F431793

General Info

Members Datasets Scaffolds Average Seq Length
390 208 780 257

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1719879|Ga0436365_1719879_351_1130
Length 259
Sequence MAWDPGQYLKFAGPRLRPALDLLQRIDLEAPRLVYDLGAGAGNVTRLIAARWPAARVIGVDGSAEMLAKAAAENPGIEWQQADLGHWRPSVDGARAPDAIYSNAALHWLDGHDRLIPDIFAQLAPGGVMALQMPRNFSAPSHTSITEAALAGPWRGKLEPLLRPSPVEAPEFYYDLLAPRTAALDMWESEYLQVLDGENPVKEWTKGTWLTPLLAALDKPERSRFEADYAARVAAHYPRRADGKTLFPFRRMFIVATAP

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
143 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
144 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
145 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
146 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
202 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
203 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
204 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
205 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0
Rhizoplane 0.51
Rhizosphere 96.67
Stem 0
Stem Tuber 0
Unclassified 8.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1719879 3300039437 Bacteria 1268
2 Ga0070676_10008630 3300005328 Bacteria 5495
3 Ga0070670_100038651 3300005331 Bacteria 4103
4 Ga0068869_100003188 3300005334 Bacteria 10020
5 Ga0068869_100038952 3300005334 Bacteria 3391
6 Ga0068869_100077915 3300005334 Bacteria 2467
7 Ga0070680_100008096 3300005336 Bacteria 8024
8 Ga0070680_100032958 3300005336 Bacteria 4172
9 Ga0070682_100009912 3300005337 Bacteria 5395
10 Ga0068868_100101196 3300005338 Bacteria 2332
11 Ga0070691_10017920 3300005341 Bacteria 3260
12 Ga0070691_10019743 3300005341 Bacteria 3112
13 Ga0070691_10052496 3300005341 Bacteria 1949
14 Ga0070691_10095183 3300005341 Bacteria 1473
15 Ga0070661_100006770 3300005344 Bacteria 7898
16 Ga0070692_10057927 3300005345 Bacteria 2033
17 Ga0070671_100006499 3300005355 Bacteria 9346
18 Ga0070673_100024318 3300005364 Bacteria 4440
19 Ga0070659_100007243 3300005366 Bacteria 8051
20 Ga0070703_10006762 3300005406 Bacteria 3216
21 Ga0070709_10018310 3300005434 Bacteria 4031
22 Ga0070709_10074025 3300005434 Bacteria 2207
23 Ga0070714_100014234 3300005435 Bacteria 6388
24 Ga0070714_100039192 3300005435 Bacteria 3988
25 Ga0070713_100085568 3300005436 Unclassified 2701
26 Ga0070713_100095633 3300005436 Bacteria 2563
27 Ga0070701_10001385 3300005438 Bacteria 8963
28 Ga0070701_10107719 3300005438 Bacteria 1553
29 Ga0070705_100009285 3300005440 Bacteria 4885
30 Ga0070705_100156691 3300005440 Bacteria 1517
31 Ga0070700_100002805 3300005441 Bacteria 8934
32 Ga0070694_100001367 3300005444 Bacteria 14259
33 Ga0070694_100014255 3300005444 Bacteria 4974
34 Ga0070694_100017909 3300005444 Bacteria 4484
35 Ga0070694_100271657 3300005444 Bacteria 1289
36 Ga0070708_100005552 3300005445 Bacteria 9997
37 Ga0070708_100104421 3300005445 Bacteria 2598
38 Ga0070708_100230318 3300005445 Bacteria 1738
39 Ga0070663_100000680 3300005455 Bacteria 18271
40 Ga0070681_10215907 3300005458 Unclassified 1834
41 Ga0068867_100004638 3300005459 Bacteria 9670
42 Ga0070706_100083568 3300005467 Bacteria 2958
43 Ga0070706_100175284 3300005467 Bacteria 2002
44 Ga0070707_100133604 3300005468 Bacteria 2413
45 Ga0070707_100208004 3300005468 Bacteria 1907
46 Ga0070707_100215233 3300005468 Bacteria 1872
47 Ga0070707_100448519 3300005468 Bacteria 1251
48 Ga0070698_100001489 3300005471 Bacteria 26007
49 Ga0070698_100022175 3300005471 Bacteria 6648
50 Ga0070698_100030664 3300005471 Bacteria 5575
51 Ga0070698_100109411 3300005471 Bacteria 2730
52 Ga0070699_100009983 3300005518 Bacteria 8219
53 Ga0070699_100013628 3300005518 Bacteria 7000
54 Ga0070699_100079172 3300005518 Bacteria 2862
55 Ga0070699_100304686 3300005518 Bacteria 1430
56 Ga0070679_100657163 3300005530 Bacteria 991
57 Ga0070684_100214016 3300005535 Bacteria 1757
58 Ga0070697_100011751 3300005536 Bacteria 6850
59 Ga0070697_100018172 3300005536 Bacteria 5541
60 Ga0070697_100025074 3300005536 Bacteria 4754
61 Ga0070697_100128648 3300005536 Bacteria 2122
62 Ga0070697_100163472 3300005536 Unclassified 1881
63 Ga0070697_100224120 3300005536 Unclassified 1603
64 Ga0070697_100362833 3300005536 Bacteria 1252
