F431617

General Info

Members Datasets Scaffolds Average Seq Length
390 282 351 195

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10079774|rootH1_100797742
Length 214
Sequence MTLANRIRHDHRPPAPSAQPDSGRFDAFAAAFTRLIDGGADEARIRRDGASLLADLVAHDDWLDTAHAAPDPQRYRQYLLHRDPRARYAVVSFVWGPGQGTPIHDHTVWGLIGVLRGAEDAQAYRFVARDRLVAAGPSIRLERGAVDAVSPSRLDIHRVRNAHDDRVSISIHVYGGDIGTIHRSIYTEQGERMPFVSGYSIPITPITAPASEPR

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
4 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
5 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
6 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
7 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
8 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
11 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
12 2643221640 Caulobacter sp. Root342 Isolate Unclassified
13 2643221642 Caulobacter sp. Root343 Isolate Unclassified
14 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
15 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
16 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
17 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
18 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
19 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
20 2818991435 Caulobacter henricii 536 Isolate Unclassified
21 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
22 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
23 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
24 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
25 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
26 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
27 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
28 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
29 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
30 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
31 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
32 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
33 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
34 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
35 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
36 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
37 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
38 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
39 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
40 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
41 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
42 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
43 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
44 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
45 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
46 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
47 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
48 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
49 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
50 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
51 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
52 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
53 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
54 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
55 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
56 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
57 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
58 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
59 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
97 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
100 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
101 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
102 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
