F431913

General Info

Members Datasets Scaffolds Average Seq Length
391 214 782 413

Family's Representative Sequence

Representative Sequence 3300003792|Ga0055540_1007028|Ga0055540_10070285
Length 437
Sequence MTEGDDAGGTGPDETTGEPDAAEPEATPLLTPADGVPELAVTADQILAAAELLVSGHGPFAIDAERASGFRYSNRAYLIQIRRAGAGSVLIDPVNHGEDPLMVMAPLADVLDTDEWILHAADQDLPCLAELGMVPPQLYDTELAGRLAGFDRVNLAAMVQRLLGLQLMKGHGAADWSKRPLPADWLIYAALDVEVLLELREAVAAELEAQGKTRWAAEEFEHLRTYVASPTRRDRWRRTSGIHKVKNPRTLAAVRELWTTRDHIAQRRDIAPGRILPDAAIISAATADPDTVEKLVALPVFGGSRQRRSAGVWLEALARARVTDDVPTASEPVTGPPPAVRWSRRKPEAAERLDRVRAGLAELSQRVSVPTENLLTPDLVRRLVWDWQPVAHADKAIDAFLAEAGARPWQRELTVPVLTEALTAVQTPQAAQDAQQS

Samples

Sample ID Description Type Environment
1 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
125 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
126 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
197 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
198 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
199 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
201 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
202 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
203 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
204 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
205 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
206 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
207 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
208 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
209 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
210 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
211 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
212 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
213 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
214 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.93
Metatranscriptomes 0
Isolates 3.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.23
Nodule 0.26
Rhizoplane 12.28
Rhizosphere 68.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1007028 3300003792 Bacteria 4337
2 JGI24744J21845_10001012 3300002077 Bacteria 5392
3 rootH1_10052991 3300003316 Bacteria 1826
4 Ga0055540_1000871 3300003792 Bacteria 20021
5 Ga0055540_1004140 3300003792 Bacteria 6704
6 Ga0070676_10009735 3300005328 Bacteria 5198
7 Ga0070683_100217460 3300005329 Bacteria 1816
8 Ga0070666_10007407 3300005335 Bacteria 6764
9 Ga0070682_100020595 3300005337 Bacteria 3883
10 Ga0068868_100055358 3300005338 Bacteria 3129
11 Ga0068868_100233819 3300005338 Bacteria 1542
12 Ga0070691_10010167 3300005341 Bacteria 4289
13 Ga0070691_10055571 3300005341 Bacteria 1897
14 Ga0070687_100003038 3300005343 Bacteria 6455
15 Ga0070668_100015036 3300005347 Bacteria 5780
16 Ga0070669_100000402 3300005353 Bacteria 33141
17 Ga0070675_100150863 3300005354 Bacteria 1993
18 Ga0070671_100001788 3300005355 Bacteria 16329
19 Ga0070674_100049237 3300005356 Bacteria 2896
20 Ga0070674_100049452 3300005356 Bacteria 2890
21 Ga0070688_100029661 3300005365 Bacteria 3277
22 Ga0070667_100000375 3300005367 Bacteria 48917
23 Ga0070667_100001789 3300005367 Bacteria 19128
24 Ga0070709_10079957 3300005434 Bacteria 2130
25 Ga0070710_10016408 3300005437 Bacteria 3767
26 Ga0070711_100009472 3300005439 Bacteria 6003
27 Ga0070711_100014859 3300005439 Bacteria 4917
28 Ga0070694_100117552 3300005444 Bacteria 1903
29 Ga0070694_100182620 3300005444 Bacteria 1552
30 Ga0070663_100024642 3300005455 Bacteria 4053
31 Ga0070678_100004043 3300005456 Bacteria 8252
32 Ga0070678_100205470 3300005456 Bacteria 1628
33 Ga0070662_100035737 3300005457 Bacteria 3511
34 Ga0068867_100013712 3300005459 Bacteria 5740
35 Ga0068853_100009261 3300005539 Bacteria 7939
36 Ga0068853_100019311 3300005539 Bacteria 5650
37 Ga0068853_100144897 3300005539 Bacteria 2134
38 Ga0068853_100221401 3300005539 Bacteria 1728
39 Ga0070695_100020569 3300005545 Bacteria 4029
40 Ga0070696_100023141 3300005546 Bacteria 4223
41 Ga0070696_100075405 3300005546 Bacteria 2379
42 Ga0070665_100002733 3300005548 Bacteria 19124
43 Ga0070665_100015638 3300005548 Bacteria 7622
44 Ga0070665_100019774 3300005548 Bacteria 6760
45 Ga0070704_100014331 3300005549 Bacteria 4950
46 Ga0068854_100021244 3300005578 Bacteria 4403