65 Ga0068853_100000697 3300005539 Bacteria 23226
66 Ga0070695_100003218 3300005545 Bacteria 9532
67 Ga0070695_100039188 3300005545 Bacteria 2994
68 Ga0070695_100169189 3300005545 Bacteria 1540
69 Ga0070695_100191925 3300005545 Bacteria 1454
70 Ga0070696_100007431 3300005546 Bacteria 7327
71 Ga0070696_100023509 3300005546 Bacteria 4190
72 Ga0070696_100048440 3300005546 Bacteria 2950
73 Ga0070696_100052025 3300005546 Bacteria 2849
74 Ga0070696_100307089 3300005546 Bacteria 1217
75 Ga0070704_100033035 3300005549 Bacteria 3496
76 Ga0070704_100042772 3300005549 Bacteria 3135
77 Ga0070664_100080171 3300005564 Bacteria 2811
78 Ga0068857_100048680 3300005577 Bacteria 3762
79 Ga0068854_100010671 3300005578 Bacteria 5962
80 Ga0068856_100003454 3300005614 Bacteria 15973
81 Ga0068859_100001234 3300005617 Bacteria 26131
82 Ga0068864_100019198 3300005618 Bacteria 5713
83 Ga0068866_10200758 3300005718 Bacteria 1191
84 Ga0068861_100220583 3300005719 Bacteria 1602
85 Ga0068870_10002700 3300005840 Bacteria 7438
86 Ga0068863_100063472 3300005841 Bacteria 3493
87 Ga0068860_100247162 3300005843 Bacteria 1736
88 Ga0068860_100503758 3300005843 Unclassified 1209
89 Ga0068862_100004901 3300005844 Bacteria 11277
90 Ga0068862_100021833 3300005844 Bacteria 5353
91 Ga0068862_100043895 3300005844 Bacteria 3812
92 Ga0068862_100101089 3300005844 Bacteria 2522
93 Ga0081455_10002400 3300005937 Bacteria 22363
94 Ga0081455_10003309 3300005937 Bacteria 18639
95 Ga0081455_10307050 3300005937 Bacteria 1135
96 Ga0081539_10000005 3300005985 Bacteria 549026
97 Ga0081539_10026494 3300005985 Bacteria 3698
98 Ga0070717_10270263 3300006028 Bacteria 1506
99 Ga0070716_100000986 3300006173 Bacteria 12412
100 Ga0070712_100002037 3300006175 Bacteria 12385
101 Ga0075428_100000924 3300006844 Bacteria 31024
102 Ga0075430_100027780 3300006846 Bacteria 4806
103 Ga0075430_100158549 3300006846 Bacteria 1884
104 Ga0075431_100002229 3300006847 Bacteria 18559
105 Ga0075431_100002299 3300006847 Bacteria 18354
106 Ga0075431_100004118 3300006847 Bacteria 14197
107 Ga0075431_100208563 3300006847 Unclassified 1997
108 Ga0075433_10017185 3300006852 Bacteria 5985
109 Ga0075433_10060159 3300006852 Bacteria 3326
110 Ga0075433_10068807 3300006852 Bacteria 3108
111 Ga0075434_100006567 3300006871 Bacteria 10667
112 Ga0075434_100074027 3300006871 Bacteria 3399
113 Ga0075434_100078916 3300006871 Bacteria 3288
114 Ga0075434_100097917 3300006871 Bacteria 2938
115 Ga0075434_100294870 3300006871 Bacteria 1641
116 Ga0075429_100047914 3300006880 Bacteria 3716
117 Ga0068865_100115580 3300006881 Bacteria 1986
118 Ga0075436_100011846 3300006914 Bacteria 5983
119 Ga0075436_100245004 3300006914 Bacteria 1275
120 Ga0097620_100001234 3300006931 Bacteria 26131
121 Ga0075435_100003875 3300007076 Bacteria 10211
122 Ga0075435_100125792 3300007076 Bacteria 2142
123 Ga0075435_100437986 3300007076 Bacteria 1126
124 Ga0075435_100547911 3300007076 Bacteria 1001
125 Ga0099794_10013375 3300007265 Bacteria 3571
126 Ga0099794_10091233 3300007265 Bacteria 1512
127 Ga0111539_10000087 3300009094 Bacteria 95344
128 Ga0105245_10923205 3300009098 Bacteria 915
129 Ga0114129_10000115 3300009147 Bacteria 80576
130 Ga0114129_10000416 3300009147 Bacteria 50401
131 Ga0114129_10002376 3300009147 Bacteria 26133
132 Ga0114129_10144394 3300009147 Bacteria 3260
133 Ga0114129_10249165 3300009147 Bacteria 2385
134 Ga0114129_10347007 3300009147 Bacteria 1967
135 Ga0105243_10218300 3300009148 Bacteria 1684
136 Ga0105241_10188071 3300009174 Bacteria 1717
137 Ga0105242_10186702 3300009176 Bacteria 1832
138 Ga0105237_10055199 3300009545 Bacteria 3979
139 Ga0157373_10031444 3300013100 Bacteria 3821
140 Ga0157371_10019585 3300013102 Bacteria 4986
141 Ga0157371_10158817 3300013102 Bacteria 1614
142 Ga0157369_10189133 3300013105 Bacteria 2163
143 Ga0157378_10377984 3300013297 Bacteria 1391
144 Ga0163162_10109744 3300013306 Bacteria 2856
145 Ga0163162_10364482 3300013306 Unclassified 1578
146 Ga0157372_10098430 3300013307 Bacteria 3337
147 Ga0157372_10121221 3300013307 Bacteria 3004
148 Ga0157375_10171231 3300013308 Bacteria 2319
149 Ga0157377_10398963 3300014745 Bacteria 936
