F431717

General Info

Members Datasets Scaffolds Average Seq Length
390 217 780 77

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10028891|Ga0105242_100288913
Length 92
Sequence LHGYADVFSSLEIFKIMEWIPAVFVVFKALVLGTGMFFAIKWHYDQGTKGKENERRAVLRAGGKVAAVFVLALLGLGLVTFFLAGMLGLPLT

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
44 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
59 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
62 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
63 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
65 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
66 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
97 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
98 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
99 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
102 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
110 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
111 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
125 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
131 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
132 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
135 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
136 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
139 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
145 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
146 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
171 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
178 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
196 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
197 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
198 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
199 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
200 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
201 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
202 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
203 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
204 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
205 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
206 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
207 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
208 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
209 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
210 2721755523 Delftia sp. HK171 Isolate Unclassified
211 2791355260 Rhizobium sp. L9 Isolate Nodule
212 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
213 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
214 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
215 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
216 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
217 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.36
Metatranscriptomes 2.05
Isolates 3.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.95
Nodule 2.31
Rhizoplane 3.59
Rhizosphere 61.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10028891 3300009176 Bacteria 4418
2 SwRhRL2b_contig_2527581 2162886007 Bacteria 1744
3 JGI25155J39150_1000279 3300002704 Bacteria 18528
4 JGI25156J39149_1010687 3300002705 Bacteria 2137
5 JGI25154J39366_1000551 3300002738 Bacteria 18528
6 JGI25154J39366_1000987 3300002738 Bacteria 11522
7 JGI25157J39369_1018745 3300002741 Bacteria 833
8 JGI25152J39213_1010168 3300002773 Bacteria 2175
9 JGI25150J39212_1000850 3300002774 Bacteria 10187
10 JGI25151J46595_10001808 3300003187 Bacteria 13813
11 JGI25151J46595_10002842 3300003187 Bacteria 9972
12 JGI25151J46595_10098273 3300003187 Bacteria 795
13 JGI25153J46596_10001526 3300003215 Bacteria 13766
14 rootH1_10010743 3300003316 Bacteria 1881