47 Ga0070702_100018999 3300005615 Bacteria 3574
48 Ga0070702_100165751 3300005615 Bacteria 1433
49 Ga0068859_100003562 3300005617 Bacteria 15860
50 Ga0068859_100014622 3300005617 Bacteria 7883
51 Ga0068866_10011684 3300005718 Bacteria 3807
52 Ga0068861_100000912 3300005719 Bacteria 17919
53 Ga0068861_100108526 3300005719 Bacteria 2220
54 Ga0068861_100109740 3300005719 Bacteria 2209
55 Ga0068863_100000194 3300005841 Bacteria 64797
56 Ga0068863_100000794 3300005841 Bacteria 31746
57 Ga0068858_100002320 3300005842 Bacteria 19228
58 Ga0068858_100006408 3300005842 Bacteria 11465
59 Ga0068860_100000489 3300005843 Bacteria 48927
60 Ga0068860_100012341 3300005843 Bacteria 8418
61 Ga0068860_100245117 3300005843 Bacteria 1743
62 Ga0068862_100000054 3300005844 Bacteria 143584
63 Ga0068862_100101380 3300005844 Bacteria 2518
64 Ga0068862_100175805 3300005844 Bacteria 1919
65 Ga0075365_10006689 3300006038 Bacteria 6370
66 Ga0075365_10008123 3300006038 Bacteria 5928
67 Ga0075363_100001290 3300006048 Bacteria 9337
68 Ga0075363_100002387 3300006048 Bacteria 7653
69 Ga0075363_100004890 3300006048 Bacteria 5920
70 Ga0075363_100009153 3300006048 Bacteria 4649
71 Ga0075363_100011684 3300006048 Bacteria 4212
72 Ga0075363_100013740 3300006048 Bacteria 3937
73 Ga0075364_10002269 3300006051 Bacteria 10792
74 Ga0075364_10006064 3300006051 Bacteria 7076
75 Ga0075364_10010510 3300006051 Bacteria 5593
76 Ga0075364_10017127 3300006051 Bacteria 4522
77 Ga0075364_10054140 3300006051 Bacteria 2623
78 Ga0070716_100004564 3300006173 Bacteria 6635
79 Ga0070716_100061860 3300006173 Bacteria 2168
80 Ga0070712_100032864 3300006175 Bacteria 3506
81 Ga0070712_100121911 3300006175 Bacteria 1963
82 Ga0070712_100126597 3300006175 Bacteria 1930
83 Ga0075367_10003499 3300006178 Bacteria 7498
84 Ga0075369_10000301 3300006186 Bacteria 14648
85 Ga0075369_10000915 3300006186 Bacteria 9778
86 Ga0075369_10014650 3300006186 Bacteria 3136
87 Ga0075369_10017310 3300006186 Bacteria 2919
88 Ga0075370_10048938 3300006353 Bacteria 2396
89 Ga0075370_10051886 3300006353 Bacteria 2326
90 Ga0075430_100079352 3300006846 Bacteria 2751
91 Ga0075430_100146191 3300006846 Bacteria 1969
92 Ga0097620_100003562 3300006931 Bacteria 15860
93 Ga0097620_100014623 3300006931 Bacteria 7883
94 Ga0105245_10063762 3300009098 Bacteria 3328
95 Ga0105245_10201220 3300009098 Bacteria 1913
96 Ga0105247_10000085 3300009101 Bacteria 102010
97 Ga0105247_10001102 3300009101 Bacteria 20112
98 Ga0105247_10104986 3300009101 Bacteria 1811
99 Ga0114129_10057478 3300009147 Bacteria 5443
100 Ga0105243_10044462 3300009148 Bacteria 3484
101 Ga0105241_10067006 3300009174 Bacteria 2778
102 Ga0105242_10152651 3300009176 Bacteria 2015
103 Ga0105248_10001177 3300009177 Bacteria 29238
104 Ga0105248_10008164 3300009177 Bacteria 11500
105 Ga0105237_10002094 3300009545 Bacteria 25197
106 Ga0105237_10327868 3300009545 Bacteria 1535
107 Ga0105237_10378319 3300009545 Bacteria 1420
108 Ga0105249_10000001 3300009553 Bacteria 504948
109 Ga0105249_10002155 3300009553 Bacteria 17052
110 Ga0105249_10006735 3300009553 Bacteria 10011
111 Ga0105239_10031814 3300010375 Bacteria 5797
112 Ga0105239_10252064 3300010375 Bacteria 1983
113 Ga0157374_10102657 3300013296 Bacteria 2743
114 Ga0157378_10027267 3300013297 Bacteria 5041
115 Ga0163162_10013868 3300013306 Bacteria 7874
116 Ga0163162_10036517 3300013306 Bacteria 4898
117 Ga0163162_10055394 3300013306 Bacteria 3992
118 Ga0163162_10139288 3300013306 Bacteria 2538
119 Ga0157372_10358051 3300013307 Bacteria 1700
120 Ga0157375_10043238 3300013308 Bacteria 4367
121 Ga0163163_10086104 3300014325 Bacteria 3151
122 Ga0157380_10000850 3300014326 Bacteria 19124
123 Ga0157380_10177173 3300014326 Bacteria 1869
124 Ga0157377_10020092 3300014745 Bacteria 3495
125 Ga0157379_10038591 3300014968 Bacteria 4261
126 Ga0157376_10031729 3300014969 Bacteria 4235
127 Ga0163161_10016416 3300017792 Bacteria 5168
128 Ga0213876_10015659 3300021384 Bacteria 4013
129 Ga0213875_10002632 3300021388 Bacteria 10626
130 Ga0209051_1000612 3300025303 Bacteria 41270
131 Ga0209051_1000965 3300025303 Bacteria 28164
132 Ga0207692_10007832 3300025898 Bacteria 4396
133 Ga0207692_10008433 3300025898 Bacteria 4261
134 Ga0207642_10004876 3300025899 Bacteria 4346
