F431828

General Info

Members Datasets Scaffolds Average Seq Length
390 275 345 370

Family's Representative Sequence

Representative Sequence 3300046683|Ga0495658_0042019|Ga0495658_0042019_20_1273
Length 417
Sequence MPIGRYSSVVRGTRLAERGWYTAACTRVRPARGITHQQGNAMTDRHDSSRRRALAQLSAGSLATLAPWAMQAALAQAKPLTVGVIYVGPRDDFGYNQAQAQAVVEVKKLPGVKVVEEENVPETTAVQKTMTGMIQQDGAKVVFATSFGYFDPHVLVLAPKFPDVRFSHCGGLWTDKNPKNAGSYFGYVEECQYLNGVIAGHMSKSKKLGFVAAKPIPQVLKNINAFTMGARSVDPKITTTVIFTGEWSMPVKEAEATNSLADQGVDVFTMHVDGPKVVVETAAKRGKMVCGYHASQAKLAPNAYLTGAEWNWLTAYKTVIDAAQAGKPHPNFLRGGLKEGYVKMSPYGPMVTDAAKKNAEDVKAKMLAGTFDIFSGGSAGLKDNKGATVIAAGKTIKQTDVELEKMNYLVEGVVGSA

Samples

Sample ID Description Type Environment
1 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2643221609 Acidovorax sp. Root217 Isolate Unclassified
7 2643221611 Acidovorax sp. Root219 Isolate Unclassified
8 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
9 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
10 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
11 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
12 2643221658 Variovorax sp. Root411 Isolate Unclassified
13 2643221660 Methylibium sp. Root1272 Isolate Unclassified
14 2643221672 Variovorax sp. Root434 Isolate Unclassified
15 2738541277 Variovorax sp. GV051 Isolate Unclassified
16 2738541307 Variovorax sp. GV008 Isolate Unclassified
17 2738543013 Variovorax sp. BT01 Isolate Unclassified
18 2738543019 Variovorax sp. GV040 Isolate Unclassified
19 2818991446 Variovorax sp. 1180 Isolate Unclassified
20 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
21 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
22 2842677519 Variovorax sp. R-72495 Isolate Unclassified
23 2842733646 Variovorax sp. R-72446 Isolate Unclassified
24 2842747753 Variovorax sp. R-72060 Isolate Unclassified
25 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
26 2885198086 Variovorax sp. 679 Isolate Unclassified
27 2885211737 Variovorax sp. 553 Isolate Unclassified
28 2899924645 Variovorax sp. 369 Isolate Unclassified
29 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
30 2904456579 Variovorax sp. 2002 Isolate Unclassified
31 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
32 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
33 2928037797 Variovorax sp. 1126 Isolate Unclassified
34 2928044640 Variovorax sp. 1128 Isolate Unclassified
35 2928051484 Variovorax sp. 1133 Isolate Unclassified
36 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
37 2928070936 Variovorax gossypii 1167 Isolate Unclassified
38 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
39 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
40 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
41 2929520902 Variovorax beijingensis 502 Isolate Unclassified
42 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
43 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
44 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
45 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
46 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
47 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
48 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
49 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
50 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
51 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
52 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
53 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
54 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
55 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
56 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
57 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
58 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
59 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
60 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
63 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
64 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
65 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
66 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
67 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
68 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
69 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
70 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
71 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
72 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
73 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
74 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
75 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
76 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
77 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
78 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
79 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
80 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
81 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
82 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
83 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
91 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
92 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
99 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
100 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
101 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
106 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
107 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
132 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
134 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
135 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
191 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
196 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
197 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
198 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
199 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
200 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
201 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
202 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
206 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
207 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
208 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
209 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
213 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
214 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
215 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
216 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
217 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
222 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
223 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
224 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
225 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
226 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
227 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
228 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
229 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
234 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
235 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
236 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
237 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
240 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
241 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
247 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
256 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
261 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
262 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
263 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
264 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
265 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
266 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
269 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
270 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
271 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
272 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
275 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.46
Metatranscriptomes 0
Isolates 11.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.77
Nodule 0.77
Rhizoplane 1.79
