657 Ga0501042_0239309
658 Ga0501043_0065596
659 Ga0501043_0073443
660 Ga0501046_0027813
661 Ga0501046_0034295
662 Ga0501046_0925359
663 Ga0501048_0001666
664 Ga0501048_0025426
665 Ga0501068_0005891
666 Ga0501068_0043605
667 Ga0501068_0075285
668 Ga0501068_0294619
669 Ga0501068_0411347
670 Ga0501068_0750363
671 Ga0501069_0037413
672 Ga0501069_0186582
673 Ga0501069_0219082
674 Ga0501070_0055821
675 Ga0501070_0077947
676 Ga0501070_0083797
677 Ga0501070_0089964
678 Ga0501070_1297489
679 Ga0501071_0022274
680 Ga0501071_0039884
681 Ga0501071_0164513
682 Ga0501071_0242761
683 Ga0501072_0000766
684 Ga0501072_0018508
685 Ga0501072_0039577
686 Ga0501072_0128420
687 Ga0501072_0173493
688 Ga0501072_0509102
689 Ga0501072_1047742
690 Ga0501073_0120169
691 Ga0501073_0366710
692 Ga0501073_0429629
693 Ga0501073_0782751
694 Ga0501074_0030753
695 Ga0501074_0088296
696 Ga0501074_0334748
697 Ga0501074_0360611
698 Ga0501075_0001809
699 Ga0501075_0023783
700 Ga0501075_0113644
701 Ga0501075_0210513
702 Ga0501075_0239754
703 Ga0501076_0000345
704 Ga0501076_0015173
705 Ga0501076_0087914
706 Ga0501076_0194753
707 Ga0501076_0326736
708 Ga0501077_0014396
709 Ga0501077_0073209
710 Ga0501077_0158836
711 Ga0501077_0168580
712 Ga0501079_0001649
713 Ga0501079_0138042
714 Ga0501079_0152140
715 Ga0501079_0241955
716 Ga0501079_0391751
717 Ga0501079_0494979
718 Ga0501080_0015552
719 Ga0501080_0019210
720 Ga0501080_0029207
721 Ga0501080_0292896
722 Ga0501080_1027314
723 Ga0501081_0006704
724 Ga0501081_0082240
725 Ga0501081_0173568
726 Ga0501083_0054253
727 Ga0501083_0302596
728 Ga0501083_0395633
729 Ga0501035_0046803
730 Ga0501035_0190672
731 Ga0501035_0289803
732 Ga0501035_0553088
733 Ga0501044_0428442
734 Ga0501045_0001369
735 Ga0501045_0022491
736 Ga0501045_0065997
737 Ga0501045_0196283
738 nmdc:mga03n38_220573_c1
739 nmdc:mga06z11_554170_c1
740 nmdc:mga05p37_103887_c1
741 nmdc:mga05p37_106964_c1
742 nmdc:mga05p37_238976_c1
743 nmdc:mga05p37_43526_c1
744 nmdc:mga05p37_917216_c1
745 nmdc:mga09592_1365438_c1
746 nmdc:mga09592_412669_c1
747 nmdc:mga09592_707597_c1
748 nmdc:mga0qj67_345560_c1
749 nmdc:mga0qj67_399158_c1
750 nmdc:mga06r32_1150203_c1
751 nmdc:mga08y16_266401_c1
752 nmdc:mga08y16_274481_c1
753 nmdc:mga08y16_33642_c1
754 nmdc:mga08y16_39767_c1
755 nmdc:mga08y16_617171_c1
756 nmdc:mga08y16_692689_c1
757 nmdc:mga0n895_208938_c1
758 nmdc:mga0n895_650811_c1
759 nmdc:mga0rr50_402296_c1
760 nmdc:mga0rr50_68721_c1
761 nmdc:mga08x19_586254_c1
762 nmdc:mga08x19_63205_c1
763 nmdc:mga0a205_271532_c1
764 nmdc:mga0a205_303364_c1
765 Ga0501084_0000701
766 Ga0501084_0015085
767 Ga0501084_0035880
768 Ga0501084_0039459
769 Ga0501084_0049147
770 Ga0501084_0369409
771 Ga0501084_0577889
772 Ga0590071_002152
773 Ga0590075_012695
774 Ga0590077_026599
775 Ga0501082_0000579
776 Ga0501082_0068763
777 Ga0530510_0011186
778 Ga0530510_0102439
779 Ga0530510_0142325
780 Ga0530510_0151464
781 Ga0530510_0285327
782 Ga0530510_0786152

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00127

Copper-bind

Copper binding proteins, plastocyanin/azurin family

45

127

0.86

PF13473

Cupredoxin_1

Cupredoxin-like domain

20

126

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fc9-assembly1.cif.gz_D novel purple cupredoxin from nitrosopumilus maritimus 0.9165 25 103
1sfh-assembly2.cif.gz_B reduced state of amicyanin mutant p94f 0.9028 25 103
1bxv-assembly1.cif.gz_A reduced plastocyanin from synechococcus sp. 0.9021 25 103
1sf3-assembly1.cif.gz_A structure of the reduced form of the p94a mutant of amicyanin 0.9005 25 103
2ids-assembly1.cif.gz_A structure of m98a mutant of amicyanin, cu(i) 0.8938 25 103
ID Description Score Start End Superfamily
5fc9B00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9045 25 103 2.60.40.420
2bzcA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8789 25 103 2.60.40.420
2pcfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8758 25 103 2.60.40.420
1mdaA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8681 25 103 2.60.40.420
af_Q54VX3_19_99_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.852 25 103 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A535YLQ2-F1-model_v4 Copper-binding protein 0.988 32 103
AF-A0A7V1YKB3-F1-model_v4 Blue (type 1) copper domain-containing protein 0.9588 21 103 GO:0005507
GO:0009055
AF-A0A2R6KSC3-F1-model_v4 EfeO-type cupredoxin-like domain-containing protein 0.9588 19 103
AF-A0A0G1FVX2-F1-model_v4 Blue (Type 1) copper domain protein 0.9555 25 103
AF-A0A0G1D122-F1-model_v4 Copper-binding protein 0.9555 25 103

Map