150 Ga0157379_10076223 3300014968 Bacteria 3003
151 Ga0213875_10008888 3300021388 Bacteria 5122
152 Ga0207653_10000844 3300025885 Bacteria 10203
153 Ga0207653_10006393 3300025885 Unclassified 3675
154 Ga0207653_10022313 3300025885 Bacteria 2011
155 Ga0207642_10036902 3300025899 Bacteria 2102
156 Ga0207688_10025773 3300025901 Bacteria 3232
157 Ga0207647_10017024 3300025904 Bacteria 4949
158 Ga0207699_10030649 3300025906 Bacteria 3012
159 Ga0207645_10002372 3300025907 Bacteria 14853
160 Ga0207643_10010212 3300025908 Bacteria 5050
161 Ga0207684_10000115 3300025910 Bacteria 149762
162 Ga0207684_10001378 3300025910 Bacteria 26499
163 Ga0207684_10006212 3300025910 Bacteria 10907
164 Ga0207684_10124606 3300025910 Bacteria 2210
165 Ga0207684_10191694 3300025910 Bacteria 1763
166 Ga0207693_10002970 3300025915 Bacteria 14684
167 Ga0207663_10116975 3300025916 Bacteria 1818
168 Ga0207660_10040988 3300025917 Bacteria 3243
169 Ga0207660_10133893 3300025917 Bacteria 1889
170 Ga0207657_10000925 3300025919 Bacteria 31095
171 Ga0207652_10067995 3300025921 Bacteria 3090
172 Ga0207652_10648190 3300025921 Bacteria 945
173 Ga0207646_10002702 3300025922 Bacteria 20798
174 Ga0207646_10003851 3300025922 Bacteria 16662
175 Ga0207646_10011686 3300025922 Bacteria 8489
176 Ga0207646_10041654 3300025922 Bacteria 4127
177 Ga0207646_10440197 3300025922 Bacteria 1176
178 Ga0207694_10059727 3300025924 Bacteria 2966
179 Ga0207650_10026700 3300025925 Bacteria 4123
180 Ga0207700_10076660 3300025928 Bacteria 2595
181 Ga0207700_10106694 3300025928 Unclassified 2246
182 Ga0207664_10031666 3300025929 Bacteria 4048
183 Ga0207664_10042079 3300025929 Bacteria 3564
184 Ga0207706_10002645 3300025933 Bacteria 17452
185 Ga0207686_10025639 3300025934 Bacteria 3432
186 Ga0207709_10019121 3300025935 Bacteria 3845
187 Ga0207704_10514142 3300025938 Bacteria 967
188 Ga0207689_10003443 3300025942 Bacteria 14446
189 Ga0207689_10006404 3300025942 Bacteria 10416
190 Ga0207689_10014347 3300025942 Bacteria 6741
191 Ga0207679_10002932 3300025945 Bacteria 10558
192 Ga0207667_10004905 3300025949 Bacteria 16340
193 Ga0207651_10016784 3300025960 Bacteria 4303
194 Ga0207712_10114820 3300025961 Bacteria 2026
195 Ga0207640_10038611 3300025981 Bacteria 3015
196 Ga0207658_10077196 3300025986 Bacteria 2541
197 Ga0207677_10079534 3300026023 Bacteria 2345
198 Ga0207703_10494249 3300026035 Bacteria 1148
199 Ga0207639_10004103 3300026041 Bacteria 9822
200 Ga0207678_10003434 3300026067 Bacteria 14276
201 Ga0207708_10003749 3300026075 Bacteria 11198
202 Ga0207702_10000979 3300026078 Bacteria 29227
203 Ga0207641_10156609 3300026088 Bacteria 2067
204 Ga0207641_10215671 3300026088 Unclassified 1777
205 Ga0207648_10007367 3300026089 Bacteria 10835
206 Ga0207648_10146942 3300026089 Bacteria 2079
207 Ga0207674_10001080 3300026116 Bacteria 35457
208 Ga0207674_10002327 3300026116 Bacteria 24056
209 Ga0207674_10472006 3300026116 Bacteria 1213
210 Ga0207675_100017244 3300026118 Bacteria 6744
211 Ga0207675_100371424 3300026118 Bacteria 1405
212 Ga0209970_1000381 3300027614 Bacteria 7484
213 Ga0209983_1000225 3300027665 Bacteria 11309
214 Ga0209588_1045693 3300027671 Bacteria 1417
215 Ga0209971_1000003 3300027682 Bacteria 110664
216 Ga0209966_1000149 3300027695 Bacteria 29724
217 Ga0209998_10000004 3300027717 Bacteria 104862
218 Ga0207428_10000355 3300027907 Bacteria 59077
219 Ga0268265_10230840 3300028380 Unclassified 1626
220 Ga0268264_10024863 3300028381 Bacteria 4894
221 Ga0265338_10018935 3300028800 Bacteria 7338
222 Ga0316575_10006371 3300031665 Bacteria 4240
223 Ga0265314_10161942 3300031711 Bacteria 1360
224 Ga0373954_0170470 3300035118 Bacteria 1066
225 Ga0373960_0102073 3300035121 Bacteria 931
226 Ga0316574_0001615 3300035398 Bacteria 10820
227 Ga0373931_0221196 3300035691 Bacteria 1140
228 Ga0373937_0024404 3300036401 Bacteria 5454
229 Ga0373937_0287123 3300036401 Bacteria 1554
230 Ga0436364_0947350 3300037853 Unclassified 1524
231 Ga0436364_1098889 3300037853 Bacteria 40176
232 Ga0395901_0163562 3300038443 Bacteria 2337
233 Ga0436365_1402783 3300039437 Unclassified 1336
234 Ga0436363_1693612 3300039450 Bacteria 858
235 Ga0439448_0007884 3300042005 Bacteria 3098