143 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
144 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
145 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
146 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
147 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
154 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
167 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
168 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
176 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
198 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
199 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
216 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
219 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
224 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
258 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
259 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
260 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
261 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
262 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
263 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
264 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
265 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
266 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
267 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
268 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
269 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
270 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
271 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
272 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
273 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
274 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
275 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
276 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
280 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
281 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
282 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90
Metatranscriptomes 0
Isolates 10

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.67
Nodule 1.03
Rhizoplane 0.77
Rhizosphere 68.97
Stem 0
Stem Tuber 0
Unclassified 12.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010742 3300001979 Bacteria 3511
2 JGI24735J21928_10000061 3300002067 Bacteria 44792
3 JGI25157J39369_1016700 3300002741 Bacteria 896
4 JGI25164J39214_1009009 3300002772 Bacteria 987
5 JGI25165J46597_1001119 3300003214 Bacteria 16920
6 rootH1_10079774 3300003316 Bacteria 3409
7 rootL2_10022186 3300003322 Bacteria 2465
8 rootL2_10175648 3300003322 Bacteria 1672
9 rootL2_10229018 3300003322 Bacteria 1567
10 Ga0055538_1000057 3300003751 Bacteria 112934
11 Ga0055532_1000010 3300003758 Bacteria 392055
12 Ga0055527_1000008 3300003760 Bacteria 392055
13 Ga0055535_1000007 3300003761 Bacteria 392055
14 Ga0055542_1000011 3300003762 Bacteria 392055
15 Ga0055529_1000009 3300003763 Bacteria 392055
16 Ga0055529_1000068 3300003763 Bacteria 163911
17 Ga0055536_1000027 3300003781 Bacteria 164595
18 Ga0055530_10000066 3300003791 Bacteria 93405
19 Ga0055530_10000079 3300003791 Bacteria 83270
20 Ga0055540_1032166 3300003792 Bacteria 1199
21 Ga0055531_10006811 3300003794 Bacteria 6378
22 Ga0055531_10013286 3300003794 Bacteria 3806
23 Ga0065165_1001001 3300005262 Bacteria 34644
24 Ga0065704_10302042 3300005289 Bacteria 883
25 Ga0065712_10280450 3300005290 Bacteria 897
26 Ga0070658_10190386 3300005327 Bacteria 1729
27 Ga0070658_10593001 3300005327 Bacteria 960
28 Ga0070670_100547927 3300005331 Bacteria 1032
29 Ga0068868_100050748 3300005338 Bacteria 3259
30 Ga0070671_100071101 3300005355 Bacteria 2904