Rhizosphere 60.77
Stem 0
Stem Tuber 0
Unclassified 15.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10022929 3300001989 Bacteria 2211
2 JGI25156J39149_1012976 3300002705 Bacteria 1798
3 JGI25158J39367_1002143 3300002739 Bacteria 3301
4 JGI25150J39212_1004630 3300002774 Bacteria 3033
5 JGI25159J45721_1006058 3300002987 Bacteria 3678
6 JGI25151J46595_10012084 3300003187 Bacteria 3937
7 rootL2_10034615 3300003322 Bacteria 6681
8 JGI25160J50197_1012835 3300003354 Bacteria 2885
9 JGI25161J50226_1003670 3300003374 Bacteria 3437
10 Ga0055535_1000260 3300003761 Bacteria 55578
11 Ga0055535_1000402 3300003761 Bacteria 40697
12 Ga0055542_1000013 3300003762 Bacteria 387560
13 Ga0055529_1000489 3300003763 Bacteria 36411
14 Ga0055537_1000739 3300003773 Bacteria 16762
15 Ga0055536_1004462 3300003781 Bacteria 7148
16 Ga0055534_1000685 3300003784 Bacteria 16762
17 Ga0055534_1003712 3300003784 Bacteria 4712
18 Ga0055531_10000740 3300003794 Bacteria 27497
19 Ga0065704_10169009 3300005289 Bacteria 1303
20 Ga0070658_10087090 3300005327 Bacteria 2570
21 Ga0070676_10001131 3300005328 Bacteria 13340
22 Ga0070676_10002843 3300005328 Bacteria 8944
23 Ga0070676_10011330 3300005328 Bacteria 4847
24 Ga0070683_100020280 3300005329 Bacteria 5915
25 Ga0068869_100029934 3300005334 Bacteria 3818
26 Ga0070680_100010668 3300005336 Bacteria 7090
27 Ga0070680_100063695 3300005336 Bacteria 3021
28 Ga0068868_100059071 3300005338 Bacteria 3033
29 Ga0070660_100022483 3300005339 Bacteria 4663
30 Ga0070669_100056347 3300005353 Bacteria 2882
31 Ga0070669_100107860 3300005353 Bacteria 2110
32 Ga0070675_100000096 3300005354 Bacteria 50781
33 Ga0070675_100020292 3300005354 Bacteria 5303
34 Ga0070671_100011750 3300005355 Bacteria 7042
35 Ga0070671_100028513 3300005355 Bacteria 4597
36 Ga0070671_100035083 3300005355 Bacteria 4155
37 Ga0070674_100139552 3300005356 Bacteria 1817
38 Ga0070674_100248666 3300005356 Bacteria 1395
39 Ga0070673_100018706 3300005364 Bacteria 4957
40 Ga0070673_100020217 3300005364 Bacteria 4798
41 Ga0070667_100018943 3300005367 Bacteria 5707
42 Ga0070667_100050706 3300005367 Bacteria 3498
43 Ga0070667_100140494 3300005367 Bacteria 2114
44 Ga0070700_100148056 3300005441 Bacteria 1603
45 Ga0070678_100107370 3300005456 Bacteria 2177
46 Ga0070662_100122098 3300005457 Bacteria 1998
47 Ga0070681_10012394 3300005458 Bacteria 8455
48 Ga0068867_100113774 3300005459 Bacteria 2083
49 Ga0070698_100050145 3300005471 Bacteria 4257
50 Ga0070699_100102161 3300005518 Bacteria 2514
51 Ga0070679_100001939 3300005530 Bacteria 18580
52 Ga0070672_100000072 3300005543 Bacteria 46329
53 Ga0070672_100017376 3300005543 Bacteria 5175
54 Ga0068855_100023121 3300005563 Bacteria 7448
55 Ga0068855_100171169 3300005563 Bacteria 2460
56 Ga0068857_100017408 3300005577 Bacteria 6297
57 Ga0068856_100035122 3300005614 Bacteria 4913
58 Ga0068852_100067681 3300005616 Bacteria 3123
59 Ga0068852_100098011 3300005616 Bacteria 2639
60 Ga0068864_100110367 3300005618 Bacteria 2449
61 Ga0068866_10001406 3300005718 Bacteria 10360
62 Ga0068861_100001111 3300005719 Bacteria 16665
63 Ga0068851_10015261 3300005834 Bacteria 3658
64 Ga0068863_100016978 3300005841 Bacteria 6981
65 Ga0068863_100107074 3300005841 Bacteria 2660
66 Ga0068858_100009363 3300005842 Bacteria 9350
67 Ga0068860_100002496 3300005843 Bacteria 19308
68 Ga0068860_100009942 3300005843 Bacteria 9428
69 Ga0068862_100019306 3300005844 Bacteria 5688
70 Ga0068862_100103059 3300005844 Bacteria 2498
71 Ga0068862_100201961 3300005844 Bacteria 1793
72 Ga0075365_10291400 3300006038 Bacteria 1148
73 Ga0075368_10021678 3300006042 Bacteria 2442
74 Ga0075368_10071839 3300006042 Bacteria 1399
75 Ga0075363_100064735 3300006048 Bacteria 1975
76 Ga0075363_100108345 3300006048 Bacteria 1542
77 Ga0075432_10014896 3300006058 Bacteria 2650
78 Ga0075362_10053290 3300006177 Bacteria 1815
79 Ga0075367_10087583 3300006178 Bacteria 1891
80 Ga0075366_10028047 3300006195 Bacteria 3304
81 Ga0075366_10030279 3300006195 Bacteria 3181
82 Ga0097621_100009980 3300006237 Bacteria 6920
83 Ga0097621_100357730 3300006237 Bacteria 1300
84 Ga0075370_10044267 3300006353 Bacteria 2516
85 Ga0075370_10059419 3300006353 Bacteria 2176
86 Ga0075370_10083326 3300006353 Bacteria 1840
87 Ga0068871_100025269 3300006358 Bacteria 4618
88 Ga0099826_10000699 3300006948 Bacteria 17541
89 Ga0105240_10003161 3300009093 Bacteria 25902
90 Ga0105240_10013108 3300009093 Bacteria 11408
91 Ga0105240_10247146 3300009093 Bacteria 2065
92 Ga0105245_10013935 3300009098 Bacteria 7001
93 Ga0105247_10141195 3300009101 Bacteria 1578
94 Ga0105243_10009785 3300009148 Bacteria 7298
95 Ga0105243_10279735 3300009148 Bacteria 1502
96 Ga0105242_10181679 3300009176 Bacteria 1856
97 Ga0105237_10002139 3300009545 Bacteria 24880
98 Ga0105237_10008606 3300009545 Bacteria 11036
99 Ga0105238_10077009 3300009551 Bacteria 3328
100 Ga0105238_10247760 3300009551 Bacteria 1759
101 Ga0105238_10261880 3300009551 Bacteria 1709
102 Ga0105238_10318087 3300009551 Bacteria 1542
103 Ga0105249_10018847 3300009553 Bacteria 6151
104 Ga0105249_10226517 3300009553 Bacteria 1842
105 Ga0105239_10001543 3300010375 Bacteria 30425
106 Ga0105246_10219816 3300011119 Bacteria 1488
107 Ga0157373_10053091 3300013100 Bacteria 2882
108 Ga0157369_10035810 3300013105 Bacteria 5441
109 Ga0157374_10012796 3300013296 Bacteria 7308
110 Ga0157374_10143503 3300013296 Bacteria 2318
111 Ga0157378_10144178 3300013297 Bacteria 2214
112 Ga0157375_10067592 3300013308 Bacteria 3571
113 Ga0157375_10078231 3300013308 Bacteria 3340
114 Ga0157375_10299777 3300013308 Bacteria 1771
115 Ga0182008_10016923 3300014497 Bacteria 3782
116 Ga0157377_10000016 3300014745 Bacteria 190613
117 Ga0182007_10045435 3300015262 Bacteria 1455
118 Ga0183362_10004 3300015683 Bacteria 569303
119 Ga0163161_10000561 3300017792 Bacteria 29982
120 Ga0163161_10023490 3300017792 Bacteria 4350
121 Ga0209672_102201 3300025228 Bacteria 5090
122 Ga0209147_100843 3300025229 Bacteria 14406
123 Ga0209258_100020 3300025242 Bacteria 565241
124 Ga0209258_100414 3300025242 Bacteria 51162
125 Ga0207425_1000814 3300025245 Bacteria 15617
126 Ga0209148_1000031 3300025254 Bacteria 564601
127 Ga0209759_1001541 3300025256 Bacteria 12632
128 Ga0209129_1000055 3300025258 Bacteria 261708
129 Ga0209565_1000078 3300025263 Bacteria 160838
130 Ga0209565_1000310 3300025263 Bacteria 45322
131 Ga0209455_1000264 3300025272 Bacteria 60245
132 Ga0209673_1000170 3300025273 Bacteria 133933
133 Ga0209673_1001531 3300025273 Bacteria 21069
134 Ga0209673_1025196 3300025273 Bacteria 1982
135 Ga0209130_1000807 3300025284 Bacteria 26513
136 Ga0209130_1001274 3300025284 Bacteria 17481
137 Ga0209675_1000055 3300025291 Bacteria 193129
138 Ga0209675_1004061 3300025291 Bacteria 6668
139 Ga0209675_1005830 3300025291 Bacteria 5062
140 Ga0209676_1000040 3300025292 Bacteria 438184
141 Ga0209676_1013125 3300025292 Bacteria 3203
142 Ga0209025_1000409 3300025294 Bacteria 86577
143 Ga0209025_1004351 3300025294 Bacteria 12359
144 Ga0209025_1007387 3300025294 Bacteria 8211
145 Ga0209025_1017588 3300025294 Bacteria 4113
146 Ga0209564_1000157 3300025295 Bacteria 164758
147 Ga0209564_1000806 3300025295 Bacteria 42875
148 Ga0209758_1000042 3300025297 Bacteria 407145
149 Ga0209050_1000021 3300025298 Bacteria 574406
150 Ga0209050_1025709 3300025298 Bacteria 1992
151 Ga0209256_1000056 3300025299 Bacteria 283044
152 Ga0209256_1000124 3300025299 Bacteria 165390
153 Ga0207426_1000055 3300025302 Bacteria 374450
154 Ga0207426_1000079 3300025302 Bacteria 314709
155 Ga0209051_1000351 3300025303 Bacteria 68445
156 Ga0209051_1000446 3300025303 Bacteria 55218
157 Ga0209051_1030836 3300025303 Bacteria 2074
158 Ga0209257_1000015 3300025304 Bacteria 908141
159 Ga0209257_1000043 3300025304 Bacteria 512127
160 Ga0209257_1001377 3300025304 Bacteria 29185
161 Ga0207697_10006755 3300025315 Bacteria 5160
162 Ga0207655_1005080 3300025728 Bacteria 9094
163 Ga0207642_10001981 3300025899 Bacteria 6311
164 Ga0207642_10075605 3300025899 Bacteria 1618
165 Ga0207680_10001775 3300025903 Bacteria 10181
166 Ga0207645_10017521 3300025907 Bacteria 4726
167 Ga0207643_10038899 3300025908 Bacteria 2674
168 Ga0207684_10016844 3300025910 Bacteria 6276
169 Ga0207707_10063061 3300025912 Bacteria 3226
170 Ga0207695_10229477 3300025913 Bacteria 1761
171 Ga0207671_10008796 3300025914 Bacteria 8504
172 Ga0207662_10010589 3300025918 Bacteria 5098