236 Ga0439448_0028151 3300042005 Bacteria 1773
237 Ga0439455_0004374 3300042012 Bacteria 2796
238 Ga0439458_0043729 3300042157 Bacteria 1093
239 Ga0439459_0000501 3300042438 Bacteria 5144
240 Ga0439464_0003504 3300042439 Bacteria 3965
241 Ga0439460_0001038 3300042461 Bacteria 6453
242 Ga0451577_0011475 3300042876 Bacteria 8377
243 Ga0451577_0012361 3300042876 Bacteria 8015
244 Ga0451577_0047834 3300042876 Bacteria 3822
245 Ga0451577_0050957 3300042876 Bacteria 3695
246 Ga0451577_0107264 3300042876 Bacteria 2496
247 Ga0451577_0223083 3300042876 Bacteria 1704
248 Ga0453683_0182687 3300044673 Bacteria 1330
249 Ga0453684_0004984 3300044712 Bacteria 27007
250 Ga0453684_0014578 3300044712 Bacteria 12551
251 Ga0453684_0057801 3300044712 Bacteria 5015
252 Ga0453684_0089722 3300044712 Bacteria 3800
253 Ga0451576_0011758 3300045051 Bacteria 9912
254 Ga0451576_0024938 3300045051 Bacteria 6452
255 Ga0451576_0032818 3300045051 Bacteria 5521
256 Ga0451576_0058561 3300045051 Bacteria 4025
257 Ga0451576_0058671 3300045051 Bacteria 4020
258 Ga0451576_0122390 3300045051 Bacteria 2709
259 Ga0495592_0126432 3300046454 Unclassified 1793
260 Ga0495580_0253103 3300046472 Bacteria 1205
261 Ga0495662_0059379 3300046476 Unclassified 1847
262 Ga0495584_0096945 3300046491 Bacteria 1489
263 Ga0495594_0254584 3300046499 Bacteria 1000
264 Ga0495618_0094752 3300046514 Unclassified 1909
265 Ga0495640_0148901 3300046533 Bacteria 1505
266 Ga0495586_0077002 3300046535 Bacteria 1828
267 Ga0495634_0086127 3300046642 Unclassified 2047
268 Ga0495635_0243327 3300046663 Unclassified 1213
269 Ga0495599_0116291 3300046678 Unclassified 1664
270 Ga0496103_0070781 3300048906 Bacteria 2182
271 Ga0496112_0421415 3300048915 Bacteria 1274
272 Ga0501031_0071308 3300049568 Bacteria 2263
273 Ga0501033_0095474 3300049570 Bacteria 2173
274 Ga0501036_0024441 3300049572 Bacteria 5093
275 Ga0501036_0076453 3300049572 Bacteria 2832
276 Ga0501036_0278283 3300049572 Unclassified 1401
277 Ga0501037_0168153 3300049573 Unclassified 1560
278 Ga0501038_0028253 3300049574 Bacteria 4984
279 Ga0501038_0057140 3300049574 Bacteria 3351
280 Ga0501039_0026173 3300049575 Bacteria 4483
281 Ga0501039_0040411 3300049575 Bacteria 3601
282 Ga0501039_0215997 3300049575 Bacteria 1508
283 Ga0501040_0000907 3300049576 Bacteria 18589
284 Ga0501040_0004288 3300049576 Bacteria 9268
285 Ga0501040_0013677 3300049576 Bacteria 5337
286 Ga0501040_0108800 3300049576 Unclassified 1938
287 Ga0501041_0008773 3300049577 Bacteria 5949
288 Ga0501041_0141779 3300049577 Bacteria 1499
289 Ga0501042_0002333 3300049578 Bacteria 11618
290 Ga0501042_0029935 3300049578 Unclassified 3842
291 Ga0501043_0140556 3300049579 Bacteria 1891
292 Ga0501046_0000303 3300049580 Bacteria 49710
293 Ga0501046_0225706 3300049580 Bacteria 1385
294 Ga0501047_0039975 3300049581 Bacteria 4536
295 Ga0501047_0475706 3300049581 Bacteria 1077
296 Ga0501048_0003609 3300049582 Bacteria 11786
297 Ga0501048_0065331 3300049582 Bacteria 2573
298 Ga0501048_0075399 3300049582 Bacteria 2379
299 Ga0501068_0077173 3300049584 Bacteria 2040
300 Ga0501068_0267429 3300049584 Bacteria 1091
301 Ga0501070_0182134 3300049586 Bacteria 1729
302 Ga0501071_0277173 3300049587 Unclassified 1269
303 Ga0501071_0337599 3300049587 Bacteria 1145
304 Ga0501072_0095272 3300049588 Bacteria 2366
305 Ga0501074_0102939 3300049590 Bacteria 2044
306 Ga0501074_0194849 3300049590 Bacteria 1444
307 Ga0501075_0013082 3300049591 Bacteria 5915
308 Ga0501075_0028325 3300049591 Unclassified 4134
309 Ga0501075_0049366 3300049591 Bacteria 3163
310 Ga0501075_0100968 3300049591 Unclassified 2191
311 Ga0501075_0279732 3300049591 Bacteria 1271
312 Ga0501076_0008489 3300049592 Bacteria 7528
313 Ga0501076_0011536 3300049592 Bacteria 6588
314 Ga0501076_0079332 3300049592 Bacteria 2634
315 Ga0501076_0089924 3300049592 Bacteria 2469
316 Ga0501076_0128900 3300049592 Unclassified 2051
317 Ga0501076_0138808 3300049592 Bacteria 1974
318 Ga0501077_0010060 3300049593 Bacteria 5888
319 Ga0501077_0010962 3300049593 Bacteria 5650
320 Ga0501077_0030554 3300049593 Bacteria 3427
321 Ga0501077_0031591 3300049593 Bacteria 3370
322 Ga0501079_0000600 3300049741 Bacteria 23913