31 Ga0070671_100174015 3300005355 Bacteria 1821
32 Ga0070674_101083951 3300005356 Bacteria 707
33 Ga0070667_100777902 3300005367 Bacteria 888
34 Ga0070713_100185888 3300005436 Bacteria 1870
35 Ga0070663_100403591 3300005455 Bacteria 1118
36 Ga0070681_10198987 3300005458 Bacteria 1922
37 Ga0068853_100102068 3300005539 Bacteria 2538
38 Ga0068855_100009378 3300005563 Bacteria 11820
39 Ga0068855_100011788 3300005563 Bacteria 10570
40 Ga0068855_100030430 3300005563 Bacteria 6458
41 Ga0068855_100147512 3300005563 Bacteria 2677
42 Ga0068857_100460148 3300005577 Bacteria 1190
43 Ga0068856_100125516 3300005614 Bacteria 2569
44 Ga0068864_100017048 3300005618 Bacteria 6054
45 Ga0068863_100048230 3300005841 Bacteria 4039
46 Ga0068858_100094557 3300005842 Bacteria 2784
47 Ga0068860_100840993 3300005843 Bacteria 932
48 Ga0081455_10015969 3300005937 Bacteria 7267
49 Ga0075367_10010051 3300006178 Bacteria 4962
50 Ga0075367_10542925 3300006178 Bacteria 738
51 Ga0075369_10002376 3300006186 Bacteria 6712
52 Ga0075366_10003431 3300006195 Bacteria 8357
53 Ga0075366_10023970 3300006195 Bacteria 3557
54 Ga0075366_10038658 3300006195 Bacteria 2819
55 Ga0075370_10001002 3300006353 Bacteria 11672
56 Ga0075370_10018059 3300006353 Bacteria 3821
57 Ga0075370_10203275 3300006353 Bacteria 1169
58 Ga0105251_10316294 3300009011 Bacteria 709
59 Ga0105240_10000220 3300009093 Bacteria 115299
60 Ga0105240_10005115 3300009093 Bacteria 19632
61 Ga0111539_10009753 3300009094 Bacteria 12117
62 Ga0105245_10747907 3300009098 Bacteria 1013
63 Ga0105241_10051043 3300009174 Bacteria 3154
64 Ga0105237_10000099 3300009545 Bacteria 120098
65 Ga0105238_10039436 3300009551 Bacteria 4789
66 Ga0105238_10337081 3300009551 Bacteria 1496
67 Ga0105238_10502463 3300009551 Bacteria 1213
68 Ga0105239_10000111 3300010375 Bacteria 115283
69 Ga0105239_10443121 3300010375 Bacteria 1473
70 Ga0157371_10354567 3300013102 Bacteria 1068
71 Ga0157370_10018733 3300013104 Bacteria 6960
72 Ga0157369_10091024 3300013105 Bacteria 3257
73 Ga0163162_10100669 3300013306 Bacteria 2981
74 Ga0163162_10493111 3300013306 Bacteria 1356
75 Ga0157372_10031589 3300013307 Bacteria 5798
76 Ga0157372_11245740 3300013307 Bacteria 859
77 Ga0157380_10344837 3300014326 Bacteria 1391
78 Ga0182008_10373025 3300014497 Bacteria 761
79 Ga0157379_10235689 3300014968 Bacteria 1659
80 Ga0213872_10003406 3300021361 Bacteria 8843
81 Ga0213875_10019294 3300021388 Bacteria 3280
82 Ga0207427_101857 3300025231 Bacteria 6670
83 Ga0209437_103873 3300025233 Bacteria 2667
84 Ga0209026_1001729 3300025250 Bacteria 9096
85 Ga0209759_1014571 3300025256 Bacteria 2072
86 Ga0209233_1000061 3300025261 Bacteria 406211
87 Ga0209455_1000026 3300025272 Bacteria 653778
88 Ga0209676_1000087 3300025292 Bacteria 263734
89 Ga0209758_1001275 3300025297 Bacteria 31177
90 Ga0209050_1000038 3300025298 Bacteria 412635
91 Ga0209050_1000083 3300025298 Bacteria 263734
92 Ga0209256_1028661 3300025299 Bacteria 1567
93 Ga0209051_1001863 3300025303 Bacteria 16568
94 Ga0209257_1000350 3300025304 Bacteria 95008
95 Ga0209257_1001060 3300025304 Bacteria 36360
96 Ga0209257_1014897 3300025304 Bacteria 3290
97 Ga0207705_10504475 3300025909 Bacteria 940
98 Ga0207654_10014232 3300025911 Bacteria 4108
99 Ga0207707_10230646 3300025912 Bacteria 1611
100 Ga0207695_10000213 3300025913 Bacteria 155843
101 Ga0207695_10004235 3300025913 Bacteria 19709
102 Ga0207671_10000788 3300025914 Bacteria 40108
103 Ga0207694_10211047 3300025924 Bacteria 1581
104 Ga0207694_10281172 3300025924 Bacteria 1367
105 Ga0207650_10093097 3300025925 Bacteria 2306
106 Ga0207644_10090397 3300025931 Unclassified 2281
107 Ga0207689_10353654 3300025942 Bacteria 1221
108 Ga0207667_10002533 3300025949 Bacteria 22752
109 Ga0207667_10021099 3300025949 Bacteria 7224