173 Ga0207657_10022273 3300025919 Bacteria 5935
174 Ga0207652_10040910 3300025921 Bacteria 3938
175 Ga0207681_10043558 3300025923 Bacteria 3004
176 Ga0207694_10014153 3300025924 Bacteria 6015
177 Ga0207650_10001087 3300025925 Bacteria 20115
178 Ga0207650_10005322 3300025925 Bacteria 8777
179 Ga0207650_10007951 3300025925 Bacteria 7229
180 Ga0207650_10374909 3300025925 Bacteria 1174
181 Ga0207659_10000153 3300025926 Bacteria 41045
182 Ga0207659_10049969 3300025926 Bacteria 2969
183 Ga0207659_10109678 3300025926 Bacteria 2096
184 Ga0207644_10001677 3300025931 Bacteria 14280
185 Ga0207644_10012220 3300025931 Bacteria 5699
186 Ga0207690_10096107 3300025932 Bacteria 2106
187 Ga0207706_10021057 3300025933 Bacteria 5857
188 Ga0207706_10071535 3300025933 Bacteria 3051
189 Ga0207706_10193510 3300025933 Bacteria 1785
190 Ga0207686_10025552 3300025934 Bacteria 3436
191 Ga0207709_10008073 3300025935 Bacteria 5829
192 Ga0207709_10025587 3300025935 Bacteria 3381
193 Ga0207709_10045009 3300025935 Bacteria 2670
194 Ga0207704_10226224 3300025938 Bacteria 1388
195 Ga0207691_10002790 3300025940 Bacteria 17030
196 Ga0207691_10157949 3300025940 Bacteria 1990
197 Ga0207711_10010920 3300025941 Bacteria 7548
198 Ga0207689_10058598 3300025942 Bacteria 3168
199 Ga0207661_10027349 3300025944 Bacteria 4356
200 Ga0207667_10118322 3300025949 Bacteria 2730
201 Ga0207667_10153972 3300025949 Bacteria 2365
202 Ga0207667_10158511 3300025949 Bacteria 2329
203 Ga0207651_10007699 3300025960 Bacteria 5756
204 Ga0207651_10024141 3300025960 Bacteria 3755
205 Ga0207712_10022756 3300025961 Bacteria 4131
206 Ga0207658_10000764 3300025986 Bacteria 27551
207 Ga0207658_10017704 3300025986 Bacteria 4912
208 Ga0207677_10139678 3300026023 Bacteria 1853
209 Ga0207703_10005845 3300026035 Bacteria 9852
210 Ga0207703_10088531 3300026035 Bacteria 2599
211 Ga0207703_10128381 3300026035 Bacteria 2186
212 Ga0207639_10046690 3300026041 Bacteria 3269
213 Ga0207639_10134712 3300026041 Bacteria 2050
214 Ga0207639_10313351 3300026041 Bacteria 1391
215 Ga0207678_10140398 3300026067 Bacteria 2062
216 Ga0207708_10162225 3300026075 Bacteria 1766
217 Ga0207641_10002081 3300026088 Bacteria 18972
218 Ga0207641_10033136 3300026088 Bacteria 4293
219 Ga0207648_10000476 3300026089 Bacteria 44737
220 Ga0207648_10016905 3300026089 Bacteria 6649
221 Ga0207676_10012019 3300026095 Bacteria 6195
222 Ga0207676_10041879 3300026095 Bacteria 3519
223 Ga0207674_10016088 3300026116 Bacteria 8193
224 Ga0207674_10073045 3300026116 Bacteria 3444
225 Ga0207674_10076115 3300026116 Bacteria 3365
226 Ga0207675_100000846 3300026118 Bacteria 30438
227 Ga0209282_1000139 3300027666 Bacteria 42847
228 Ga0209813_10040449 3300027866 Bacteria 1417
229 Ga0268266_10046142 3300028379 Bacteria 3731
230 Ga0268266_10160318 3300028379 Bacteria 2034
231 Ga0268265_10004575 3300028380 Bacteria 9565
232 Ga0268265_10011207 3300028380 Bacteria 6060
233 Ga0268265_10014399 3300028380 Bacteria 5388
234 Ga0268264_10001240 3300028381 Bacteria 24403
235 Ga0268264_10097041 3300028381 Bacteria 2554
236 Ga0265336_10000044 3300028666 Bacteria 131932
237 Ga0307515_10000006 3300028794 Bacteria 725810
238 Ga0307515_10000322 3300028794 Bacteria 118563
239 Ga0307515_10002234 3300028794 Bacteria 42472
240 Ga0307515_10023840 3300028794 Bacteria 10697
241 Ga0307515_10049372 3300028794 Bacteria 6334
242 Ga0307515_10152337 3300028794 Bacteria 2409
243 Ga0307515_10248240 3300028794 Bacteria 1537
244 Ga0307515_10298528 3300028794 Bacteria 1298
245 Ga0265324_10000440 3300029957 Bacteria 29513
246 Ga0307512_10136017 3300030522 Bacteria 1522
247 Ga0265332_10004050 3300031238 Bacteria 6963
248 Ga0265327_10003094 3300031251 Bacteria 16421
249 Ga0265327_10005552 3300031251 Bacteria 10473
250 Ga0307513_10000013 3300031456 Bacteria 325682
251 Ga0307513_10007912 3300031456 Bacteria 13688
252 Ga0307513_10029152 3300031456 Bacteria 6296
253 Ga0307513_10157366 3300031456 Bacteria 2170
254 Ga0307509_10007099 3300031507 Bacteria 14778
255 Ga0307509_10014890 3300031507 Bacteria 9113
256 Ga0307408_100094331 3300031548 Bacteria 2266
257 Ga0307408_100146453 3300031548 Bacteria 1859
258 Ga0307508_10000450 3300031616 Bacteria 49283
259 Ga0307508_10008054 3300031616 Bacteria 9770
260 Ga0307514_10000891 3300031649 Bacteria 46567
261 Ga0307514_10001030 3300031649 Bacteria 40201
262 Ga0307514_10004889 3300031649 Bacteria 12181
263 Ga0265314_10008574 3300031711 Bacteria 8741
264 Ga0265342_10083893 3300031712 Bacteria 1836
265 Ga0307516_10001048 3300031730 Bacteria 38456
266 Ga0307516_10006527 3300031730 Bacteria 13656
267 Ga0307516_10008482 3300031730 Bacteria 11617
268 Ga0307516_10026674 3300031730 Bacteria 5866
269 Ga0307516_10227245 3300031730 Bacteria 1572
270 Ga0307407_10178766 3300031903 Bacteria 1404
271 Ga0307412_10008739 3300031911 Bacteria 5795
272 Ga0307412_10031554 3300031911 Bacteria 3347
273 Ga0307416_100213724 3300032002 Bacteria 1842
274 Ga0316585_10023820 3300032137 Bacteria 1891
275 Ga0307507_10187105 3300033179 Bacteria 1465
276 Ga0307510_10026478 3300033180 Bacteria 6663
277 Ga0373948_0018976 3300034817 Bacteria 1296
278 Ga0373953_0055020 3300035117 Bacteria 1615
279 Ga0373957_0028100 3300035120 Bacteria 2048
280 Ga0373943_0015458 3300035170 Bacteria 3467
281 Ga0373935_0024297 3300035692 Bacteria 3730
282 Ga0395905_0035250 3300037471 Bacteria 4698
283 Ga0395905_0295380 3300037471 Bacteria 1507
284 Ga0439461_0003018 3300041410 Bacteria 2742
285 Ga0439431_0012372 3300041997 Bacteria 1961
286 Ga0439445_0011999 3300042004 Bacteria 2075
287 Ga0439432_002290 3300042006 Bacteria 7216
288 Ga0439449_0000360 3300042007 Bacteria 16709
289 Ga0439452_030638 3300042010 Bacteria 1325
290 Ga0450911_000417 3300042115 Bacteria 14032
291 Ga0450906_001240 3300042145 Bacteria 5641
292 Ga0439434_0001757 3300042435 Bacteria 6291
293 Ga0451577_0009811 3300042876 Bacteria 9175
294 Ga0466969_0000065 3300044656 Bacteria 54697
295 Ga0466966_0079777 3300044684 Bacteria 2039
296 Ga0453684_0011408 3300044712 Bacteria 14911
297 Ga0453684_0111049 3300044712 Bacteria 3331
298 Ga0466968_0066233 3300044735 Bacteria 1564
299 Ga0466959_0034832 3300045049 Bacteria 3724
300 Ga0495592_0001645 3300046454 Bacteria 15657
301 Ga0495590_0016904 3300046457 Bacteria 2633
302 Ga0495629_0127525 3300046459 Bacteria 1773
303 Ga0495583_0000224 3300046506 Bacteria 95810
304 Ga0495606_0001242 3300046507 Bacteria 35620
305 Ga0495637_0005420 3300046520 Bacteria 6507
306 Ga0495621_0029310 3300046539 Bacteria 1876
307 Ga0495625_0024199 3300046660 Bacteria 4626
308 Ga0495625_0035241 3300046660 Bacteria 3690
309 Ga0495635_0079267 3300046663 Bacteria 2248
310 Ga0495658_0042019 3300046683 Bacteria 2550
311 Ga0495658_0064873 3300046683 Bacteria 2105
312 Ga0495649_0000373 3300046694 Bacteria 38804
313 Ga0495660_0077375 3300046810 Bacteria 1751
314 Ga0495674_0187478 3300047319 Bacteria 1721
315 Ga0495676_0015539 3300047321 Bacteria 6774
316 Ga0495684_0077932 3300047471 Bacteria 2515
317 Ga0495686_0048395 3300047472 Bacteria 2681
318 Ga0496106_0082013 3300048909 Bacteria 2478
319 Ga0496108_0134435 3300048911 Bacteria 2126
320 Ga0496109_0105439 3300048912 Bacteria 2618
321 Ga0496109_0302543 3300048912 Bacteria 1508
322 Ga0496116_0098391 3300048919 Bacteria 1755
323 Ga0496117_0092421 3300048920 Bacteria 1943
324 Ga0496121_0013352 3300048924 Bacteria 8835
325 Ga0496123_0000124 3300048926 Bacteria 158327
326 Ga0501034_0031938 3300049571 Bacteria 5349
327 Ga0501206_011523 3300049653 Bacteria 1194
328 Ga0501249_002052 3300049679 Bacteria 4097
329 Ga0501225_0006613 3300049705 Bacteria 3382
330 Ga0501262_000127 3300049759 Bacteria 9481
331 Ga0501265_002637 3300049762 Bacteria 2032
332 nmdc:mga0k408_18251_c1 3300050493 Bacteria 3915
333 nmdc:mga0k408_51914_c1 3300050493 Bacteria 2376
334 nmdc:mga07m45_184018_c1 3300050496 Bacteria 1215
335 nmdc:mga07m45_3745_c1 3300050496 Bacteria 7357
336 nmdc:mga07m45_96331_c1 3300050496 Bacteria 1698
337 nmdc:mga06r32_319_c1 3300050510 Bacteria 40297
338 Ga0500635_0000057 3300053080 Bacteria 73077
339 Ga0500651_0008495 3300053093 Bacteria 6047
340 Ga0500594_0001115 3300053118 Bacteria 5765
341 Ga0500658_0001211 3300053134 Bacteria 10493
342 Ga0500559_0000047 3300053136 Bacteria 95447
343 Ga0500616_0030232 3300053153 Bacteria 2976
344 Ga0500622_0029084 3300053156 Bacteria 2907
345 Ga0500636_0001689 3300053177 Bacteria 12086