323 Ga0501079_0001407 3300049741 Bacteria 16936
324 Ga0501080_0010441 3300049742 Bacteria 8500
325 Ga0501080_0035689 3300049742 Bacteria 4641
326 Ga0501080_0624515 3300049742 Bacteria 955
327 Ga0501081_0001148 3300049743 Bacteria 16013
328 Ga0501081_0001998 3300049743 Bacteria 12723
329 Ga0501081_0014073 3300049743 Bacteria 5271
330 Ga0501081_0139411 3300049743 Bacteria 1737
331 Ga0501081_0197685 3300049743 Unclassified 1458
332 Ga0501081_0204622 3300049743 Unclassified 1432
333 Ga0501083_0046099 3300049744 Bacteria 2948
334 Ga0501045_0000939 3300049824 Bacteria 19048
335 Ga0501045_0006387 3300049824 Bacteria 8160
336 Ga0501045_0066469 3300049824 Bacteria 2647
337 nmdc:mga05p37_144663_c1 3300050507 Bacteria 2912
338 nmdc:mga05p37_223156_c1 3300050507 Bacteria 2273
339 nmdc:mga05p37_270855_c1 3300050507 Bacteria 2029
340 nmdc:mga05p37_30407_c1 3300050507 Bacteria 6590
341 nmdc:mga05p37_3396_c1 3300050507 Bacteria 18593
342 nmdc:mga05p37_89_c1 3300050507 Bacteria 81482
343 nmdc:mga09592_1406_c1 3300050508 Bacteria 19268
344 nmdc:mga09592_480892_c1 3300050508 Bacteria 1070
345 nmdc:mga0qj67_105174_c1 3300050509 Bacteria 2277
346 nmdc:mga06r32_25253_c1 3300050510 Bacteria 5526
347 nmdc:mga06r32_329075_c1 3300050510 Bacteria 1513
348 nmdc:mga06r32_555908_c1 3300050510 Bacteria 1121
349 nmdc:mga06r32_7782_c1 3300050510 Bacteria 9633
350 nmdc:mga06r32_8323_c1 3300050510 Bacteria 9335
351 nmdc:mga08y16_19058_c1 3300050511 Bacteria 7229
352 nmdc:mga0n895_101216_c1 3300050512 Bacteria 2891
353 nmdc:mga0n895_203_c2 3300050512 Bacteria 15863
354 nmdc:mga0n895_231690_c1 3300050512 Bacteria 1874
355 nmdc:mga0n895_27843_c1 3300050512 Bacteria 5371
356 nmdc:mga0n895_331883_c1 3300050512 Bacteria 1541
357 nmdc:mga0n895_334408_c1 3300050512 Bacteria 1534
358 nmdc:mga0n895_7461_c1 3300050512 Bacteria 9388
359 nmdc:mga0rr50_24587_c1 3300050513 Bacteria 4174
360 nmdc:mga0rr50_29965_c1 3300050513 Bacteria 3846
361 nmdc:mga0rr50_713_c1 3300050513 Bacteria 17882
362 nmdc:mga08x19_105303_c1 3300050514 Bacteria 1876
363 nmdc:mga08x19_187638_c1 3300050514 Bacteria 1414
364 nmdc:mga08x19_470_c1 3300050514 Bacteria 27216
365 nmdc:mga0a205_12965_c1 3300050515 Bacteria 7736
366 nmdc:mga0a205_15964_c1 3300050515 Bacteria 7026
367 nmdc:mga0a205_323497_c1 3300050515 Bacteria 1413
368 nmdc:mga0a205_4741_c1 3300050515 Bacteria 12217
369 nmdc:mga0a205_62662_c1 3300050515 Bacteria 3593
370 Ga0495601_0004890 3300053077 Bacteria 7776
371 Ga0495619_0004074 3300053085 Bacteria 9361
372 Ga0495619_0369015 3300053085 Bacteria 992
373 Ga0500583_0071743 3300053092 Bacteria 1657
374 Ga0500617_126602 3300053124 Unclassified 1046
375 Ga0500588_0066740 3300053146 Bacteria 1168
376 Ga0500619_000137 3300053154 Bacteria 18737
377 Ga0500656_004306 3300053732 Bacteria 1372
378 Ga0501084_0001294 3300054114 Bacteria 19708
379 Ga0501084_0012647 3300054114 Bacteria 6993
380 Ga0501084_0020035 3300054114 Bacteria 5576
381 Ga0501084_0142748 3300054114 Bacteria 2017
382 Ga0501084_0250443 3300054114 Unclassified 1495
383 Ga0501082_0000212 3300060353 Bacteria 50890
384 Ga0501082_0011746 3300060353 Bacteria 7528
385 Ga0501082_0016999 3300060353 Bacteria 6264
386 Ga0501082_0145857 3300060353 Bacteria 2054
387 Ga0530510_0037678 3300061734 Bacteria 3489
388 Ga0530510_0078903 3300061734 Archaea 2394
389 Ga0530510_0112070 3300061734 Unclassified 1999
390 Ga0530510_0253498 3300061734 Bacteria 1311
391 Ga0436365_1719879
392 Ga0070676_10008630
393 Ga0070670_100038651
394 Ga0068869_100003188
395 Ga0068869_100038952
396 Ga0068869_100077915
397 Ga0070680_100008096
398 Ga0070680_100032958
399 Ga0070682_100009912
400 Ga0068868_100101196
401 Ga0070691_10017920
402 Ga0070691_10019743
403 Ga0070691_10052496
404 Ga0070691_10095183
405 Ga0070661_100006770
406 Ga0070692_10057927
407 Ga0070671_100006499
408 Ga0070673_100024318
409 Ga0070659_100007243
410 Ga0070703_10006762
411 Ga0070709_10018310
412 Ga0070709_10074025
413 Ga0070714_100014234
414 Ga0070714_100039192
415 Ga0070713_100085568
416 Ga0070713_100095633
417 Ga0070701_10001385
418 Ga0070701_10107719
419 Ga0070705_100009285
420 Ga0070705_100156691
421 Ga0070700_100002805
422 Ga0070694_100001367