15 rootL2_10002628 3300003322 Bacteria 9375
16 rootL2_10148347 3300003322 Bacteria 3069
17 rootH1_10120485 3300003323 Bacteria 2618
18 Ga0007417J51691_1030866 3300003544 Bacteria 588
19 Ga0007427J51700_121218 3300003559 Bacteria 580
20 Ga0007410J51695_1017855 3300003574 Bacteria 581
21 Ga0007409J51694_1013618 3300003575 Bacteria 1335
22 Ga0007416J51690_1047992 3300003577 Bacteria 1282
23 Ga0007429J51699_1059611 3300003579 Bacteria 743
24 Ga0007411J51799_125358 3300003611 Bacteria 554
25 Ga0032354_1093245 3300003693 Bacteria 560
26 Ga0055526_1074179 3300003771 Bacteria 681
27 Ga0055526_1086868 3300003771 Bacteria 598
28 Ga0055537_1000840 3300003773 Bacteria 14947
29 Ga0055537_1004028 3300003773 Bacteria 4322
30 Ga0055537_1016563 3300003773 Bacteria 1242
31 Ga0055524_1002258 3300003775 Bacteria 10074
32 Ga0055524_1013466 3300003775 Bacteria 3082
33 Ga0055524_1018157 3300003775 Bacteria 2451
34 Ga0055534_1000046 3300003784 Bacteria 98150
35 Ga0055528_1000782 3300003790 Bacteria 22131
36 Ga0055528_1001150 3300003790 Bacteria 17214
37 Ga0055540_1002083 3300003792 Bacteria 10996
38 Ga0065165_1040043 3300005262 Bacteria 1400
39 Ga0065704_10003509 3300005289 Bacteria 5234
40 Ga0070666_10403196 3300005335 Bacteria 983
41 Ga0070682_101426260 3300005337 Bacteria 593
42 Ga0070660_100231651 3300005339 Bacteria 1503
43 Ga0070668_100398935 3300005347 Bacteria 1174
44 Ga0070663_101409645 3300005455 Bacteria 617
45 Ga0070678_101942289 3300005456 Bacteria 556
46 Ga0068853_101228007 3300005539 Bacteria 724
47 Ga0070665_100676239 3300005548 Bacteria 1045
48 Ga0068855_100000220 3300005563 Bacteria 72936
49 Ga0068855_100013933 3300005563 Bacteria 9697
50 Ga0068855_100029634 3300005563 Bacteria 6541
51 Ga0068854_102007674 3300005578 Bacteria 533
52 Ga0068852_100041265 3300005616 Bacteria 3899
53 Ga0070717_10021632 3300006028 Bacteria 5072
54 Ga0068871_100692500 3300006358 Bacteria 933
55 Ga0079104_1000026 3300006946 Bacteria 216566
56 Ga0079104_1000312 3300006946 Bacteria 61208
57 Ga0079104_1009392 3300006946 Bacteria 3317
58 Ga0105251_10015687 3300009011 Bacteria 4128
59 Ga0105245_10928951 3300009098 Bacteria 912
60 Ga0105243_10004982 3300009148 Bacteria 10409
61 Ga0105243_10046418 3300009148 Bacteria 3417
62 Ga0105243_12659890 3300009148 Bacteria 540
63 Ga0105242_10113725 3300009176 Bacteria 2312
64 Ga0105237_10360041 3300009545 Bacteria 1459
65 Ga0105238_10102908 3300009551 Bacteria 2837
66 Ga0105147_112455 3300009982 Bacteria 722
67 Ga0105239_10622265 3300010375 Bacteria 1232
68 Ga0157371_11307744 3300013102 Bacteria 561
69 Ga0157370_10459707 3300013104 Bacteria 1170
70 Ga0157372_10692567 3300013307 Bacteria 1186
71 Ga0182008_10024539 3300014497 Bacteria 3068
72 Ga0182007_10010316 3300015262 Bacteria 3702
73 Ga0182007_10061501 3300015262 Bacteria 1231
74 Ga0213872_10145180 3300021361 Bacteria 1039
75 Ga0213876_10457247 3300021384 Bacteria 679
76 Ga0209435_100295 3300025206 Bacteria 12068
77 Ga0209672_107088 3300025228 Bacteria 1759
78 Ga0207425_1000048 3300025245 Bacteria 188748
79 Ga0207425_1000324 3300025245 Bacteria 34065
80 Ga0209646_1000007 3300025246 Bacteria 670994
81 Ga0209646_1000105 3300025246 Bacteria 163453
82 Ga0209026_1001827 3300025250 Bacteria 8733
83 Ga0209026_1003004 3300025250 Bacteria 5819
84 Ga0209026_1008271 3300025250 Bacteria 2195
85 Ga0209148_1000211 3300025254 Bacteria 102391
86 Ga0209759_1000569 3300025256 Bacteria 37040
87 Ga0209129_1000080 3300025258 Bacteria 186416
88 Ga0209129_1000339 3300025258 Bacteria 40301
89 Ga0209129_1001011 3300025258 Bacteria 16764
90 Ga0209565_1000003 3300025263 Bacteria 1099648
91 Ga0209565_1004118 3300025263 Bacteria 4526
92 Ga0209565_1014531 3300025263 Bacteria 1803
93 Ga0209673_1000003 3300025273 Bacteria 980859
94 Ga0209673_1000781 3300025273 Bacteria 42606