135 Ga0207710_10000125 3300025900 Bacteria 93726
136 Ga0207710_10004616 3300025900 Bacteria 5986
137 Ga0207688_10014875 3300025901 Bacteria 4223
138 Ga0207688_10102312 3300025901 Bacteria 1656
139 Ga0207685_10001741 3300025905 Bacteria 4729
140 Ga0207699_10135597 3300025906 Bacteria 1611
141 Ga0207645_10045588 3300025907 Bacteria 2802
142 Ga0207671_10030693 3300025914 Bacteria 4007
143 Ga0207693_10141369 3300025915 Bacteria 1893
144 Ga0207693_10143195 3300025915 Bacteria 1880
145 Ga0207663_10012416 3300025916 Bacteria 4606
146 Ga0207663_10051148 3300025916 Bacteria 2571
147 Ga0207662_10012718 3300025918 Bacteria 4691
148 Ga0207657_10035626 3300025919 Bacteria 4461
149 Ga0207681_10010840 3300025923 Bacteria 5599
150 Ga0207681_10043041 3300025923 Bacteria 3020
151 Ga0207644_10003102 3300025931 Bacteria 10697
152 Ga0207644_10092179 3300025931 Bacteria 2260
153 Ga0207706_10175947 3300025933 Bacteria 1880
154 Ga0207706_10259996 3300025933 Bacteria 1515
155 Ga0207709_10012199 3300025935 Bacteria 4736
156 Ga0207670_10027905 3300025936 Bacteria 3576
157 Ga0207670_10087471 3300025936 Bacteria 2195
158 Ga0207669_10009466 3300025937 Bacteria 4642
159 Ga0207669_10078183 3300025937 Bacteria 2107
160 Ga0207704_10007729 3300025938 Bacteria 5099
161 Ga0207665_10116949 3300025939 Bacteria 1880
162 Ga0207665_10116950 3300025939 Bacteria 1880
163 Ga0207711_10000228 3300025941 Bacteria 60300
164 Ga0207711_10245330 3300025941 Bacteria 1643
165 Ga0207689_10126553 3300025942 Bacteria 2102
166 Ga0207661_10300568 3300025944 Bacteria 1439
167 Ga0207712_10000006 3300025961 Bacteria 573204
168 Ga0207712_10178063 3300025961 Bacteria 1668
169 Ga0207712_10188677 3300025961 Bacteria 1626
170 Ga0207712_10226588 3300025961 Bacteria 1498
171 Ga0207668_10016947 3300025972 Bacteria 4558
172 Ga0207640_10022098 3300025981 Bacteria 3802
173 Ga0207658_10000313 3300025986 Bacteria 48919
174 Ga0207658_10061911 3300025986 Bacteria 2798
175 Ga0207677_10028327 3300026023 Bacteria 3540
176 Ga0207677_10041386 3300026023 Bacteria 3046
177 Ga0207703_10040915 3300026035 Bacteria 3711
178 Ga0207703_10047756 3300026035 Bacteria 3452
179 Ga0207703_10215432 3300026035 Bacteria 1714
180 Ga0207639_10013632 3300026041 Bacteria 5698
181 Ga0207639_10120743 3300026041 Bacteria 2153
182 Ga0207678_10142621 3300026067 Bacteria 2045
183 Ga0207678_10171273 3300026067 Bacteria 1853
184 Ga0207708_10022004 3300026075 Bacteria 4812
185 Ga0207708_10147876 3300026075 Bacteria 1847
186 Ga0207702_10076891 3300026078 Bacteria 2885
187 Ga0207641_10001860 3300026088 Bacteria 20276
188 Ga0207641_10002419 3300026088 Bacteria 17239
189 Ga0207648_10040772 3300026089 Bacteria 4079
190 Ga0207675_100046029 3300026118 Bacteria 4076
191 Ga0207675_100146075 3300026118 Bacteria 2249
192 Ga0207683_10093893 3300026121 Bacteria 2673
193 Ga0268266_10013851 3300028379 Bacteria 6943
194 Ga0268266_10014669 3300028379 Bacteria 6732
195 Ga0268266_10170938 3300028379 Bacteria 1973
196 Ga0268265_10000032 3300028380 Bacteria 225953
197 Ga0268264_10000515 3300028381 Bacteria 48941
198 Ga0268264_10039008 3300028381 Bacteria 3923
199 Ga0265327_10000064 3300031251 Bacteria 231983
200 Ga0265327_10019407 3300031251 Bacteria 4180
201 Ga0307405_10056567 3300031731 Bacteria 2461
202 Ga0307405_10193521 3300031731 Bacteria 1471
203 Ga0307410_10011584 3300031852 Bacteria 5050
204 Ga0307409_100010479 3300031995 Bacteria 5769
205 Ga0307416_100263468 3300032002 Bacteria 1686
206 Ga0307415_100036258 3300032126 Bacteria 3230
207 Ga0373960_0051249 3300035121 Bacteria 1226
208 Ga0373931_0004374 3300035691 Bacteria 6451
209 Ga0436364_0058161 3300037853 Bacteria 11834
210 Ga0436364_0143407 3300037853 Bacteria 8072
211 Ga0436365_1167796 3300039437 Bacteria 11139
212 Ga0436365_1499581 3300039437 Bacteria 19401
213 Ga0439466_0001111 3300041411 Bacteria 10483
214 Ga0439466_0013491 3300041411 Bacteria 2990
215 Ga0439466_0014896 3300041411 Bacteria 2826
216 Ga0439465_0000239 3300041413 Bacteria 15035
217 Ga0439445_0008045 3300042004 Bacteria 2460
218 Ga0466972_0004467 3300044658 Bacteria 6996
219 Ga0466972_0041358 3300044658 Bacteria 2245
220 Ga0466972_0071276 3300044658 Bacteria 1658
221 Ga0466965_0004508 3300044683 Bacteria 6201