423 Ga0070694_100014255
424 Ga0070694_100017909
425 Ga0070694_100271657
426 Ga0070708_100005552
427 Ga0070708_100104421
428 Ga0070708_100230318
429 Ga0070663_100000680
430 Ga0070681_10215907
431 Ga0068867_100004638
432 Ga0070706_100083568
433 Ga0070706_100175284
434 Ga0070707_100133604
435 Ga0070707_100208004
436 Ga0070707_100215233
437 Ga0070707_100448519
438 Ga0070698_100001489
439 Ga0070698_100022175
440 Ga0070698_100030664
441 Ga0070698_100109411
442 Ga0070699_100009983
443 Ga0070699_100013628
444 Ga0070699_100079172
445 Ga0070699_100304686
446 Ga0070679_100657163
447 Ga0070684_100214016
448 Ga0070697_100011751
449 Ga0070697_100018172
450 Ga0070697_100025074
451 Ga0070697_100128648
452 Ga0070697_100163472
453 Ga0070697_100224120
454 Ga0070697_100362833
455 Ga0068853_100000697
456 Ga0070695_100003218
457 Ga0070695_100039188
458 Ga0070695_100169189
459 Ga0070695_100191925
460 Ga0070696_100007431
461 Ga0070696_100023509
462 Ga0070696_100048440
463 Ga0070696_100052025
464 Ga0070696_100307089
465 Ga0070704_100033035
466 Ga0070704_100042772
467 Ga0070664_100080171
468 Ga0068857_100048680
469 Ga0068854_100010671
470 Ga0068856_100003454
471 Ga0068859_100001234
472 Ga0068864_100019198
473 Ga0068866_10200758
474 Ga0068861_100220583
475 Ga0068870_10002700
476 Ga0068863_100063472
477 Ga0068860_100247162
478 Ga0068860_100503758
479 Ga0068862_100004901
480 Ga0068862_100021833
481 Ga0068862_100043895
482 Ga0068862_100101089
483 Ga0081455_10002400
484 Ga0081455_10003309
485 Ga0081455_10307050
486 Ga0081539_10000005
487 Ga0081539_10026494
488 Ga0070717_10270263
489 Ga0070716_100000986
490 Ga0070712_100002037
491 Ga0075428_100000924
492 Ga0075430_100027780
493 Ga0075430_100158549
494 Ga0075431_100002229
495 Ga0075431_100002299
496 Ga0075431_100004118
497 Ga0075431_100208563
498 Ga0075433_10017185
499 Ga0075433_10060159
500 Ga0075433_10068807
501 Ga0075434_100006567
502 Ga0075434_100074027
503 Ga0075434_100078916
504 Ga0075434_100097917
505 Ga0075434_100294870
506 Ga0075429_100047914
507 Ga0068865_100115580
508 Ga0075436_100011846
509 Ga0075436_100245004
510 Ga0097620_100001234
511 Ga0075435_100003875
512 Ga0075435_100125792
513 Ga0075435_100437986
514 Ga0075435_100547911
515 Ga0099794_10013375
516 Ga0099794_10091233
517 Ga0111539_10000087
518 Ga0105245_10923205
519 Ga0114129_10000115
520 Ga0114129_10000416
521 Ga0114129_10002376
522 Ga0114129_10144394
523 Ga0114129_10249165
524 Ga0114129_10347007
525 Ga0105243_10218300
526 Ga0105241_10188071
527 Ga0105242_10186702
528 Ga0105237_10055199
529 Ga0157373_10031444
530 Ga0157371_10019585
531 Ga0157371_10158817
532 Ga0157369_10189133
533 Ga0157378_10377984
534 Ga0163162_10109744
535 Ga0163162_10364482
536 Ga0157372_10098430
537 Ga0157372_10121221
538 Ga0157375_10171231
539 Ga0157377_10398963
540 Ga0157379_10076223
541 Ga0213875_10008888
542 Ga0207653_10000844
543 Ga0207653_10006393
544 Ga0207653_10022313
545 Ga0207642_10036902
546 Ga0207688_10025773
547 Ga0207647_10017024
548 Ga0207699_10030649
549 Ga0207645_10002372
550 Ga0207643_10010212
551 Ga0207684_10000115
552 Ga0207684_10001378
553 Ga0207684_10006212
554 Ga0207684_10124606
555 Ga0207684_10191694
556 Ga0207693_10002970
557 Ga0207663_10116975
558 Ga0207660_10040988
559 Ga0207660_10133893
560 Ga0207657_10000925
561 Ga0207652_10067995
562 Ga0207652_10648190
563 Ga0207646_10002702
564 Ga0207646_10003851
565 Ga0207646_10011686
566 Ga0207646_10041654
567 Ga0207646_10440197
568 Ga0207694_10059727
569 Ga0207650_10026700
570 Ga0207700_10076660
571 Ga0207700_10106694
572 Ga0207664_10031666
573 Ga0207664_10042079
574 Ga0207706_10002645
575 Ga0207686_10025639
576 Ga0207709_10019121
577 Ga0207704_10514142
578 Ga0207689_10003443
579 Ga0207689_10006404
580 Ga0207689_10014347
581 Ga0207679_10002932
582 Ga0207667_10004905
583 Ga0207651_10016784
584 Ga0207712_10114820
585 Ga0207640_10038611
586 Ga0207658_10077196
587 Ga0207677_10079534
588 Ga0207703_10494249
589 Ga0207639_10004103
590 Ga0207678_10003434
591 Ga0207708_10003749
592 Ga0207702_10000979
593 Ga0207641_10156609
594 Ga0207641_10215671
595 Ga0207648_10007367
596 Ga0207648_10146942
597 Ga0207674_10001080
598 Ga0207674_10002327
599 Ga0207674_10472006