95 Ga0209673_1002495 3300025273 Bacteria 12674
96 Ga0209673_1017394 3300025273 Bacteria 2651
97 Ga0209673_1020412 3300025273 Bacteria 2347
98 Ga0209673_1047075 3300025273 Bacteria 1172
99 Ga0209673_1110498 3300025273 Bacteria 576
100 Ga0209675_1000003 3300025291 Bacteria 1003982
101 Ga0209676_1027610 3300025292 Bacteria 1784
102 Ga0209025_1000749 3300025294 Bacteria 54530
103 Ga0209025_1001302 3300025294 Bacteria 34065
104 Ga0209025_1010819 3300025294 Bacteria 6121
105 Ga0209564_1000614 3300025295 Bacteria 54746
106 Ga0209564_1011141 3300025295 Bacteria 4059
107 Ga0209564_1013471 3300025295 Bacteria 3469
108 Ga0209564_1016764 3300025295 Bacteria 2895
109 Ga0209758_1003599 3300025297 Bacteria 13864
110 Ga0209758_1050721 3300025297 Bacteria 1452
111 Ga0209758_1076755 3300025297 Bacteria 1027
112 Ga0209050_1000011 3300025298 Bacteria 914037
113 Ga0209256_1000029 3300025299 Bacteria 415922
114 Ga0209256_1001904 3300025299 Bacteria 19087
115 Ga0209256_1019073 3300025299 Bacteria 2199
116 Ga0209256_1023265 3300025299 Bacteria 1852
117 Ga0209256_1039514 3300025299 Bacteria 1213
118 Ga0209051_1001700 3300025303 Bacteria 17623
119 Ga0209051_1034876 3300025303 Bacteria 1879
120 Ga0209257_1000003 3300025304 Bacteria 1702593
121 Ga0209257_1011338 3300025304 Bacteria 4308
122 Ga0207656_10046616 3300025321 Bacteria 1860
123 Ga0207713_1075038 3300025735 Bacteria 1235
124 Ga0207705_10002801 3300025909 Bacteria 13336
125 Ga0207694_10132311 3300025924 Bacteria 2000
126 Ga0207687_10700735 3300025927 Bacteria 859
127 Ga0207686_10002803 3300025934 Bacteria 9429
128 Ga0207686_10253059 3300025934 Bacteria 1288
129 Ga0207709_10000079 3300025935 Bacteria 166220
130 Ga0207709_10017706 3300025935 Bacteria 3981
131 Ga0207667_10008329 3300025949 Bacteria 12330
132 Ga0207667_10043439 3300025949 Bacteria 4769
133 Ga0207683_12169272 3300026121 Bacteria 504
134 Ga0207698_10012397 3300026142 Bacteria 5576
135 Ga0209281_1000061 3300027111 Bacteria 293814
136 Ga0209281_1000067 3300027111 Bacteria 284517
137 Ga0307408_100005331 3300031548 Bacteria 8613
138 Ga0307408_100012247 3300031548 Bacteria 5678
139 Ga0395899_0057464 3300037312 Bacteria 2872
140 Ga0395899_0299402 3300037312 Bacteria 1089
141 Ga0395900_0125631 3300037418 Bacteria 2631
142 Ga0395900_0178273 3300037418 Bacteria 2161
143 Ga0395900_0910565 3300037418 Bacteria 802
144 Ga0395900_1573646 3300037418 Bacteria 569
145 Ga0395898_0429728 3300037466 Bacteria 1258
146 Ga0395898_0460845 3300037466 Bacteria 1210
147 Ga0395905_0003928 3300037471 Bacteria 15643
148 Ga0395905_0087480 3300037471 Bacteria 2921
149 Ga0395905_0092373 3300037471 Bacteria 2838
150 Ga0395905_0263655 3300037471 Bacteria 1608
151 Ga0395905_0674900 3300037471 Bacteria 936
152 Ga0395901_0382991 3300038443 Bacteria 1447
153 Ga0395901_1604430 3300038443 Bacteria 604
154 Ga0436365_1229389 3300039437 Bacteria 679
155 Ga0436361_0808852 3300039447 Bacteria 3251
156 Ga0439465_0021826 3300041413 Bacteria 2010
157 Ga0451795_1532441 3300041456 Bacteria 690
158 Ga0451802_0209547 3300041460 Bacteria 500
159 Ga0451849_0227555 3300041505 Bacteria 733
160 Ga0451853_1747843 3300041512 Bacteria 806
161 Ga0466982_0596418 3300044672 Bacteria 547
162 Ga0466965_0010196 3300044683 Bacteria 4376
163 Ga0466965_0778740 3300044683 Bacteria 552
164 Ga0466966_0013250 3300044684 Bacteria 5460
165 Ga0466966_0119539 3300044684 Bacteria 1619
166 Ga0466966_0206014 3300044684 Bacteria 1189
167 Ga0466966_0730304 3300044684 Bacteria 597
168 Ga0466961_0209986 3300044693 Bacteria 1202
169 Ga0466970_0519624 3300044765 Bacteria 686
170 Ga0466957_0000033 3300044842 Bacteria 50844
171 Ga0466959_0129617 3300045049 Bacteria 1788
172 Ga0466958_0105196 3300045836 Bacteria 1758
173 Ga0495617_003592 3300046452 Bacteria 5799