222 Ga0466966_0005104 3300044684 Bacteria 8627
223 Ga0466966_0010346 3300044684 Bacteria 6193
224 Ga0466966_0017188 3300044684 Bacteria 4783
225 Ga0466966_0047494 3300044684 Bacteria 2737
226 Ga0466961_0030164 3300044693 Bacteria 3485
227 Ga0466963_0001744 3300044694 Bacteria 11842
228 Ga0466971_0013897 3300044719 Bacteria 3539
229 Ga0466971_0022482 3300044719 Bacteria 2810
230 Ga0466968_0052123 3300044735 Bacteria 1750
231 Ga0466968_0059683 3300044735 Bacteria 1643
232 Ga0466970_0018497 3300044765 Bacteria 3608
233 Ga0466957_0001211 3300044842 Bacteria 13445
234 Ga0466957_0003994 3300044842 Bacteria 8155
235 Ga0466957_0022313 3300044842 Bacteria 3734
236 Ga0466957_0076191 3300044842 Bacteria 2082
237 Ga0466960_0000301 3300044901 Bacteria 17232
238 Ga0466960_0007819 3300044901 Bacteria 4359
239 Ga0466959_0002707 3300045049 Bacteria 11386
240 Ga0466959_0006707 3300045049 Bacteria 8009
241 Ga0466959_0041536 3300045049 Bacteria 3394
242 Ga0466958_0002115 3300045836 Bacteria 9855
243 Ga0466967_0002204 3300045976 Bacteria 11983
244 Ga0466967_0008316 3300045976 Bacteria 7588
245 Ga0466967_0037473 3300045976 Bacteria 4150
246 Ga0466967_0150692 3300045976 Bacteria 2173
247 Ga0466967_0177039 3300045976 Bacteria 2009
248 Ga0466967_0182476 3300045976 Bacteria 1980
249 Ga0466967_0291494 3300045976 Bacteria 1568
250 Ga0495629_0006165 3300046459 Bacteria 8902
251 Ga0495638_0007001 3300046460 Bacteria 8133
252 Ga0495648_0002977 3300046524 Bacteria 15200
253 Ga0495640_0034833 3300046533 Bacteria 3565
254 Ga0495668_0027271 3300046616 Bacteria 3237
255 Ga0495668_0060539 3300046616 Bacteria 2089
256 Ga0495674_0022186 3300047319 Bacteria 5857
257 Ga0495672_0006917 3300047320 Bacteria 8639
258 Ga0495672_0043236 3300047320 Bacteria 2710
259 Ga0495673_0005236 3300047469 Bacteria 7880
260 Ga0495686_0001716 3300047472 Bacteria 22588
261 Ga0496100_0006872 3300048903 Bacteria 6233
262 Ga0496100_0014225 3300048903 Bacteria 4614
263 Ga0496100_0017600 3300048903 Bacteria 4223
264 Ga0496100_0094092 3300048903 Bacteria 2051
265 Ga0496100_0112245 3300048903 Bacteria 1896
266 Ga0496101_0000188 3300048904 Bacteria 48692
267 Ga0496101_0006904 3300048904 Bacteria 7330
268 Ga0496101_0033259 3300048904 Bacteria 3635
269 Ga0496101_0046015 3300048904 Bacteria 3128
270 Ga0496102_0000460 3300048905 Bacteria 45416
271 Ga0496102_0017517 3300048905 Bacteria 6274
272 Ga0496102_0031128 3300048905 Bacteria 4783
273 Ga0496102_0052689 3300048905 Bacteria 3708
274 Ga0496102_0088348 3300048905 Bacteria 2865
275 Ga0496102_0106168 3300048905 Bacteria 2613
276 Ga0496102_0237175 3300048905 Bacteria 1720
277 Ga0496103_0000301 3300048906 Bacteria 45401
278 Ga0496103_0010851 3300048906 Bacteria 5392
279 Ga0496104_0006760 3300048907 Bacteria 10102
280 Ga0496104_0029573 3300048907 Bacteria 5083
281 Ga0496105_0032226 3300048908 Bacteria 4300
282 Ga0496106_0003488 3300048909 Bacteria 11713
283 Ga0496106_0013903 3300048909 Bacteria 5950
284 Ga0496106_0016433 3300048909 Bacteria 5475
285 Ga0496106_0020791 3300048909 Bacteria 4871
286 Ga0496107_0002302 3300048910 Bacteria 12325
287 Ga0496107_0016016 3300048910 Bacteria 5260
288 Ga0496107_0085305 3300048910 Bacteria 2304
289 Ga0496107_0096049 3300048910 Bacteria 2169
290 Ga0496108_0023871 3300048911 Bacteria 5034
291 Ga0496108_0051219 3300048911 Bacteria 3459
292 Ga0496108_0058861 3300048911 Bacteria 3230
293 Ga0496108_0080217 3300048911 Bacteria 2764
294 Ga0496109_0002635 3300048912 Bacteria 15045
295 Ga0496109_0019886 3300048912 Bacteria 5927
296 Ga0496110_0024166 3300048913 Bacteria 5176
297 Ga0496110_0055280 3300048913 Bacteria 3492
298 Ga0496111_0103579 3300048914 Bacteria 2093
299 Ga0496112_0001870 3300048915 Bacteria 16593
300 Ga0496112_0018401 3300048915 Bacteria 6577
301 Ga0496112_0053146 3300048915 Bacteria 3977
302 Ga0496112_0156707 3300048915 Bacteria 2244
303 Ga0496113_0004420 3300048916 Bacteria 8636
304 Ga0496113_0032614 3300048916 Bacteria 3786
305 Ga0496114_0001234 3300048917 Bacteria 19342
306 Ga0496114_0007176 3300048917 Bacteria 8792
307 Ga0496115_0029509 3300048918 Bacteria 4308
308 Ga0496115_0225584 3300048918 Bacteria 1545
309 Ga0496116_0000652 3300048919 Bacteria 45385
310 Ga0496116_0039257 3300048919 Bacteria 3274
311 Ga0496117_0000901 3300048920 Bacteria 45774