600 Ga0207675_100017244
601 Ga0207675_100371424
602 Ga0209970_1000381
603 Ga0209983_1000225
604 Ga0209588_1045693
605 Ga0209971_1000003
606 Ga0209966_1000149
607 Ga0209998_10000004
608 Ga0207428_10000355
609 Ga0268265_10230840
610 Ga0268264_10024863
611 Ga0265338_10018935
612 Ga0316575_10006371
613 Ga0265314_10161942
614 Ga0373954_0170470
615 Ga0373960_0102073
616 Ga0316574_0001615
617 Ga0373931_0221196
618 Ga0373937_0024404
619 Ga0373937_0287123
620 Ga0436364_0947350
621 Ga0436364_1098889
622 Ga0395901_0163562
623 Ga0436365_1402783
624 Ga0436363_1693612
625 Ga0439448_0007884
626 Ga0439448_0028151
627 Ga0439455_0004374
628 Ga0439458_0043729
629 Ga0439459_0000501
630 Ga0439464_0003504
631 Ga0439460_0001038
632 Ga0451577_0011475
633 Ga0451577_0012361
634 Ga0451577_0047834
635 Ga0451577_0050957
636 Ga0451577_0107264
637 Ga0451577_0223083
638 Ga0453683_0182687
639 Ga0453684_0004984
640 Ga0453684_0014578
641 Ga0453684_0057801
642 Ga0453684_0089722
643 Ga0451576_0011758
644 Ga0451576_0024938
645 Ga0451576_0032818
646 Ga0451576_0058561
647 Ga0451576_0058671
648 Ga0451576_0122390
649 Ga0495592_0126432
650 Ga0495580_0253103
651 Ga0495662_0059379
652 Ga0495584_0096945
653 Ga0495594_0254584
654 Ga0495618_0094752
655 Ga0495640_0148901
656 Ga0495586_0077002
657 Ga0495634_0086127
658 Ga0495635_0243327
659 Ga0495599_0116291
660 Ga0496103_0070781
661 Ga0496112_0421415
662 Ga0501031_0071308
663 Ga0501033_0095474
664 Ga0501036_0024441
665 Ga0501036_0076453
666 Ga0501036_0278283
667 Ga0501037_0168153
668 Ga0501038_0028253
669 Ga0501038_0057140
670 Ga0501039_0026173
671 Ga0501039_0040411
672 Ga0501039_0215997
673 Ga0501040_0000907
674 Ga0501040_0004288
675 Ga0501040_0013677
676 Ga0501040_0108800
677 Ga0501041_0008773
678 Ga0501041_0141779
679 Ga0501042_0002333
680 Ga0501042_0029935
681 Ga0501043_0140556
682 Ga0501046_0000303
683 Ga0501046_0225706
684 Ga0501047_0039975
685 Ga0501047_0475706
686 Ga0501048_0003609
687 Ga0501048_0065331
688 Ga0501048_0075399
689 Ga0501068_0077173
690 Ga0501068_0267429
691 Ga0501070_0182134
692 Ga0501071_0277173
693 Ga0501071_0337599
694 Ga0501072_0095272
695 Ga0501074_0102939
696 Ga0501074_0194849
697 Ga0501075_0013082
698 Ga0501075_0028325
699 Ga0501075_0049366
700 Ga0501075_0100968
701 Ga0501075_0279732
702 Ga0501076_0008489
703 Ga0501076_0011536
704 Ga0501076_0079332
705 Ga0501076_0089924
706 Ga0501076_0128900
707 Ga0501076_0138808
708 Ga0501077_0010060
709 Ga0501077_0010962
710 Ga0501077_0030554
711 Ga0501077_0031591
712 Ga0501079_0000600
713 Ga0501079_0001407
714 Ga0501080_0010441
715 Ga0501080_0035689
716 Ga0501080_0624515
717 Ga0501081_0001148
718 Ga0501081_0001998
719 Ga0501081_0014073
720 Ga0501081_0139411
721 Ga0501081_0197685
722 Ga0501081_0204622
723 Ga0501083_0046099
724 Ga0501045_0000939
725 Ga0501045_0006387
726 Ga0501045_0066469
727 nmdc:mga05p37_144663_c1
728 nmdc:mga05p37_223156_c1
729 nmdc:mga05p37_270855_c1
730 nmdc:mga05p37_30407_c1
731 nmdc:mga05p37_3396_c1
732 nmdc:mga05p37_89_c1
733 nmdc:mga09592_1406_c1
734 nmdc:mga09592_480892_c1
735 nmdc:mga0qj67_105174_c1
736 nmdc:mga06r32_25253_c1
737 nmdc:mga06r32_329075_c1
738 nmdc:mga06r32_555908_c1
739 nmdc:mga06r32_7782_c1
740 nmdc:mga06r32_8323_c1
741 nmdc:mga08y16_19058_c1
742 nmdc:mga0n895_101216_c1
743 nmdc:mga0n895_203_c2
744 nmdc:mga0n895_231690_c1
745 nmdc:mga0n895_27843_c1
746 nmdc:mga0n895_331883_c1
747 nmdc:mga0n895_334408_c1
748 nmdc:mga0n895_7461_c1
749 nmdc:mga0rr50_24587_c1
750 nmdc:mga0rr50_29965_c1
751 nmdc:mga0rr50_713_c1
752 nmdc:mga08x19_105303_c1
753 nmdc:mga08x19_187638_c1
754 nmdc:mga08x19_470_c1
755 nmdc:mga0a205_12965_c1
756 nmdc:mga0a205_15964_c1
757 nmdc:mga0a205_323497_c1
758 nmdc:mga0a205_4741_c1
759 nmdc:mga0a205_62662_c1
760 Ga0495601_0004890
761 Ga0495619_0004074
762 Ga0495619_0369015
763 Ga0500583_0071743
764 Ga0500617_126602
765 Ga0500588_0066740
766 Ga0500619_000137
767 Ga0500656_004306
768 Ga0501084_0001294
769 Ga0501084_0012647
770 Ga0501084_0020035
771 Ga0501084_0142748
772 Ga0501084_0250443
773 Ga0501082_0000212
774 Ga0501082_0011746
775 Ga0501082_0016999
776 Ga0501082_0145857
777 Ga0530510_0037678
778 Ga0530510_0078903
779 Ga0530510_0112070
780 Ga0530510_0253498