174 Ga0495627_113312 3300046453 Bacteria 769
175 Ga0495590_0000288 3300046457 Bacteria 27099
176 Ga0495590_0047731 3300046457 Bacteria 1494
177 Ga0495629_0046413 3300046459 Bacteria 3047
178 Ga0495638_0628160 3300046460 Bacteria 524
179 Ga0495651_0004428 3300046462 Bacteria 10762
180 Ga0495653_0016885 3300046463 Bacteria 5940
181 Ga0495653_0025600 3300046463 Bacteria 4737
182 Ga0495653_0412297 3300046463 Bacteria 856
183 Ga0495650_0147002 3300046471 Bacteria 849
184 Ga0495650_0282630 3300046471 Bacteria 558
185 Ga0495580_0233720 3300046472 Bacteria 1262
186 Ga0495582_0018303 3300046473 Bacteria 3832
187 Ga0495605_0105097 3300046474 Bacteria 1293
188 Ga0495664_0878582 3300046477 Bacteria 525
189 Ga0495584_0000440 3300046491 Bacteria 28616
190 Ga0495584_0020232 3300046491 Bacteria 3382
191 Ga0495584_0391148 3300046491 Bacteria 706
192 Ga0495584_0451979 3300046491 Bacteria 653
193 Ga0495584_0465455 3300046491 Bacteria 643
194 Ga0495585_0049781 3300046492 Bacteria 2325
195 Ga0495585_0399256 3300046492 Bacteria 662
196 Ga0495594_0476460 3300046499 Bacteria 709
197 Ga0495594_0603415 3300046499 Bacteria 622
198 Ga0495594_0815809 3300046499 Bacteria 525
199 Ga0495596_0008869 3300046500 Bacteria 4450
200 Ga0495596_0084874 3300046500 Bacteria 1229
201 Ga0495596_0196131 3300046500 Bacteria 785
202 Ga0495596_0242526 3300046500 Bacteria 699
203 Ga0495607_0092693 3300046501 Bacteria 1633
204 Ga0495607_0357774 3300046501 Bacteria 672
205 Ga0495583_0145250 3300046506 Bacteria 985
206 Ga0495606_0000024 3300046507 Bacteria 262080
207 Ga0495606_0000256 3300046507 Bacteria 93906
208 Ga0495606_0001698 3300046507 Bacteria 28439
209 Ga0495606_0011012 3300046507 Bacteria 7426
210 Ga0495606_0011782 3300046507 Bacteria 7086
211 Ga0495606_0027000 3300046507 Bacteria 4079
212 Ga0495606_0076007 3300046507 Bacteria 2100
213 Ga0495606_0224553 3300046507 Bacteria 1056
214 Ga0495606_0313297 3300046507 Bacteria 846
215 Ga0495610_0019919 3300046512 Bacteria 3739
216 Ga0495610_0034894 3300046512 Bacteria 2587
217 Ga0495630_0816987 3300046517 Bacteria 711
218 Ga0495631_0021324 3300046518 Bacteria 3017
219 Ga0495632_0002527 3300046519 Bacteria 13861
220 Ga0495632_0136564 3300046519 Bacteria 1139
221 Ga0495637_0013155 3300046520 Bacteria 3935
222 Ga0495643_0000127 3300046522 Bacteria 123390
223 Ga0495643_0006967 3300046522 Bacteria 7350
224 Ga0495643_0057539 3300046522 Bacteria 2071
225 Ga0495643_0108416 3300046522 Bacteria 1414
226 Ga0495648_0035069 3300046524 Bacteria 3256
227 Ga0495666_0001798 3300046526 Bacteria 10595
228 Ga0495666_0042051 3300046526 Bacteria 2210
229 Ga0495666_0088856 3300046526 Bacteria 1459
230 Ga0495642_0018792 3300046528 Bacteria 2706
231 Ga0495642_0060015 3300046528 Bacteria 1577
232 Ga0495642_0115200 3300046528 Bacteria 1151
233 Ga0495652_0021373 3300046529 Bacteria 5754
234 Ga0495654_0000258 3300046530 Bacteria 48532
235 Ga0495654_0025088 3300046530 Bacteria 3073
236 Ga0495665_0066601 3300046531 Bacteria 1900
237 Ga0495665_0209094 3300046531 Bacteria 1010
238 Ga0495640_0514036 3300046533 Bacteria 728
239 Ga0495586_0005435 3300046535 Bacteria 6812
240 Ga0495586_0135634 3300046535 Bacteria 1379
241 Ga0495587_0026468 3300046536 Bacteria 3537
242 Ga0495587_0183014 3300046536 Bacteria 1187
243 Ga0495587_0215193 3300046536 Bacteria 1084
244 Ga0495609_0050986 3300046538 Bacteria 1843
245 Ga0495609_0174572 3300046538 Bacteria 906
246 Ga0495609_0279082 3300046538 Bacteria 683
247 Ga0495621_0095198 3300046539 Bacteria 1127
248 Ga0495597_0010381 3300046542 Bacteria 4553
249 Ga0495622_0203113 3300046557 Bacteria 882
250 Ga0495633_0001177 3300046558 Bacteria 21028
251 Ga0495633_0036160 3300046558 Bacteria 2367
252 Ga0495633_0239806 3300046558 Bacteria 828
253 Ga0495656_0162560 3300046615 Bacteria 1086
254 Ga0495668_0000051 3300046616 Bacteria 214532