312 Ga0496117_0000907 3300048920 Bacteria 45401
313 Ga0496118_0000947 3300048921 Bacteria 45401
314 Ga0496118_0001040 3300048921 Bacteria 43213
315 Ga0496118_0001599 3300048921 Bacteria 33518
316 Ga0496119_0001246 3300048922 Bacteria 31658
317 Ga0496119_0008822 3300048922 Bacteria 8773
318 Ga0496120_0002967 3300048923 Bacteria 16142
319 Ga0496120_0022525 3300048923 Bacteria 3961
320 Ga0496121_0002584 3300048924 Bacteria 27384
321 Ga0496121_0011569 3300048924 Bacteria 9773
322 Ga0496123_0039431 3300048926 Bacteria 3304
323 Ga0496124_0029572 3300048927 Bacteria 4878
324 Ga0496125_0045249 3300048928 Bacteria 3707
325 Ga0496126_0001156 3300048929 Bacteria 43705
326 Ga0496126_0001198 3300048929 Bacteria 42290
327 Ga0496126_0008356 3300048929 Bacteria 11172
328 Ga0496126_0166977 3300048929 Bacteria 1877
329 Ga0501032_0000516 3300049569 Bacteria 31374
330 Ga0501032_0005353 3300049569 Bacteria 9547
331 Ga0501032_0052073 3300049569 Bacteria 2759
332 Ga0501034_0005108 3300049571 Bacteria 14407
333 Ga0501034_0008262 3300049571 Bacteria 11017
334 Ga0501034_0183197 3300049571 Bacteria 2059
335 Ga0501034_0194541 3300049571 Bacteria 1989
336 Ga0501036_0028400 3300049572 Bacteria 4728
337 Ga0501036_0048711 3300049572 Bacteria 3588
338 Ga0501037_0000165 3300049573 Bacteria 62545
339 Ga0501037_0074460 3300049573 Bacteria 2467
340 Ga0501038_0000292 3300049574 Bacteria 42699
341 Ga0501043_0005878 3300049579 Bacteria 9870
342 Ga0501043_0033560 3300049579 Bacteria 4039
343 Ga0501046_0002821 3300049580 Bacteria 16183
344 Ga0501046_0153455 3300049580 Bacteria 1736
345 Ga0501047_0021984 3300049581 Bacteria 6126
346 Ga0501047_0075726 3300049581 Bacteria 3238
347 Ga0501047_0124355 3300049581 Bacteria 2460
348 Ga0501048_0045612 3300049582 Bacteria 3130
349 Ga0501069_0039015 3300049585 Bacteria 2623
350 Ga0501070_0000573 3300049586 Bacteria 33479
351 Ga0501070_0054160 3300049586 Bacteria 3326
352 Ga0501070_0247201 3300049586 Bacteria 1459
353 Ga0501080_0084962 3300049742 Bacteria 2941
354 Ga0501035_0000921 3300049822 Bacteria 31170
355 Ga0501035_0004178 3300049822 Bacteria 13726
356 Ga0501044_0000239 3300049823 Bacteria 69462
357 Ga0501044_0001384 3300049823 Bacteria 28445
358 Ga0501044_0009215 3300049823 Bacteria 10781
359 nmdc:mga03n38_6501_c1 3300050490 Bacteria 4066
360 nmdc:mga00v17_12843_c1 3300050491 Bacteria 4633
361 nmdc:mga00v17_7658_c1 3300050491 Bacteria 5777
362 nmdc:mga00v17_93140_c1 3300050491 Bacteria 1894
363 nmdc:mga0yw44_149756_c1 3300050492 Bacteria 1521
364 nmdc:mga06z11_11530_c1 3300050494 Bacteria 3816
365 nmdc:mga06z11_8304_c1 3300050494 Bacteria 4323
366 nmdc:mga07m45_20046_c1 3300050496 Bacteria 2680
367 nmdc:mga07m45_26444_c1 3300050496 Bacteria 3190
368 nmdc:mga05p37_242036_c1 3300050507 Bacteria 2169
369 nmdc:mga0qj67_59328_c1 3300050509 Bacteria 3034
370 nmdc:mga0qj67_61025_c1 3300050509 Bacteria 2993
371 nmdc:mga0sz30_2564_c1 3300050516 Bacteria 6471
372 Ga0500635_0002638 3300053080 Bacteria 4451
373 Ga0500643_011842 3300053087 Bacteria 3156
374 Ga0500652_006988 3300053131 Bacteria 3669
375 Ga0500616_0077607 3300053153 Bacteria 1677
376 Ga0500645_000588 3300053730 Bacteria 23471
377 Ga0466962_0001402 3300061719 Bacteria 11217
378 Ga0466962_0011949 3300061719 Bacteria 4178
379 Ga0466962_0016152 3300061719 Bacteria 3602
380 2644486244 2643221687 Bacteria 6500351
381 2644637619 2643221715 Bacteria 6671032
382 2738705300 2738541274 Bacteria 6909446
383 2739334595 2738543028 Bacteria 6917070
384 2795786639 2795385470 Bacteria 8317180
385 2842138226 2842134933 Bacteria 5847019
386 2902796246 2902792274 Bacteria 7270173
387 2902801395 2902799365 Bacteria 5419524
388 2902815290 2902810491 Bacteria 6794147
389 2902840347 2902837492 Bacteria 6697721
390 2929215193 2929212328 Bacteria 7708288
391 2939587570 2939582691 Bacteria 7088898
392 Ga0055540_1007028
393 JGI24744J21845_10001012
394 rootH1_10052991
395 Ga0055540_1000871
396 Ga0055540_1004140
397 Ga0070676_10009735
398 Ga0070683_100217460
399 Ga0070666_10007407
400 Ga0070682_100020595
401 Ga0068868_100055358
402 Ga0068868_100233819
403 Ga0070691_10010167
404 Ga0070691_10055571
405 Ga0070687_100003038
406 Ga0070668_100015036
407 Ga0070669_100000402
408 Ga0070675_100150863
409 Ga0070671_100001788