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08242

Methyltransf_12

Methyltransferase domain

35

129

0.95

PF08241

Methyltransf_11

Methyltransferase domain

35

131

0.9

PF13649

Methyltransf_25

Methyltransferase domain

34

127

0.89

PF13847

Methyltransf_31

Methyltransferase domain

31

195

0.84

PF13489

Methyltransf_23

Methyltransferase domain

8

175

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p35-assembly1.cif.gz_A crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens 0.9114 10 259
2p35-assembly1.cif.gz_B crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens 0.9101 17 259
2p35-assembly1.cif.gz_A crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens 0.9044 10 259
2p35-assembly1.cif.gz_B crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens 0.903 17 259
4qtt-assembly2.cif.gz_D structure of s. cerevisiae bud23-trm112 complex involved in formation of m7g1575 on 18s rrna (apo-form) 0.8729 19 133
ID Description Score Start End Superfamily
2p35B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9611 17 259 3.40.50.150
2p35B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9497 17 259 3.40.50.150
af_K7KE15_1_124_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9063 26 133 3.40.50.150
af_Q8I3G1_737_866_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8598 34 104 3.40.50.150
af_Q55DF6_53_245_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8449 22 96 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2G2A269-F1-model_v4 Trans-aconitate 2-methyltransferase (EC 2.1.1.144) 0.9418 7 259 GO:0030798
GO:0032259
AF-I3B4Q0-F1-model_v4 deleted 0.9371 132 256
AF-A0A2G2A269-F1-model_v4 Trans-aconitate 2-methyltransferase (EC 2.1.1.144) 0.9273 7 259 GO:0030798
GO:0032259
AF-A0A1F2XF93-F1-model_v4 Methyltransferase domain-containing protein 0.9269 7 257 GO:0030798
GO:0032259
AF-A0A849PC59-F1-model_v4 deleted 0.9232 1 258

Map