255 Ga0495668_0001160 3300046616 Bacteria 26953
256 Ga0495668_0004225 3300046616 Bacteria 10342
257 Ga0495668_0380141 3300046616 Bacteria 775
258 Ga0495634_0008818 3300046642 Bacteria 7479
259 Ga0495634_0387742 3300046642 Bacteria 832
260 Ga0495611_0004011 3300046648 Bacteria 6411
261 Ga0495611_0270799 3300046648 Bacteria 785
262 Ga0495611_0499101 3300046648 Bacteria 553
263 Ga0495625_0288610 3300046660 Bacteria 1053
264 Ga0495625_0875253 3300046660 Bacteria 517
265 Ga0495635_0662901 3300046663 Bacteria 678
266 Ga0495661_0012266 3300046665 Bacteria 5788
267 Ga0495661_0098025 3300046665 Bacteria 1655
268 Ga0495661_0208365 3300046665 Bacteria 1019
269 Ga0495588_0069521 3300046674 Bacteria 1830
270 Ga0495588_0085986 3300046674 Bacteria 1644
271 Ga0495588_0137171 3300046674 Bacteria 1291
272 Ga0495588_0180880 3300046674 Bacteria 1114
273 Ga0495588_0214500 3300046674 Bacteria 1016
274 Ga0495588_0227412 3300046674 Bacteria 984
275 Ga0495588_0764020 3300046674 Bacteria 505
276 Ga0495657_0123427 3300046675 Bacteria 1629
277 Ga0495623_0021569 3300046679 Bacteria 4159
278 Ga0495623_0112850 3300046679 Bacteria 1645
279 Ga0495670_0010520 3300046691 Bacteria 4546
280 Ga0495671_0044177 3300046692 Bacteria 2235
281 Ga0495671_0123622 3300046692 Bacteria 1262
282 Ga0495649_0003157 3300046694 Bacteria 11261
283 Ga0495649_0075116 3300046694 Bacteria 1810
284 Ga0495649_0123047 3300046694 Bacteria 1371
285 Ga0495589_0007326 3300046794 Bacteria 5780
286 Ga0495589_0041677 3300046794 Bacteria 2290
287 Ga0495589_0180638 3300046794 Bacteria 1001
288 Ga0495600_0048796 3300046809 Bacteria 2762
289 Ga0495600_0270158 3300046809 Bacteria 1079
290 Ga0495600_0464779 3300046809 Bacteria 781
291 Ga0495660_0000160 3300046810 Bacteria 73039
292 Ga0495660_0048309 3300046810 Bacteria 2327
293 Ga0495581_0096739 3300047315 Bacteria 1714
294 Ga0495604_0062803 3300047317 Bacteria 2836
295 Ga0495604_0077259 3300047317 Bacteria 2502
296 Ga0495604_0090943 3300047317 Bacteria 2265
297 Ga0495636_0006684 3300047318 Bacteria 4534
298 Ga0495636_0193011 3300047318 Bacteria 927
299 Ga0495674_0168602 3300047319 Bacteria 1828
300 Ga0495672_0180486 3300047320 Bacteria 1069
301 Ga0495680_0920550 3300047322 Bacteria 563
302 Ga0495683_0332204 3300047323 Bacteria 645
303 Ga0495687_055342 3300047443 Bacteria 1659
304 Ga0495687_093456 3300047443 Bacteria 1146
305 Ga0495675_0157017 3300047444 Bacteria 1402
306 Ga0495673_0000003 3300047469 Bacteria 1491337
307 Ga0495673_0014041 3300047469 Bacteria 4179
308 Ga0495686_0001293 3300047472 Bacteria 28223
309 Ga0495686_0004428 3300047472 Bacteria 11567
310 Ga0495686_0004730 3300047472 Bacteria 11022
311 Ga0495593_0032575 3300047673 Bacteria 2840
312 Ga0495593_0045212 3300047673 Bacteria 2351
313 Ga0495602_0001408 3300048088 Bacteria 23797
314 Ga0495602_0263160 3300048088 Bacteria 1278
315 Ga0495602_0304342 3300048088 Bacteria 1165
316 Ga0495614_0186754 3300048089 Bacteria 934
317 Ga0495614_0652646 3300048089 Bacteria 507
318 Ga0495626_0024222 3300048091 Bacteria 2978
319 Ga0495626_0251593 3300048091 Bacteria 708
320 Ga0496100_0844954 3300048903 Bacteria 718
321 Ga0496101_0087450 3300048904 Bacteria 2313
322 Ga0496101_0859025 3300048904 Bacteria 715
323 Ga0496103_0000716 3300048906 Bacteria 24534
324 Ga0496106_0481298 3300048909 Bacteria 997
325 Ga0496106_1192291 3300048909 Bacteria 594
326 Ga0496110_0666290 3300048913 Bacteria 941
327 Ga0496110_1189319 3300048913 Bacteria 671
328 Ga0496114_0317963 3300048917 Bacteria 1375
329 Ga0496114_1527256 3300048917 Bacteria 556
330 Ga0496116_0081121 3300048919 Bacteria 2012
331 Ga0496116_0135201 3300048919 Bacteria 1398
332 Ga0496116_0367778 3300048919 Bacteria 650
333 Ga0496117_0024427 3300048920 Bacteria 4782
334 Ga0496121_0042776 3300048924 Bacteria 3934