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10076115 Ga0207674_100761154 320
2 3300050496 nmdc:mga07m45_184018_c1 nmdc:mga07m45_184018_c1_13_1077 340
3 3300048912 Ga0496109_0302543 Ga0496109_0302543_440_1489 342
4 3300044712 Ga0453684_0111049 Ga0453684_0111049_120_1244 343
5 3300049653 Ga0501206_011523 Ga0501206_011523_109_1164 343
6 3300005356 Ga0070674_100139552 Ga0070674_1001395522 345
7 3300009553 Ga0105249_10226517 Ga0105249_102265172 345
8 3300013308 Ga0157375_10299777 Ga0157375_102997772 345
9 3300025899 Ga0207642_10075605 Ga0207642_100756051 345
10 3300028379 Ga0268266_10046142 Ga0268266_100461421 345
11 3300005327 Ga0070658_10087090 Ga0070658_100870902 346
12 3300005339 Ga0070660_100022483 Ga0070660_1000224834 346
13 3300005530 Ga0070679_100001939 Ga0070679_10000193916 346
14 3300005563 Ga0068855_100023121 Ga0068855_1000231217 346
15 3300009093 Ga0105240_10003161 Ga0105240_1000316112 346
16 3300025919 Ga0207657_10022273 Ga0207657_100222734 346
17 3300025921 Ga0207652_10040910 Ga0207652_100409102 346
18 3300025949 Ga0207667_10118322 Ga0207667_101183223 346
19 3300037471 Ga0395905_0035250 Ga0395905_0035250_1386_2459 346
20 3300049571 Ga0501034_0031938 Ga0501034_0031938_632_1756 346
21 3300005336 Ga0070680_100063695 Ga0070680_1000636952 347
22 3300005458 Ga0070681_10012394 Ga0070681_100123943 347
23 3300009545 Ga0105237_10008606 Ga0105237_100086068 347
24 3300009551 Ga0105238_10247760 Ga0105238_102477601 347
25 3300025912 Ga0207707_10063061 Ga0207707_100630612 347
26 3300025949 Ga0207667_10153972 Ga0207667_101539722 347
27 3300046457 Ga0495590_0016904 Ga0495590_0016904_365_1441 347
28 3300046810 Ga0495660_0077375 Ga0495660_0077375_135_1211 347
29 3300050510 nmdc:mga06r32_319_c1 nmdc:mga06r32_319_c1_33932_35164 347
30 3300005334 Ga0068869_100029934 Ga0068869_1000299342 349
31 3300005563 Ga0068855_100171169 Ga0068855_1001711692 349
32 3300005614 Ga0068856_100035122 Ga0068856_1000351225 349
33 3300009098 Ga0105245_10013935 Ga0105245_100139356 349
34 3300025913 Ga0207695_10229477 Ga0207695_102294772 349
35 3300026023 Ga0207677_10139678 Ga0207677_101396782 349
36 3300005841 Ga0068863_100107074 Ga0068863_1001070742 350
37 3300006237 Ga0097621_100357730 Ga0097621_1003577301 350
38 3300009551 Ga0105238_10318087 Ga0105238_103180872 350
39 3300042115 Ga0450911_000417 Ga0450911_000417_9999_11111 350
40 iso_pu_bacteria 2928115317 2928118848 350
41 iso_pu_bacteria 2885192300 2885193972 351
42 3300009551 Ga0105238_10261880 Ga0105238_102618802 352
43 3300013296 Ga0157374_10143503 Ga0157374_101435032 352
44 3300050493 nmdc:mga0k408_18251_c1 nmdc:mga0k408_18251_c1_1773_2879 352
45 3300050493 nmdc:mga0k408_51914_c1 nmdc:mga0k408_51914_c1_33_1139 352
46 3300050496 nmdc:mga07m45_3745_c1 nmdc:mga07m45_3745_c1_4422_5528 352
47 iso_pu_bacteria 2643221654 2644305745 352
48 iso_pu_bacteria 2738543013 2739247371 352
49 iso_pu_bacteria 2842733646 2842738286 352
50 3300031456 Ga0307513_10157366 Ga0307513_101573661 353
51 3300031911 Ga0307412_10008739 Ga0307412_100087394 353
52 3300035170 Ga0373943_0015458 Ga0373943_0015458_16_1161 353
53 3300049679 Ga0501249_002052 Ga0501249_002052_2185_3303 353
54 3300049705 Ga0501225_0006613 Ga0501225_0006613_866_1984 353
55 iso_pu_bacteria 2643221628 2644160851 353
56 iso_pu_bacteria 2643221639 2644220202 353
57 iso_pu_bacteria 2643221646 2644261246 353
58 iso_pu_bacteria 2643221660 2644341161 353
59 iso_pu_bacteria 2738541277 2738719309 353
60 iso_pu_bacteria 2738541307 2738883345 353
61 iso_pu_bacteria 2738543019 2739282960 353
62 iso_pu_bacteria 2842677519 2842679284 353
63 iso_pu_bacteria 2842747753 2842750717 353
64 iso_pu_bacteria 2904449895 2904451620 353
65 iso_pu_bacteria 2904456579 2904461891 353
66 iso_pu_bacteria 2904541872 2904543299 353
67 iso_pu_bacteria 2919462493 2919464484 353
68 iso_pu_bacteria 2929160207 2929160531 353
69 iso_pu_bacteria 2929520902 2929526539 353
70 iso_pu_bacteria 2945909444 2945915521 353
71 iso_pu_bacteria 2945945610 2945950458 353
72 iso_pu_bacteria 2945972063 2945974899 353
73 iso_pu_bacteria 2945984333 2945989081 353
74 3300003794 Ga0055531_10000740 Ga0055531_100007407 354
75 3300005367 Ga0070667_100018943 Ga0070667_1000189433 354
76 3300005367 Ga0070667_100140494 Ga0070667_1001404942 354
77 3300006038 Ga0075365_10291400 Ga0075365_102914001 354
78 3300006048 Ga0075363_100064735 Ga0075363_1000647352 354
79 3300006177 Ga0075362_10053290 Ga0075362_100532901 354
80 3300006353 Ga0075370_10083326 Ga0075370_100833262 354
81 3300009101 Ga0105247_10141195 Ga0105247_101411952 354
82 3300025303 Ga0209051_1000351 Ga0209051_100035146 354
83 3300025304 Ga0209257_1000015 Ga0209257_1000015288 354
84 3300025986 Ga0207658_10017704 Ga0207658_100177044 354
85 3300026088 Ga0207641_10033136 Ga0207641_100331364 354
86 3300028794 Ga0307515_10023840 Ga0307515_100238404 354
87 3300028794 Ga0307515_10049372 Ga0307515_100493725 354
88 3300031238 Ga0265332_10004050 Ga0265332_100040506 354
89 3300031456 Ga0307513_10000013 Ga0307513_1000001367 354
90 3300031456 Ga0307513_10007912 Ga0307513_100079129 354
91 3300031507 Ga0307509_10007099 Ga0307509_100070992 354
92 3300031507 Ga0307509_10014890 Ga0307509_100148908 354
93 3300031616 Ga0307508_10000450 Ga0307508_100004503 354
94 3300031616 Ga0307508_10008054 Ga0307508_100080549 354
95 3300031711 Ga0265314_10008574 Ga0265314_100085746 354
96 3300031712 Ga0265342_10083893 Ga0265342_100838931 354
97 3300031730 Ga0307516_10001048 Ga0307516_1000104829 354
98 3300031730 Ga0307516_10008482 Ga0307516_100084827 354
99 3300033179 Ga0307507_10187105 Ga0307507_101871051 354
100 3300033180 Ga0307510_10026478 Ga0307510_100264784 354
101 3300044656 Ga0466969_0000065 Ga0466969_0000065_17549_18670 354