110 Ga0207712_10776100 3300025961 Bacteria 841
111 Ga0207677_10003700 3300026023 Bacteria 8112
112 Ga0207677_10050413 3300026023 Bacteria 2816
113 Ga0207639_10059711 3300026041 Bacteria 2939
114 Ga0207678_10375451 3300026067 Bacteria 1229
115 Ga0207702_10221038 3300026078 Bacteria 1765
116 Ga0207641_10037047 3300026088 Bacteria 4072
117 Ga0207676_10012704 3300026095 Bacteria 6040
118 Ga0207676_10405054 3300026095 Bacteria 1276
119 Ga0207674_10426395 3300026116 Bacteria 1282
120 Ga0207675_100980557 3300026118 Bacteria 863
121 Ga0207428_10008660 3300027907 Bacteria 9186
122 Ga0268264_10070205 3300028381 Bacteria 2965
123 Ga0307515_10007367 3300028794 Bacteria 21771
124 Ga0237817_11246 3300030083 Bacteria 1368
125 Ga0307509_10238616 3300031507 Bacteria 1613
126 Ga0307408_100536994 3300031548 Bacteria 1030
127 Ga0307516_10433165 3300031730 Bacteria 972
128 Ga0307407_10538750 3300031903 Bacteria 861
129 Ga0307412_10000003 3300031911 Bacteria 659081
130 Ga0307412_10211097 3300031911 Bacteria 1481
131 Ga0307412_10497776 3300031911 Bacteria 1014
132 Ga0307416_100060515 3300032002 Bacteria 3085
133 Ga0307416_101232156 3300032002 Bacteria 854
134 Ga0307416_101669295 3300032002 Bacteria 742
135 Ga0436364_1037032 3300037853 Bacteria 3287
136 Ga0436365_0888895 3300039437 Bacteria 2854
137 Ga0436360_1062972 3300039438 Bacteria 1055
138 Ga0436361_0153257 3300039447 Bacteria 8251
139 Ga0439439_0053126 3300041406 Bacteria 1065
140 Ga0451793_1753175 3300041452 Bacteria 5063
141 Ga0451800_1228714 3300041459 Bacteria 752
142 Ga0451841_1165116 3300041498 Bacteria 1051
143 Ga0439441_059049 3300042001 Bacteria 804
144 Ga0439459_0032392 3300042438 Bacteria 1071
145 Ga0451577_0013199 3300042876 Bacteria 7741
146 Ga0451577_0691962 3300042876 Bacteria 924
147 Ga0453684_0435905 3300044712 Bacteria 1461
148 Ga0466968_0081369 3300044735 Bacteria 1423
149 Ga0495592_0002259 3300046454 Bacteria 13591
150 Ga0495592_0054100 3300046454 Bacteria 2975
151 Ga0495603_0001333 3300046455 Bacteria 14346
152 Ga0495590_0228790 3300046457 Bacteria 688
153 Ga0495591_000134 3300046458 Bacteria 80820
154 Ga0495629_0000054 3300046459 Bacteria 106374
155 Ga0495629_0004376 3300046459 Bacteria 10579
156 Ga0495629_0017812 3300046459 Bacteria 5091
157 Ga0495629_0098928 3300046459 Bacteria 2035
158 Ga0495638_0014015 3300046460 Bacteria 5434
159 Ga0495641_0010834 3300046461 Bacteria 5243
160 Ga0495651_0126083 3300046462 Bacteria 1875
161 Ga0495653_0000459 3300046463 Bacteria 31797
162 Ga0495653_0003641 3300046463 Bacteria 12431
163 Ga0495653_0527097 3300046463 Bacteria 733
164 Ga0495650_0000595 3300046471 Bacteria 49927
165 Ga0495650_0007925 3300046471 Bacteria 6298
166 Ga0495580_0000150 3300046472 Bacteria 50701
167 Ga0495580_0004465 3300046472 Bacteria 11753
168 Ga0495580_0154796 3300046472 Bacteria 1587
169 Ga0495580_0192497 3300046472 Bacteria 1406
170 Ga0495582_0000275 3300046473 Bacteria 28734
171 Ga0495582_0008495 3300046473 Bacteria 5665
172 Ga0495664_0002137 3300046477 Bacteria 10560
173 Ga0495664_0013852 3300046477 Bacteria 4572
174 Ga0495584_0279625 3300046491 Bacteria 848
175 Ga0495585_0160227 3300046492 Bacteria 1168
176 Ga0495594_0018055 3300046499 Bacteria 3735
177 Ga0495596_0073003 3300046500 Bacteria 1332
178 Ga0495596_0141832 3300046500 Bacteria 933
179 Ga0495583_0104566 3300046506 Bacteria 1205
180 Ga0495606_0018038 3300046507 Bacteria 5308
181 Ga0495606_0068124 3300046507 Bacteria 2252
182 Ga0495606_0075079 3300046507 Bacteria 2116
183 Ga0495606_0194465 3300046507 Bacteria 1160
184 Ga0495608_0007608 3300046511 Bacteria 7637
185 Ga0495618_0010123 3300046514 Bacteria 5701
186 Ga0495618_0025617 3300046514 Bacteria 3661
187 Ga0495620_0024768 3300046515 Bacteria 2849
188 Ga0495628_0003722 3300046516 Bacteria 13575
189 Ga0495628_0012503 3300046516 Bacteria 7154