335 Ga0496121_0071722 3300048924 Bacteria 2784
336 Ga0496121_0079367 3300048924 Bacteria 2606
337 Ga0496121_0158628 3300048924 Bacteria 1657
338 Ga0496121_0200958 3300048924 Bacteria 1420
339 Ga0496121_0282856 3300048924 Bacteria 1133
340 Ga0496121_0391660 3300048924 Bacteria 913
341 Ga0496122_0000261 3300048925 Bacteria 118793
342 Ga0496122_0006661 3300048925 Bacteria 13165
343 Ga0496122_0012816 3300048925 Bacteria 8291
344 Ga0496122_0018629 3300048925 Bacteria 6397
345 Ga0496122_0057611 3300048925 Bacteria 2884
346 Ga0496122_0210356 3300048925 Bacteria 1127
347 Ga0496123_0000218 3300048926 Bacteria 116615
348 Ga0496123_0007957 3300048926 Bacteria 9835
349 Ga0496123_0015287 3300048926 Bacteria 6305
350 Ga0496123_0248428 3300048926 Bacteria 879
351 Ga0496123_0384071 3300048926 Bacteria 643
352 Ga0496123_0459987 3300048926 Bacteria 564
353 Ga0496124_0046883 3300048927 Bacteria 3699
354 Ga0496124_0085385 3300048927 Plasmid 2586
355 Ga0496124_0113087 3300048927 Bacteria 2182
356 Ga0496124_0150818 3300048927 Bacteria 1824
357 Ga0496125_0022759 3300048928 Bacteria 5808
358 Ga0496125_0046876 3300048928 Bacteria 3621
359 Ga0496125_0263984 3300048928 Bacteria 1077
360 Ga0496125_0527589 3300048928 Bacteria 659
361 Ga0496125_0533814 3300048928 Bacteria 653
362 Ga0496126_0046902 3300048929 Bacteria 3959
363 Ga0496126_0827346 3300048929 Bacteria 708
364 Ga0495678_015992 3300049459 Bacteria 3443
365 nmdc:mga07m45_56050_c1 3300050496 Bacteria 1569
366 Ga0500646_0102984 3300053090 Bacteria 899
367 Ga0500562_097171 3300053108 Bacteria 801
368 Ga0500572_269488 3300053111 Bacteria 552
369 Ga0500594_0000708 3300053118 Bacteria 7102
370 Ga0500618_000947 3300053125 Bacteria 14865
371 Ga0500573_0251947 3300053140 Bacteria 909
372 Ga0500586_164699 3300053145 Bacteria 749
373 Ga0500616_0007153 3300053153 Bacteria 7138
374 Ga0500622_0014849 3300053156 Bacteria 4175
375 Ga0500633_0006703 3300053160 Bacteria 2843
376 Ga0500636_0410777 3300053177 Bacteria 625
377 2511250741 2511231003 Bacteria 5606035
378 2599336223 2599185156 Bacteria 5403036
379 2599717833 2599185236 Bacteria 6875203
380 2644240736 2643221643 Bacteria 5749658
381 2722883031 2721755523 Bacteria 6430384
382 2793319989 2791355260 Bacteria 6598818
383 2839143824 2839138175 Bacteria 6549354
384 2919047301 2919046199 Bacteria 5567169
385 2919101883 2919100787 Bacteria 7710546
386 3005412160 3005409236 Bacteria 7188837
387 3005446000 3005445848 Bacteria 6906074
388 8024489166 8024486573 Bacteria 6540512
389 8024490023 8024486573 Bacteria 6540512
390 8024490486 8024486573 Bacteria 6540512
391 Ga0105242_10028891
392 SwRhRL2b_contig_2527581
393 JGI25155J39150_1000279
394 JGI25156J39149_1010687
395 JGI25154J39366_1000551
396 JGI25154J39366_1000987
397 JGI25157J39369_1018745
398 JGI25152J39213_1010168
399 JGI25150J39212_1000850
400 JGI25151J46595_10001808
401 JGI25151J46595_10002842
402 JGI25151J46595_10098273
403 JGI25153J46596_10001526
404 rootH1_10010743
405 rootL2_10002628
406 rootL2_10148347
407 rootH1_10120485
408 Ga0007417J51691_1030866
409 Ga0007427J51700_121218
410 Ga0007410J51695_1017855
411 Ga0007409J51694_1013618
412 Ga0007416J51690_1047992
413 Ga0007429J51699_1059611
414 Ga0007411J51799_125358
415 Ga0032354_1093245
416 Ga0055526_1074179
417 Ga0055526_1086868
418 Ga0055537_1000840
419 Ga0055537_1004028
420 Ga0055537_1016563
421 Ga0055524_1002258
422 Ga0055524_1013466
423 Ga0055524_1018157
424 Ga0055534_1000046
425 Ga0055528_1000782
426 Ga0055528_1001150
427 Ga0055540_1002083
428 Ga0065165_1040043
429 Ga0065704_10003509
430 Ga0070666_10403196
431 Ga0070682_101426260
432 Ga0070660_100231651
433 Ga0070668_100398935
434 Ga0070663_101409645
435 Ga0070678_101942289
436 Ga0068853_101228007
437 Ga0070665_100676239
438 Ga0068855_100000220