102 3300044684 Ga0466966_0079777 Ga0466966_0079777_424_1545 354
103 3300045049 Ga0466959_0034832 Ga0466959_0034832_41_1162 354
104 3300046454 Ga0495592_0001645 Ga0495592_0001645_3321_4436 354
105 3300046683 Ga0495658_0064873 Ga0495658_0064873_320_1435 354
106 3300047472 Ga0495686_0048395 Ga0495686_0048395_1415_2530 354
107 3300053118 Ga0500594_0001115 Ga0500594_0001115_2901_4016 354
108 3300053136 Ga0500559_0000047 Ga0500559_0000047_76821_77936 354
109 3300053156 Ga0500622_0029084 Ga0500622_0029084_1776_2891 354
110 3300005356 Ga0070674_100248666 Ga0070674_1002486661 355
111 3300005459 Ga0068867_100113774 Ga0068867_1001137741 355
112 3300006195 Ga0075366_10028047 Ga0075366_100280473 355
113 3300009093 Ga0105240_10247146 Ga0105240_102471462 355
114 3300013105 Ga0157369_10035810 Ga0157369_100358102 355
115 3300014497 Ga0182008_10016923 Ga0182008_100169234 355
116 3300015683 Ga0183362_10004 Ga0183362_10004505 355
117 3300017792 Ga0163161_10023490 Ga0163161_100234903 355
118 3300025949 Ga0207667_10158511 Ga0207667_101585113 355
119 3300028794 Ga0307515_10000006 Ga0307515_10000006409 355
120 3300028794 Ga0307515_10000322 Ga0307515_1000032270 355
121 3300028794 Ga0307515_10002234 Ga0307515_1000223437 355
122 3300028794 Ga0307515_10248240 Ga0307515_102482402 355
123 3300031251 Ga0265327_10003094 Ga0265327_1000309410 355
124 3300031251 Ga0265327_10005552 Ga0265327_100055526 355
125 3300031456 Ga0307513_10029152 Ga0307513_100291524 355
126 3300031548 Ga0307408_100146453 Ga0307408_1001464533 355
127 3300031649 Ga0307514_10001030 Ga0307514_100010309 355
128 3300031730 Ga0307516_10227245 Ga0307516_102272452 355
129 3300042006 Ga0439432_002290 Ga0439432_002290_6031_7146 355
130 3300042007 Ga0439449_0000360 Ga0439449_0000360_15458_16573 355
131 3300042010 Ga0439452_030638 Ga0439452_030638_72_1187 355
132 3300042876 Ga0451577_0009811 Ga0451577_0009811_5528_6631 355
133 3300046660 Ga0495625_0035241 Ga0495625_0035241_1857_2966 355
134 3300048909 Ga0496106_0082013 Ga0496106_0082013_14_1135 355
135 3300048911 Ga0496108_0134435 Ga0496108_0134435_180_1295 355
136 3300048912 Ga0496109_0105439 Ga0496109_0105439_159_1274 355
137 3300049762 Ga0501265_002637 Ga0501265_002637_90_1211 355
138 iso_pu_bacteria 2599185214 2599622442 355
139 iso_pu_bacteria 2599185226 2599674466 355
140 iso_pu_bacteria 2599185227 2599680151 355
141 iso_pu_bacteria 2599185229 2599692167 355
142 iso_pu_bacteria 2643221658 2644326558 355
143 iso_pu_bacteria 2643221672 2644396902 355
144 iso_pu_bacteria 2818991446 2819599142 355
145 iso_pu_bacteria 2831265667 2831270921 355
146 iso_pu_bacteria 2838054893 2838058968 355
147 iso_pu_bacteria 2885198086 2885202260 355
148 iso_pu_bacteria 2885211737 2885215913 355
149 iso_pu_bacteria 2899924645 2899929966 355
150 iso_pu_bacteria 2928037797 2928043501 355
151 iso_pu_bacteria 2928044640 2928049869 355
152 iso_pu_bacteria 2928051484 2928054444 355
153 iso_pu_bacteria 2928064002 2928070030 355
154 iso_pu_bacteria 2928070936 2928074351 355
155 iso_pu_bacteria 2928084124 2928086589 355
156 3300002705 JGI25156J39149_1012976 JGI25156J39149_10129762 356
157 3300003322 rootL2_10034615 rootL2_100346153 356
158 3300003761 Ga0055535_1000402 Ga0055535_100040229 356
159 3300003763 Ga0055529_1000489 Ga0055529_100048930 356
160 3300003784 Ga0055534_1003712 Ga0055534_10037125 356
161 3300005328 Ga0070676_10001131 Ga0070676_100011312 356
162 3300005328 Ga0070676_10002843 Ga0070676_100028436 356
163 3300005328 Ga0070676_10011330 Ga0070676_100113301 356
164 3300005329 Ga0070683_100020280 Ga0070683_1000202801 356
165 3300005336 Ga0070680_100010668 Ga0070680_1000106683 356
166 3300005338 Ga0068868_100059071 Ga0068868_1000590712 356
167 3300005353 Ga0070669_100056347 Ga0070669_1000563472 356
168 3300005353 Ga0070669_100107860 Ga0070669_1001078602 356
169 3300005354 Ga0070675_100000096 Ga0070675_10000009634 356
170 3300005354 Ga0070675_100020292 Ga0070675_1000202924 356
171 3300005355 Ga0070671_100011750 Ga0070671_1000117505 356
172 3300005355 Ga0070671_100028513 Ga0070671_1000285132 356
173 3300005355 Ga0070671_100035083 Ga0070671_1000350831 356
174 3300005364 Ga0070673_100018706 Ga0070673_1000187064 356
175 3300005364 Ga0070673_100020217 Ga0070673_1000202174 356
176 3300005367 Ga0070667_100050706 Ga0070667_1000507063 356
177 3300005441 Ga0070700_100148056 Ga0070700_1001480561 356
178 3300005456 Ga0070678_100107370 Ga0070678_1001073701 356
179 3300005457 Ga0070662_100122098 Ga0070662_1001220982 356
180 3300005471 Ga0070698_100050145 Ga0070698_1000501453 356
181 3300005518 Ga0070699_100102161 Ga0070699_1001021612 356
182 3300005543 Ga0070672_100000072 Ga0070672_10000007226 356
183 3300005543 Ga0070672_100017376 Ga0070672_1000173763 356
184 3300005577 Ga0068857_100017408 Ga0068857_1000174082 356
185 3300005616 Ga0068852_100067681 Ga0068852_1000676812 356
186 3300005616 Ga0068852_100098011 Ga0068852_1000980112 356
187 3300005618 Ga0068864_100110367 Ga0068864_1001103672 356
188 3300005718 Ga0068866_10001406 Ga0068866_100014062 356
189 3300005719 Ga0068861_100001111 Ga0068861_10000111115 356
190 3300005841 Ga0068863_100016978 Ga0068863_1000169784 356
191 3300005842 Ga0068858_100009363 Ga0068858_1000093632 356
192 3300005843 Ga0068860_100002496 Ga0068860_10000249618 356
193 3300005843 Ga0068860_100009942 Ga0068860_1000099428 356
194 3300005844 Ga0068862_100019306 Ga0068862_1000193065 356
195 3300005844 Ga0068862_100103059 Ga0068862_1001030592 356
196 3300005844 Ga0068862_100201961 Ga0068862_1002019611 356
197 3300006042 Ga0075368_10021678 Ga0075368_100216782 356
198 3300006195 Ga0075366_10030279 Ga0075366_100302792 356
199 3300006237 Ga0097621_100009980 Ga0097621_1000099806 356