190 Ga0495628_0354203 3300046516 Bacteria 1078
191 Ga0495630_0016973 3300046517 Bacteria 5327
192 Ga0495630_0249978 3300046517 Bacteria 1354
193 Ga0495631_0135585 3300046518 Bacteria 1057
194 Ga0495632_0000267 3300046519 Bacteria 52020
195 Ga0495643_0154427 3300046522 Bacteria 1134
196 Ga0495648_0002476 3300046524 Bacteria 16962
197 Ga0495648_0023016 3300046524 Bacteria 4275
198 Ga0495666_0001783 3300046526 Bacteria 10627
199 Ga0495666_0002435 3300046526 Bacteria 9247
200 Ga0495666_0003887 3300046526 Bacteria 7553
201 Ga0495642_0000306 3300046528 Bacteria 27260
202 Ga0495642_0096711 3300046528 Bacteria 1253
203 Ga0495652_0012104 3300046529 Bacteria 7793
204 Ga0495665_0001430 3300046531 Bacteria 12813
205 Ga0495665_0002268 3300046531 Bacteria 10414
206 Ga0495665_0013727 3300046531 Bacteria 4374
207 Ga0495665_0026626 3300046531 Bacteria 3106
208 Ga0495640_0000749 3300046533 Bacteria 24356
209 Ga0495586_0010165 3300046535 Bacteria 5009
210 Ga0495587_0002770 3300046536 Bacteria 11698
211 Ga0495597_0018169 3300046542 Bacteria 3302
212 Ga0495597_0248616 3300046542 Bacteria 699
213 Ga0495645_0001413 3300046543 Bacteria 16163
214 Ga0495645_0182446 3300046543 Bacteria 1437
215 Ga0495622_0000012 3300046557 Bacteria 189011
216 Ga0495633_0000621 3300046558 Bacteria 33553
217 Ga0495667_0187524 3300046559 Bacteria 1326
218 Ga0495656_0046538 3300046615 Bacteria 1836
219 Ga0495668_0000007 3300046616 Bacteria 552902
220 Ga0495668_0076845 3300046616 Bacteria 1833
221 Ga0495668_0094846 3300046616 Bacteria 1633
222 Ga0495668_0118349 3300046616 Bacteria 1449
223 Ga0495668_0233294 3300046616 Bacteria 1008
224 Ga0495634_0006970 3300046642 Bacteria 8529
225 Ga0495634_0207176 3300046642 Bacteria 1215
226 Ga0495611_0016404 3300046648 Bacteria 3166
227 Ga0495625_0149055 3300046660 Bacteria 1573
228 Ga0495625_0166924 3300046660 Bacteria 1471
229 Ga0495625_0386649 3300046660 Bacteria 877
230 Ga0495625_0412992 3300046660 Bacteria 841
231 Ga0495635_0005422 3300046663 Bacteria 8871
232 Ga0495659_0091414 3300046664 Bacteria 1169
233 Ga0495661_0003551 3300046665 Bacteria 11486
234 Ga0495588_0015188 3300046674 Bacteria 3700
235 Ga0495599_0004448 3300046678 Bacteria 8293
236 Ga0495623_0005452 3300046679 Bacteria 8313
237 Ga0495623_0048431 3300046679 Bacteria 2695
238 Ga0495646_0000743 3300046680 Bacteria 18130
239 Ga0495646_0006856 3300046680 Bacteria 7227
240 Ga0495646_0058033 3300046680 Bacteria 2314
241 Ga0495613_0010279 3300046689 Bacteria 6951
242 Ga0495613_0266374 3300046689 Bacteria 1192
243 Ga0495624_0004532 3300046690 Bacteria 10156
244 Ga0495624_0014977 3300046690 Bacteria 5251
245 Ga0495670_0209317 3300046691 Bacteria 1034
246 Ga0495600_0018655 3300046809 Bacteria 4422
247 Ga0495600_0230806 3300046809 Bacteria 1181
248 Ga0495660_0031715 3300046810 Bacteria 2971
249 Ga0495660_0193840 3300046810 Bacteria 974
250 Ga0495581_0002589 3300047315 Bacteria 10275
251 Ga0495581_0006396 3300047315 Bacteria 6834
252 Ga0495604_0001220 3300047317 Bacteria 21102
253 Ga0495604_0098858 3300047317 Bacteria 2148
254 Ga0495636_0013753 3300047318 Bacteria 3212
255 Ga0495674_0008602 3300047319 Bacteria 9713
256 Ga0495674_0036831 3300047319 Bacteria 4399
257 Ga0495674_0044088 3300047319 Bacteria 3966
258 Ga0495672_0074034 3300047320 Bacteria 1919
259 Ga0495672_0360321 3300047320 Bacteria 673
260 Ga0495676_0005430 3300047321 Bacteria 11693
261 Ga0495676_0130651 3300047321 Bacteria 1813
262 Ga0495676_0269977 3300047321 Bacteria 1154
263 Ga0495680_0006903 3300047322 Bacteria 10478
264 Ga0495683_0019135 3300047323 Bacteria 3534
265 Ga0495683_0038072 3300047323 Bacteria 2436
266 Ga0495683_0084678 3300047323 Bacteria 1542
267 Ga0495687_000642 3300047443 Bacteria 40071
268 Ga0495675_0561400 3300047444 Bacteria 650