439 Ga0068855_100013933
440 Ga0068855_100029634
441 Ga0068854_102007674
442 Ga0068852_100041265
443 Ga0070717_10021632
444 Ga0068871_100692500
445 Ga0079104_1000026
446 Ga0079104_1000312
447 Ga0079104_1009392
448 Ga0105251_10015687
449 Ga0105245_10928951
450 Ga0105243_10004982
451 Ga0105243_10046418
452 Ga0105243_12659890
453 Ga0105242_10113725
454 Ga0105237_10360041
455 Ga0105238_10102908
456 Ga0105147_112455
457 Ga0105239_10622265
458 Ga0157371_11307744
459 Ga0157370_10459707
460 Ga0157372_10692567
461 Ga0182008_10024539
462 Ga0182007_10010316
463 Ga0182007_10061501
464 Ga0213872_10145180
465 Ga0213876_10457247
466 Ga0209435_100295
467 Ga0209672_107088
468 Ga0207425_1000048
469 Ga0207425_1000324
470 Ga0209646_1000007
471 Ga0209646_1000105
472 Ga0209026_1001827
473 Ga0209026_1003004
474 Ga0209026_1008271
475 Ga0209148_1000211
476 Ga0209759_1000569
477 Ga0209129_1000080
478 Ga0209129_1000339
479 Ga0209129_1001011
480 Ga0209565_1000003
481 Ga0209565_1004118
482 Ga0209565_1014531
483 Ga0209673_1000003
484 Ga0209673_1000781
485 Ga0209673_1002495
486 Ga0209673_1017394
487 Ga0209673_1020412
488 Ga0209673_1047075
489 Ga0209673_1110498
490 Ga0209675_1000003
491 Ga0209676_1027610
492 Ga0209025_1000749
493 Ga0209025_1001302
494 Ga0209025_1010819
495 Ga0209564_1000614
496 Ga0209564_1011141
497 Ga0209564_1013471
498 Ga0209564_1016764
499 Ga0209758_1003599
500 Ga0209758_1050721
501 Ga0209758_1076755
502 Ga0209050_1000011
503 Ga0209256_1000029
504 Ga0209256_1001904
505 Ga0209256_1019073
506 Ga0209256_1023265
507 Ga0209256_1039514
508 Ga0209051_1001700
509 Ga0209051_1034876
510 Ga0209257_1000003
511 Ga0209257_1011338
512 Ga0207656_10046616
513 Ga0207713_1075038
514 Ga0207705_10002801
515 Ga0207694_10132311
516 Ga0207687_10700735
517 Ga0207686_10002803
518 Ga0207686_10253059
519 Ga0207709_10000079
520 Ga0207709_10017706
521 Ga0207667_10008329
522 Ga0207667_10043439
523 Ga0207683_12169272
524 Ga0207698_10012397
525 Ga0209281_1000061
526 Ga0209281_1000067
527 Ga0307408_100005331
528 Ga0307408_100012247
529 Ga0395899_0057464
530 Ga0395899_0299402
531 Ga0395900_0125631
532 Ga0395900_0178273
533 Ga0395900_0910565
534 Ga0395900_1573646
535 Ga0395898_0429728
536 Ga0395898_0460845
537 Ga0395905_0003928
538 Ga0395905_0087480
539 Ga0395905_0092373
540 Ga0395905_0263655
541 Ga0395905_0674900
542 Ga0395901_0382991
543 Ga0395901_1604430
544 Ga0436365_1229389
545 Ga0436361_0808852
546 Ga0439465_0021826
547 Ga0451795_1532441
548 Ga0451802_0209547
549 Ga0451849_0227555
550 Ga0451853_1747843
551 Ga0466982_0596418
552 Ga0466965_0010196
553 Ga0466965_0778740
554 Ga0466966_0013250
555 Ga0466966_0119539
556 Ga0466966_0206014
557 Ga0466966_0730304
558 Ga0466961_0209986
559 Ga0466970_0519624
560 Ga0466957_0000033
561 Ga0466959_0129617
562 Ga0466958_0105196
563 Ga0495617_003592
564 Ga0495627_113312
565 Ga0495590_0000288
566 Ga0495590_0047731
567 Ga0495629_0046413
568 Ga0495638_0628160
569 Ga0495651_0004428
570 Ga0495653_0016885
571 Ga0495653_0025600
572 Ga0495653_0412297
573 Ga0495650_0147002
574 Ga0495650_0282630
575 Ga0495580_0233720
576 Ga0495582_0018303
577 Ga0495605_0105097
578 Ga0495664_0878582
579 Ga0495584_0000440
580 Ga0495584_0020232
581 Ga0495584_0391148
582 Ga0495584_0451979
583 Ga0495584_0465455
584 Ga0495585_0049781
585 Ga0495585_0399256
586 Ga0495594_0476460
587 Ga0495594_0603415
588 Ga0495594_0815809
589 Ga0495596_0008869
590 Ga0495596_0084874
591 Ga0495596_0196131
592 Ga0495596_0242526
593 Ga0495607_0092693
594 Ga0495607_0357774
595 Ga0495583_0145250
596 Ga0495606_0000024
597 Ga0495606_0000256
598 Ga0495606_0001698
599 Ga0495606_0011012
600 Ga0495606_0011782
601 Ga0495606_0027000
602 Ga0495606_0076007
603 Ga0495606_0224553
604 Ga0495606_0313297
605 Ga0495610_0019919
606 Ga0495610_0034894
607 Ga0495630_0816987