200 3300006353 Ga0075370_10059419 Ga0075370_100594192 356
201 3300006358 Ga0068871_100025269 Ga0068871_1000252692 356
202 3300009093 Ga0105240_10013108 Ga0105240_100131084 356
203 3300009148 Ga0105243_10009785 Ga0105243_100097855 356
204 3300009148 Ga0105243_10279735 Ga0105243_102797351 356
205 3300009176 Ga0105242_10181679 Ga0105242_101816792 356
206 3300009545 Ga0105237_10002139 Ga0105237_1000213913 356
207 3300009551 Ga0105238_10077009 Ga0105238_100770092 356
208 3300009553 Ga0105249_10018847 Ga0105249_100188474 356
209 3300010375 Ga0105239_10001543 Ga0105239_1000154319 356
210 3300013296 Ga0157374_10012796 Ga0157374_100127966 356
211 3300013297 Ga0157378_10144178 Ga0157378_101441782 356
212 3300013308 Ga0157375_10067592 Ga0157375_100675923 356
213 3300013308 Ga0157375_10078231 Ga0157375_100782313 356
214 3300014745 Ga0157377_10000016 Ga0157377_10000016138 356
215 3300025242 Ga0209258_100414 Ga0209258_10041410 356
216 3300025256 Ga0209759_1001541 Ga0209759_10015414 356
217 3300025272 Ga0209455_1000264 Ga0209455_100026447 356
218 3300025273 Ga0209673_1025196 Ga0209673_10251962 356
219 3300025291 Ga0209675_1004061 Ga0209675_10040615 356
220 3300025292 Ga0209676_1013125 Ga0209676_10131253 356
221 3300025294 Ga0209025_1000409 Ga0209025_100040911 356
222 3300025298 Ga0209050_1025709 Ga0209050_10257092 356
223 3300025303 Ga0209051_1030836 Ga0209051_10308361 356
224 3300025315 Ga0207697_10006755 Ga0207697_100067555 356
225 3300025899 Ga0207642_10001981 Ga0207642_100019811 356
226 3300025903 Ga0207680_10001775 Ga0207680_100017753 356
227 3300025907 Ga0207645_10017521 Ga0207645_100175211 356
228 3300025908 Ga0207643_10038899 Ga0207643_100388992 356
229 3300025910 Ga0207684_10016844 Ga0207684_100168444 356
230 3300025914 Ga0207671_10008796 Ga0207671_100087966 356
231 3300025918 Ga0207662_10010589 Ga0207662_100105892 356
232 3300025923 Ga0207681_10043558 Ga0207681_100435582 356
233 3300025924 Ga0207694_10014153 Ga0207694_100141535 356
234 3300025925 Ga0207650_10001087 Ga0207650_100010871 356
235 3300025925 Ga0207650_10005322 Ga0207650_100053226 356
236 3300025925 Ga0207650_10007951 Ga0207650_100079514 356
237 3300025925 Ga0207650_10374909 Ga0207650_103749091 356
238 3300025926 Ga0207659_10000153 Ga0207659_100001536 356
239 3300025926 Ga0207659_10049969 Ga0207659_100499691 356
240 3300025926 Ga0207659_10109678 Ga0207659_101096781 356
241 3300025931 Ga0207644_10001677 Ga0207644_1000167713 356
242 3300025931 Ga0207644_10012220 Ga0207644_100122203 356
243 3300025933 Ga0207706_10021057 Ga0207706_100210572 356
244 3300025933 Ga0207706_10071535 Ga0207706_100715352 356
245 3300025934 Ga0207686_10025552 Ga0207686_100255523 356
246 3300025935 Ga0207709_10008073 Ga0207709_100080733 356
247 3300025935 Ga0207709_10025587 Ga0207709_100255873 356
248 3300025935 Ga0207709_10045009 Ga0207709_100450091 356
249 3300025938 Ga0207704_10226224 Ga0207704_102262241 356
250 3300025940 Ga0207691_10002790 Ga0207691_1000279014 356
251 3300025941 Ga0207711_10010920 Ga0207711_100109206 356
252 3300025942 Ga0207689_10058598 Ga0207689_100585983 356
253 3300025944 Ga0207661_10027349 Ga0207661_100273491 356
254 3300025960 Ga0207651_10007699 Ga0207651_100076994 356
255 3300025960 Ga0207651_10024141 Ga0207651_100241412 356
256 3300025961 Ga0207712_10022756 Ga0207712_100227562 356
257 3300025986 Ga0207658_10000764 Ga0207658_100007646 356
258 3300026035 Ga0207703_10005845 Ga0207703_1000584511 356
259 3300026035 Ga0207703_10088531 Ga0207703_100885313 356
260 3300026035 Ga0207703_10128381 Ga0207703_101283812 356
261 3300026041 Ga0207639_10134712 Ga0207639_101347122 356
262 3300026041 Ga0207639_10313351 Ga0207639_103133512 356
263 3300026067 Ga0207678_10140398 Ga0207678_101403982 356
264 3300026075 Ga0207708_10162225 Ga0207708_101622251 356
265 3300026088 Ga0207641_10002081 Ga0207641_1000208111 356
266 3300026089 Ga0207648_10000476 Ga0207648_100004768 356
267 3300026089 Ga0207648_10016905 Ga0207648_100169055 356
268 3300026095 Ga0207676_10012019 Ga0207676_100120192 356
269 3300026095 Ga0207676_10041879 Ga0207676_100418791 356
270 3300026116 Ga0207674_10016088 Ga0207674_100160886 356
271 3300026118 Ga0207675_100000846 Ga0207675_10000084626 356
272 3300028379 Ga0268266_10160318 Ga0268266_101603182 356
273 3300028380 Ga0268265_10004575 Ga0268265_100045755 356
274 3300028380 Ga0268265_10014399 Ga0268265_100143995 356
275 3300028381 Ga0268264_10001240 Ga0268264_100012402 356
276 3300028381 Ga0268264_10097041 Ga0268264_100970411 356
277 3300028666 Ga0265336_10000044 Ga0265336_1000004413 356
278 3300028794 Ga0307515_10152337 Ga0307515_101523373 356
279 3300028794 Ga0307515_10298528 Ga0307515_102985281 356
280 3300029957 Ga0265324_10000440 Ga0265324_1000044021 356
281 3300031548 Ga0307408_100094331 Ga0307408_1000943312 356
282 3300031730 Ga0307516_10006527 Ga0307516_1000652710 356
283 3300031730 Ga0307516_10026674 Ga0307516_100266745 356
284 3300032137 Ga0316585_10023820 Ga0316585_100238201 356
285 3300034817 Ga0373948_0018976 Ga0373948_0018976_135_1253 356
286 3300035117 Ga0373953_0055020 Ga0373953_0055020_13_1143 356
287 3300035120 Ga0373957_0028100 Ga0373957_0028100_480_1610 356
288 3300035692 Ga0373935_0024297 Ga0373935_0024297_650_1768 356
289 3300037471 Ga0395905_0295380 Ga0395905_0295380_217_1344 356
290 3300044712 Ga0453684_0011408 Ga0453684_0011408_13359_14516 356
291 3300046459 Ga0495629_0127525 Ga0495629_0127525_483_1664 356
292 3300046506 Ga0495583_0000224 Ga0495583_0000224_57538_58653 356
293 3300046507 Ga0495606_0001242 Ga0495606_0001242_586_1701 356
294 3300046539 Ga0495621_0029310 Ga0495621_0029310_578_1708 356
295 3300046660 Ga0495625_0024199 Ga0495625_0024199_1760_2875 356