410 Ga0070674_100049237
411 Ga0070674_100049452
412 Ga0070688_100029661
413 Ga0070667_100000375
414 Ga0070667_100001789
415 Ga0070709_10079957
416 Ga0070710_10016408
417 Ga0070711_100009472
418 Ga0070711_100014859
419 Ga0070694_100117552
420 Ga0070694_100182620
421 Ga0070663_100024642
422 Ga0070678_100004043
423 Ga0070678_100205470
424 Ga0070662_100035737
425 Ga0068867_100013712
426 Ga0068853_100009261
427 Ga0068853_100019311
428 Ga0068853_100144897
429 Ga0068853_100221401
430 Ga0070695_100020569
431 Ga0070696_100023141
432 Ga0070696_100075405
433 Ga0070665_100002733
434 Ga0070665_100015638
435 Ga0070665_100019774
436 Ga0070704_100014331
437 Ga0068854_100021244
438 Ga0070702_100018999
439 Ga0070702_100165751
440 Ga0068859_100003562
441 Ga0068859_100014622
442 Ga0068866_10011684
443 Ga0068861_100000912
444 Ga0068861_100108526
445 Ga0068861_100109740
446 Ga0068863_100000194
447 Ga0068863_100000794
448 Ga0068858_100002320
449 Ga0068858_100006408
450 Ga0068860_100000489
451 Ga0068860_100012341
452 Ga0068860_100245117
453 Ga0068862_100000054
454 Ga0068862_100101380
455 Ga0068862_100175805
456 Ga0075365_10006689
457 Ga0075365_10008123
458 Ga0075363_100001290
459 Ga0075363_100002387
460 Ga0075363_100004890
461 Ga0075363_100009153
462 Ga0075363_100011684
463 Ga0075363_100013740
464 Ga0075364_10002269
465 Ga0075364_10006064
466 Ga0075364_10010510
467 Ga0075364_10017127
468 Ga0075364_10054140
469 Ga0070716_100004564
470 Ga0070716_100061860
471 Ga0070712_100032864
472 Ga0070712_100121911
473 Ga0070712_100126597
474 Ga0075367_10003499
475 Ga0075369_10000301
476 Ga0075369_10000915
477 Ga0075369_10014650
478 Ga0075369_10017310
479 Ga0075370_10048938
480 Ga0075370_10051886
481 Ga0075430_100079352
482 Ga0075430_100146191
483 Ga0097620_100003562
484 Ga0097620_100014623
485 Ga0105245_10063762
486 Ga0105245_10201220
487 Ga0105247_10000085
488 Ga0105247_10001102
489 Ga0105247_10104986
490 Ga0114129_10057478
491 Ga0105243_10044462
492 Ga0105241_10067006
493 Ga0105242_10152651
494 Ga0105248_10001177
495 Ga0105248_10008164
496 Ga0105237_10002094
497 Ga0105237_10327868
498 Ga0105237_10378319
499 Ga0105249_10000001
500 Ga0105249_10002155
501 Ga0105249_10006735
502 Ga0105239_10031814
503 Ga0105239_10252064
504 Ga0157374_10102657
505 Ga0157378_10027267
506 Ga0163162_10013868
507 Ga0163162_10036517
508 Ga0163162_10055394
509 Ga0163162_10139288
510 Ga0157372_10358051
511 Ga0157375_10043238
512 Ga0163163_10086104
513 Ga0157380_10000850
514 Ga0157380_10177173
515 Ga0157377_10020092
516 Ga0157379_10038591
517 Ga0157376_10031729
518 Ga0163161_10016416
519 Ga0213876_10015659
520 Ga0213875_10002632
521 Ga0209051_1000612
522 Ga0209051_1000965
523 Ga0207692_10007832
524 Ga0207692_10008433
525 Ga0207642_10004876
526 Ga0207710_10000125
527 Ga0207710_10004616
528 Ga0207688_10014875
529 Ga0207688_10102312
530 Ga0207685_10001741
531 Ga0207699_10135597
532 Ga0207645_10045588
533 Ga0207671_10030693
534 Ga0207693_10141369
535 Ga0207693_10143195
536 Ga0207663_10012416
537 Ga0207663_10051148
538 Ga0207662_10012718
539 Ga0207657_10035626
540 Ga0207681_10010840
541 Ga0207681_10043041
542 Ga0207644_10003102
543 Ga0207644_10092179
544 Ga0207706_10175947
545 Ga0207706_10259996
546 Ga0207709_10012199
547 Ga0207670_10027905
548 Ga0207670_10087471
549 Ga0207669_10009466
550 Ga0207669_10078183
551 Ga0207704_10007729
552 Ga0207665_10116949
553 Ga0207665_10116950
554 Ga0207711_10000228
555 Ga0207711_10245330
556 Ga0207689_10126553
557 Ga0207661_10300568
558 Ga0207712_10000006
559 Ga0207712_10178063
560 Ga0207712_10188677
561 Ga0207712_10226588
562 Ga0207668_10016947
563 Ga0207640_10022098
564 Ga0207658_10000313
565 Ga0207658_10061911
566 Ga0207677_10028327
567 Ga0207677_10041386
568 Ga0207703_10040915
569 Ga0207703_10047756
570 Ga0207703_10215432
571 Ga0207639_10013632
572 Ga0207639_10120743
573 Ga0207678_10142621
574 Ga0207678_10171273
575 Ga0207708_10022004
576 Ga0207708_10147876
577 Ga0207702_10076891
578 Ga0207641_10001860
579 Ga0207641_10002419
580 Ga0207648_10040772
581 Ga0207675_100046029
582 Ga0207675_100146075
583 Ga0207683_10093893
584 Ga0268266_10013851
585 Ga0268266_10014669
586 Ga0268266_10170938
587 Ga0268265_10000032
588 Ga0268264_10000515
589 Ga0268264_10039008
590 Ga0265327_10000064