608 Ga0495631_0021324
609 Ga0495632_0002527
610 Ga0495632_0136564
611 Ga0495637_0013155
612 Ga0495643_0000127
613 Ga0495643_0006967
614 Ga0495643_0057539
615 Ga0495643_0108416
616 Ga0495648_0035069
617 Ga0495666_0001798
618 Ga0495666_0042051
619 Ga0495666_0088856
620 Ga0495642_0018792
621 Ga0495642_0060015
622 Ga0495642_0115200
623 Ga0495652_0021373
624 Ga0495654_0000258
625 Ga0495654_0025088
626 Ga0495665_0066601
627 Ga0495665_0209094
628 Ga0495640_0514036
629 Ga0495586_0005435
630 Ga0495586_0135634
631 Ga0495587_0026468
632 Ga0495587_0183014
633 Ga0495587_0215193
634 Ga0495609_0050986
635 Ga0495609_0174572
636 Ga0495609_0279082
637 Ga0495621_0095198
638 Ga0495597_0010381
639 Ga0495622_0203113
640 Ga0495633_0001177
641 Ga0495633_0036160
642 Ga0495633_0239806
643 Ga0495656_0162560
644 Ga0495668_0000051
645 Ga0495668_0001160
646 Ga0495668_0004225
647 Ga0495668_0380141
648 Ga0495634_0008818
649 Ga0495634_0387742
650 Ga0495611_0004011
651 Ga0495611_0270799
652 Ga0495611_0499101
653 Ga0495625_0288610
654 Ga0495625_0875253
655 Ga0495635_0662901
656 Ga0495661_0012266
657 Ga0495661_0098025
658 Ga0495661_0208365
659 Ga0495588_0069521
660 Ga0495588_0085986
661 Ga0495588_0137171
662 Ga0495588_0180880
663 Ga0495588_0214500
664 Ga0495588_0227412
665 Ga0495588_0764020
666 Ga0495657_0123427
667 Ga0495623_0021569
668 Ga0495623_0112850
669 Ga0495670_0010520
670 Ga0495671_0044177
671 Ga0495671_0123622
672 Ga0495649_0003157
673 Ga0495649_0075116
674 Ga0495649_0123047
675 Ga0495589_0007326
676 Ga0495589_0041677
677 Ga0495589_0180638
678 Ga0495600_0048796
679 Ga0495600_0270158
680 Ga0495600_0464779
681 Ga0495660_0000160
682 Ga0495660_0048309
683 Ga0495581_0096739
684 Ga0495604_0062803
685 Ga0495604_0077259
686 Ga0495604_0090943
687 Ga0495636_0006684
688 Ga0495636_0193011
689 Ga0495674_0168602
690 Ga0495672_0180486
691 Ga0495680_0920550
692 Ga0495683_0332204
693 Ga0495687_055342
694 Ga0495687_093456
695 Ga0495675_0157017
696 Ga0495673_0000003
697 Ga0495673_0014041
698 Ga0495686_0001293
699 Ga0495686_0004428
700 Ga0495686_0004730
701 Ga0495593_0032575
702 Ga0495593_0045212
703 Ga0495602_0001408
704 Ga0495602_0263160
705 Ga0495602_0304342
706 Ga0495614_0186754
707 Ga0495614_0652646
708 Ga0495626_0024222
709 Ga0495626_0251593
710 Ga0496100_0844954
711 Ga0496101_0087450
712 Ga0496101_0859025
713 Ga0496103_0000716
714 Ga0496106_0481298
715 Ga0496106_1192291
716 Ga0496110_0666290
717 Ga0496110_1189319
718 Ga0496114_0317963
719 Ga0496114_1527256
720 Ga0496116_0081121
721 Ga0496116_0135201
722 Ga0496116_0367778
723 Ga0496117_0024427
724 Ga0496121_0042776
725 Ga0496121_0071722
726 Ga0496121_0079367
727 Ga0496121_0158628
728 Ga0496121_0200958
729 Ga0496121_0282856
730 Ga0496121_0391660
731 Ga0496122_0000261
732 Ga0496122_0006661
733 Ga0496122_0012816
734 Ga0496122_0018629
735 Ga0496122_0057611
736 Ga0496122_0210356
737 Ga0496123_0000218
738 Ga0496123_0007957
739 Ga0496123_0015287
740 Ga0496123_0248428
741 Ga0496123_0384071
742 Ga0496123_0459987
743 Ga0496124_0046883
744 Ga0496124_0085385
745 Ga0496124_0113087
746 Ga0496124_0150818
747 Ga0496125_0022759
748 Ga0496125_0046876
749 Ga0496125_0263984
750 Ga0496125_0527589
751 Ga0496125_0533814
752 Ga0496126_0046902
753 Ga0496126_0827346
754 Ga0495678_015992
755 nmdc:mga07m45_56050_c1
756 Ga0500646_0102984
757 Ga0500562_097171
758 Ga0500572_269488
759 Ga0500594_0000708
760 Ga0500618_000947
761 Ga0500573_0251947
762 Ga0500586_164699
763 Ga0500616_0007153
764 Ga0500622_0014849
765 Ga0500633_0006703
766 Ga0500636_0410777
767 2511250741
768 2599336223
769 2599717833
770 2644240736
771 2722883031
772 2793319989
773 2839143824
774 2919047301
775 2919101883
776 3005412160
777 3005446000
778 8024489166
779 8024490023
780 8024490486

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map