296 3300046663 Ga0495635_0079267 Ga0495635_0079267_924_2045 356
297 3300046683 Ga0495658_0042019 Ga0495658_0042019_20_1273 356
298 3300046694 Ga0495649_0000373 Ga0495649_0000373_20395_21510 356
299 3300047319 Ga0495674_0187478 Ga0495674_0187478_42_1160 356
300 3300047321 Ga0495676_0015539 Ga0495676_0015539_3232_4353 356
301 3300047471 Ga0495684_0077932 Ga0495684_0077932_1329_2459 356
302 3300048926 Ga0496123_0000124 Ga0496123_0000124_151627_152742 356
303 3300053080 Ga0500635_0000057 Ga0500635_0000057_69880_70986 356
304 3300053177 Ga0500636_0001689 Ga0500636_0001689_6318_7433 356
305 iso_pu_bacteria 2585428058 2587731438 356
306 iso_pu_bacteria 2643221609 2644060575 356
307 iso_pu_bacteria 2643221611 2644073903 356
308 3300003773 Ga0055537_1000739 Ga0055537_10007395 357
309 3300003784 Ga0055534_1000685 Ga0055534_10006855 357
310 3300005289 Ga0065704_10169009 Ga0065704_101690091 357
311 3300006042 Ga0075368_10071839 Ga0075368_100718391 357
312 3300006048 Ga0075363_100108345 Ga0075363_1001083452 357
313 3300006058 Ga0075432_10014896 Ga0075432_100148961 357
314 3300006178 Ga0075367_10087583 Ga0075367_100875832 357
315 3300006353 Ga0075370_10044267 Ga0075370_100442673 357
316 3300006948 Ga0099826_10000699 Ga0099826_100006995 357
317 3300011119 Ga0105246_10219816 Ga0105246_102198161 357
318 3300013100 Ga0157373_10053091 Ga0157373_100530912 357
319 3300015262 Ga0182007_10045435 Ga0182007_100454352 357
320 3300017792 Ga0163161_10000561 Ga0163161_1000056129 357
321 3300025263 Ga0209565_1000078 Ga0209565_100007815 357
322 3300025273 Ga0209673_1000170 Ga0209673_1000170111 357
323 3300025291 Ga0209675_1000055 Ga0209675_1000055111 357
324 3300025291 Ga0209675_1005830 Ga0209675_10058302 357
325 3300025294 Ga0209025_1017588 Ga0209025_10175883 357
326 3300025303 Ga0209051_1000446 Ga0209051_10004464 357
327 3300025940 Ga0207691_10157949 Ga0207691_101579492 357
328 3300027666 Ga0209282_1000139 Ga0209282_100013923 357
329 3300027866 Ga0209813_10040449 Ga0209813_100404492 357
330 3300028380 Ga0268265_10011207 Ga0268265_100112074 357
331 3300030522 Ga0307512_10136017 Ga0307512_101360172 357
332 3300031649 Ga0307514_10000891 Ga0307514_1000089126 357
333 3300031649 Ga0307514_10004889 Ga0307514_100048895 357
334 3300031903 Ga0307407_10178766 Ga0307407_101787661 357
335 3300031911 Ga0307412_10031554 Ga0307412_100315543 357
336 3300032002 Ga0307416_100213724 Ga0307416_1002137241 357
337 3300041410 Ga0439461_0003018 Ga0439461_0003018_806_1927 357
338 3300041997 Ga0439431_0012372 Ga0439431_0012372_104_1225 357
339 3300042004 Ga0439445_0011999 Ga0439445_0011999_456_1574 357
340 3300042145 Ga0450906_001240 Ga0450906_001240_3793_4911 357
341 3300042435 Ga0439434_0001757 Ga0439434_0001757_1626_2744 357
342 3300044735 Ga0466968_0066233 Ga0466968_0066233_13_1158 357
343 3300046520 Ga0495637_0005420 Ga0495637_0005420_1756_2874 357
344 3300048919 Ga0496116_0098391 Ga0496116_0098391_30_1151 357
345 3300048924 Ga0496121_0013352 Ga0496121_0013352_716_1837 357
346 3300049759 Ga0501262_000127 Ga0501262_000127_7513_8631 357
347 3300025933 Ga0207706_10193510 Ga0207706_101935102 358
348 3300001989 JGI24739J22299_10022929 JGI24739J22299_100229292 359
349 3300002739 JGI25158J39367_1002143 JGI25158J39367_10021433 359
350 3300002774 JGI25150J39212_1004630 JGI25150J39212_10046303 359
351 3300002987 JGI25159J45721_1006058 JGI25159J45721_10060583 359
352 3300003187 JGI25151J46595_10012084 JGI25151J46595_100120845 359
353 3300003354 JGI25160J50197_1012835 JGI25160J50197_10128353 359
354 3300003374 JGI25161J50226_1003670 JGI25161J50226_10036703 359
355 3300003761 Ga0055535_1000260 Ga0055535_10002603 359
356 3300003762 Ga0055542_1000013 Ga0055542_1000013197 359
357 3300003781 Ga0055536_1004462 Ga0055536_10044627 359
358 3300005834 Ga0068851_10015261 Ga0068851_100152613 359
359 3300025228 Ga0209672_102201 Ga0209672_1022015 359
360 3300025229 Ga0209147_100843 Ga0209147_10084311 359
361 3300025242 Ga0209258_100020 Ga0209258_100020353 359
362 3300025245 Ga0207425_1000814 Ga0207425_10008145 359
363 3300025254 Ga0209148_1000031 Ga0209148_1000031353 359
364 3300025258 Ga0209129_1000055 Ga0209129_1000055214 359
365 3300025263 Ga0209565_1000310 Ga0209565_100031035 359
366 3300025273 Ga0209673_1001531 Ga0209673_100153110 359
367 3300025284 Ga0209130_1000807 Ga0209130_100080722 359
368 3300025284 Ga0209130_1001274 Ga0209130_100127411 359
369 3300025292 Ga0209676_1000040 Ga0209676_1000040243 359
370 3300025294 Ga0209025_1004351 Ga0209025_10043513 359
371 3300025294 Ga0209025_1007387 Ga0209025_10073873 359
372 3300025295 Ga0209564_1000157 Ga0209564_10001573 359
373 3300025295 Ga0209564_1000806 Ga0209564_10008062 359
374 3300025297 Ga0209758_1000042 Ga0209758_1000042146 359
375 3300025298 Ga0209050_1000021 Ga0209050_1000021150 359
376 3300025299 Ga0209256_1000056 Ga0209256_1000056123 359
377 3300025299 Ga0209256_1000124 Ga0209256_100012458 359
378 3300025302 Ga0207426_1000055 Ga0207426_1000055185 359
379 3300025302 Ga0207426_1000079 Ga0207426_1000079148 359
380 3300025304 Ga0209257_1000043 Ga0209257_1000043145 359
381 3300025304 Ga0209257_1001377 Ga0209257_100137711 359
382 3300025728 Ga0207655_1005080 Ga0207655_10050805 359
383 3300025932 Ga0207690_10096107 Ga0207690_100961072 359
384 3300026041 Ga0207639_10046690 Ga0207639_100466903 359
385 3300026116 Ga0207674_10073045 Ga0207674_100730453 359
386 3300048920 Ga0496117_0092421 Ga0496117_0092421_281_1405 359
387 3300050496 nmdc:mga07m45_96331_c1 nmdc:mga07m45_96331_c1_531_1655 359
388 3300053093 Ga0500651_0008495 Ga0500651_0008495_880_2004 359
389 3300053134 Ga0500658_0001211 Ga0500658_0001211_8404_9528 359
390 3300053153 Ga0500616_0030232 Ga0500616_0030232_1042_2166 359