591 Ga0265327_10019407
592 Ga0307405_10056567
593 Ga0307405_10193521
594 Ga0307410_10011584
595 Ga0307409_100010479
596 Ga0307416_100263468
597 Ga0307415_100036258
598 Ga0373960_0051249
599 Ga0373931_0004374
600 Ga0436364_0058161
601 Ga0436364_0143407
602 Ga0436365_1167796
603 Ga0436365_1499581
604 Ga0439466_0001111
605 Ga0439466_0013491
606 Ga0439466_0014896
607 Ga0439465_0000239
608 Ga0439445_0008045
609 Ga0466972_0004467
610 Ga0466972_0041358
611 Ga0466972_0071276
612 Ga0466965_0004508
613 Ga0466966_0005104
614 Ga0466966_0010346
615 Ga0466966_0017188
616 Ga0466966_0047494
617 Ga0466961_0030164
618 Ga0466963_0001744
619 Ga0466971_0013897
620 Ga0466971_0022482
621 Ga0466968_0052123
622 Ga0466968_0059683
623 Ga0466970_0018497
624 Ga0466957_0001211
625 Ga0466957_0003994
626 Ga0466957_0022313
627 Ga0466957_0076191
628 Ga0466960_0000301
629 Ga0466960_0007819
630 Ga0466959_0002707
631 Ga0466959_0006707
632 Ga0466959_0041536
633 Ga0466958_0002115
634 Ga0466967_0002204
635 Ga0466967_0008316
636 Ga0466967_0037473
637 Ga0466967_0150692
638 Ga0466967_0177039
639 Ga0466967_0182476
640 Ga0466967_0291494
641 Ga0495629_0006165
642 Ga0495638_0007001
643 Ga0495648_0002977
644 Ga0495640_0034833
645 Ga0495668_0027271
646 Ga0495668_0060539
647 Ga0495674_0022186
648 Ga0495672_0006917
649 Ga0495672_0043236
650 Ga0495673_0005236
651 Ga0495686_0001716
652 Ga0496100_0006872
653 Ga0496100_0014225
654 Ga0496100_0017600
655 Ga0496100_0094092
656 Ga0496100_0112245
657 Ga0496101_0000188
658 Ga0496101_0006904
659 Ga0496101_0033259
660 Ga0496101_0046015
661 Ga0496102_0000460
662 Ga0496102_0017517
663 Ga0496102_0031128
664 Ga0496102_0052689
665 Ga0496102_0088348
666 Ga0496102_0106168
667 Ga0496102_0237175
668 Ga0496103_0000301
669 Ga0496103_0010851
670 Ga0496104_0006760
671 Ga0496104_0029573
672 Ga0496105_0032226
673 Ga0496106_0003488
674 Ga0496106_0013903
675 Ga0496106_0016433
676 Ga0496106_0020791
677 Ga0496107_0002302
678 Ga0496107_0016016
679 Ga0496107_0085305
680 Ga0496107_0096049
681 Ga0496108_0023871
682 Ga0496108_0051219
683 Ga0496108_0058861
684 Ga0496108_0080217
685 Ga0496109_0002635
686 Ga0496109_0019886
687 Ga0496110_0024166
688 Ga0496110_0055280
689 Ga0496111_0103579
690 Ga0496112_0001870
691 Ga0496112_0018401
692 Ga0496112_0053146
693 Ga0496112_0156707
694 Ga0496113_0004420
695 Ga0496113_0032614
696 Ga0496114_0001234
697 Ga0496114_0007176
698 Ga0496115_0029509
699 Ga0496115_0225584
700 Ga0496116_0000652
701 Ga0496116_0039257
702 Ga0496117_0000901
703 Ga0496117_0000907
704 Ga0496118_0000947
705 Ga0496118_0001040
706 Ga0496118_0001599
707 Ga0496119_0001246
708 Ga0496119_0008822
709 Ga0496120_0002967
710 Ga0496120_0022525
711 Ga0496121_0002584
712 Ga0496121_0011569
713 Ga0496123_0039431
714 Ga0496124_0029572
715 Ga0496125_0045249
716 Ga0496126_0001156
717 Ga0496126_0001198
718 Ga0496126_0008356
719 Ga0496126_0166977
720 Ga0501032_0000516
721 Ga0501032_0005353
722 Ga0501032_0052073
723 Ga0501034_0005108
724 Ga0501034_0008262
725 Ga0501034_0183197
726 Ga0501034_0194541
727 Ga0501036_0028400
728 Ga0501036_0048711
729 Ga0501037_0000165
730 Ga0501037_0074460
731 Ga0501038_0000292
732 Ga0501043_0005878
733 Ga0501043_0033560
734 Ga0501046_0002821
735 Ga0501046_0153455
736 Ga0501047_0021984
737 Ga0501047_0075726
738 Ga0501047_0124355
739 Ga0501048_0045612
740 Ga0501069_0039015
741 Ga0501070_0000573
742 Ga0501070_0054160
743 Ga0501070_0247201
744 Ga0501080_0084962
745 Ga0501035_0000921
746 Ga0501035_0004178
747 Ga0501044_0000239
748 Ga0501044_0001384
749 Ga0501044_0009215
750 nmdc:mga03n38_6501_c1
751 nmdc:mga00v17_12843_c1
752 nmdc:mga00v17_7658_c1
753 nmdc:mga00v17_93140_c1
754 nmdc:mga0yw44_149756_c1
755 nmdc:mga06z11_11530_c1
756 nmdc:mga06z11_8304_c1
757 nmdc:mga07m45_20046_c1
758 nmdc:mga07m45_26444_c1
759 nmdc:mga05p37_242036_c1
760 nmdc:mga0qj67_59328_c1
761 nmdc:mga0qj67_61025_c1
762 nmdc:mga0sz30_2564_c1
763 Ga0500635_0002638
764 Ga0500643_011842
765 Ga0500652_006988
766 Ga0500616_0077607
767 Ga0500645_000588
768 Ga0466962_0001402
769 Ga0466962_0011949
770 Ga0466962_0016152
771 2644486244
772 2644637619
773 2738705300
774 2739334595
775 2795786639
776 2842138226
777 2902796246
778 2902801395
779 2902815290
780 2902840347
781 2929215193
782 2939587570