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02608

Bmp

ABC transporter substrate-binding protein PnrA-like

80

374

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s99-assembly1.cif.gz_A crystal structure of a basic membrane lipoprotein from brucella melitensis, iodide soak 0.9332 24 359
6pi5-assembly4.cif.gz_D the evolving story of atzt, a periplasmic binding protein 0.9289 22 359
3s99-assembly1.cif.gz_A crystal structure of a basic membrane lipoprotein from brucella melitensis, iodide soak 0.9251 24 359
6pi5-assembly4.cif.gz_D the evolving story of atzt, a periplasmic binding protein 0.9236 22 359
7x0r-assembly1.cif.gz_A crystal structure of substrate binding protein lbp complexed wtih guanosine from clostridium thermocellum 0.9037 24 318
ID Description Score Start End Superfamily
3s99A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9433 133 359 3.40.50.2300
3s99A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9293 133 359 3.40.50.2300
2fqwA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8136 23 130 3.40.50.2300
4iilA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8052 132 316 3.40.50.2300
4p98A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7836 134 316 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A659UJD1-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.987 151 247 GO:0005886
AF-A0A658K5D6-F1-model_v4 Twin-arginine translocation pathway signal 0.9853 185 359 GO:0005886
AF-A0A512JMG1-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.9796 27 359 GO:0005886
AF-U2FZT8-F1-model_v4 ABC transporter substrate-binding protein 0.9755 17 358 GO:0005886
AF-A0A512JMG1-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.9738 27 359 GO:0005886

Feature Viewer

pLDDT pTM Quality
91.26 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map