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18305

DNA_pol_A_exoN

3' to 5' exonuclease C-terminal domain

335

422

0.98

PF01612

DNA_pol_A_exo1

3'-5' exonuclease

39

208

0.96

PF00570

HRDC

HRDC domain

250

317

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rhf-assembly1.cif.gz_A d. radiodurans recq hrdc domain 3 0.8756 238 312
3cym-assembly1.cif.gz_A crystal structure of protein bad_0989 from bifidobacterium adolescentis 0.8682 14 412
1wud-assembly1.cif.gz_A e. coli recq hrdc domain 0.8586 238 307
7mqd-assembly1.cif.gz_A bartonella henselae nrnc complexed with pagg. d4 symmetry. 0.8492 48 212
2rhf-assembly1.cif.gz_A d. radiodurans recq hrdc domain 3 0.8447 238 312
ID Description Score Start End Superfamily
af_I6XF17_15_224_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9664 11 219 3.30.420.10
af_I6XF17_15_224_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9574 11 219 3.30.420.10
af_I6XF17_332_429_1.10.150.80 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;HRDC domain 0.9497 322 413 1.10.150.80
3cymA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9149 14 212 3.30.420.10
af_I6XF17_332_429_1.10.150.80 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;HRDC domain 0.8836 322 413 1.10.150.80
ID Description Score Start End GO Terms
AF-A0A2S9F1U0-F1-model_v4 Ribonuclease D 0.9664 174 412 GO:0000166
GO:0003676
AF-A0A829Q8R1-F1-model_v4 3'-5' exonuclease family protein 0.9545 92 412 GO:0000166
GO:0003676
GO:0006139
GO:0008408
AF-A0A1V3XUG6-F1-model_v4 Putative conserved alanine rich protein 0.9538 318 411
AF-A0A655HPN2-F1-model_v4 deleted 0.9507 93 416
AF-A0A7Y5N6G9-F1-model_v4 Ribonuclease D 0.9476 14 196 GO:0003676
GO:0006139
GO:0008408

Map