269 Ga0495679_001330 3300047446 Bacteria 14314
270 Ga0495679_010297 3300047446 Bacteria 3678
271 Ga0495681_0028608 3300047470 Bacteria 2864
272 Ga0495681_0047298 3300047470 Bacteria 2047
273 Ga0495686_0223153 3300047472 Bacteria 1071
274 Ga0495593_0000988 3300047673 Bacteria 16703
275 Ga0495593_0003310 3300047673 Bacteria 9651
276 Ga0495593_0232416 3300047673 Bacteria 924
277 Ga0495602_0035266 3300048088 Bacteria 4666
278 Ga0495602_0047748 3300048088 Bacteria 3854
279 Ga0495602_0083295 3300048088 Bacteria 2680
280 Ga0495614_0003878 3300048089 Bacteria 6720
281 Ga0495614_0005101 3300048089 Bacteria 5926
282 Ga0495614_0330120 3300048089 Bacteria 708
283 Ga0495615_0073254 3300048090 Bacteria 927
284 Ga0496102_0106380 3300048905 Bacteria 2611
285 Ga0496118_0019933 3300048921 Bacteria 5969
286 Ga0496118_0031461 3300048921 Bacteria 4397
287 Ga0496121_0001819 3300048924 Bacteria 34405
288 Ga0496121_0066792 3300048924 Bacteria 2918
289 Ga0496121_0152059 3300048924 Bacteria 1702
290 Ga0496122_0136815 3300048925 Bacteria 1542
291 Ga0496124_0000004 3300048927 Bacteria 976131
292 Ga0496125_0005560 3300048928 Bacteria 13937
293 Ga0496125_0006394 3300048928 Bacteria 12766
294 Ga0496126_0002234 3300048929 Bacteria 26775
295 Ga0495678_001149 3300049459 Bacteria 21969
296 Ga0501031_0353638 3300049568 Bacteria 951
297 Ga0501036_0062375 3300049572 Bacteria 3157
298 Ga0501036_0316222 3300049572 Bacteria 1305
299 Ga0501039_0005189 3300049575 Bacteria 9863
300 Ga0501040_0055270 3300049576 Bacteria 2722
301 Ga0501041_0003354 3300049577 Bacteria 9216
302 Ga0501042_0014654 3300049578 Bacteria 5355
303 Ga0501046_0173407 3300049580 Bacteria 1617
304 Ga0501047_0046556 3300049581 Bacteria 4192
305 Ga0501048_0036205 3300049582 Bacteria 3548
306 Ga0501071_0012082 3300049587 Bacteria 5839
307 Ga0501072_0003605 3300049588 Bacteria 11649
308 Ga0501074_0829489 3300049590 Bacteria 651
309 Ga0501075_0001715 3300049591 Bacteria 14404
310 Ga0501075_0785791 3300049591 Bacteria 724
311 Ga0501076_0011627 3300049592 Bacteria 6565
312 Ga0501076_0407955 3300049592 Bacteria 1117
313 Ga0501077_0040802 3300049593 Bacteria 2955
314 Ga0501079_0006495 3300049741 Bacteria 8781
315 Ga0501080_0480588 3300049742 Bacteria 1111
316 Ga0501081_0039836 3300049743 Bacteria 3216
317 Ga0501263_014205 3300049760 Bacteria 1018
318 Ga0501035_0133820 3300049822 Bacteria 2160
319 Ga0501045_0001821 3300049824 Bacteria 14390
320 nmdc:mga0k408_17794_c1 3300050493 Bacteria 3961
321 nmdc:mga0k408_242107_c1 3300050493 Bacteria 1077
322 nmdc:mga07m45_14990_c1 3300050496 Bacteria 4138
323 nmdc:mga08y16_6170_c1 3300050511 Bacteria 12577
324 Ga0500635_0000020 3300053080 Bacteria 110196
325 Ga0500643_006689 3300053087 Bacteria 4773
326 Ga0500646_0020351 3300053090 Bacteria 1762
327 Ga0500647_0016779 3300053091 Bacteria 3370
328 Ga0500583_0097071 3300053092 Bacteria 1440
329 Ga0500651_0079655 3300053093 Bacteria 2029
330 Ga0500566_0141162 3300053094 Bacteria 1278
331 Ga0500572_006862 3300053111 Bacteria 2618
332 Ga0500608_000076 3300053122 Bacteria 42438
333 Ga0500628_047302 3300053129 Bacteria 1007
334 Ga0500652_000039 3300053131 Bacteria 68895
335 Ga0500652_001815 3300053131 Bacteria 6467
336 Ga0500655_006261 3300053133 Bacteria 2144
337 Ga0500559_0000439 3300053136 Bacteria 29528
338 Ga0500559_0002635 3300053136 Bacteria 9149
339 Ga0500622_0002773 3300053156 Bacteria 12324
340 Ga0500622_0017707 3300053156 Bacteria 3791
341 Ga0500622_0043612 3300053156 Bacteria 2326
342 Ga0500639_060106 3300053163 Bacteria 1960
343 Ga0500636_0032970 3300053177 Bacteria 3067
344 Ga0500637_0002671 3300053178 Bacteria 7993
345 Ga0500570_146104 3300053724 Bacteria 855
346 Ga0500576_041459 3300053725 Bacteria 2070
347 Ga0500584_109030 3300053726 Bacteria 1122
348 Ga0501084_0004919 3300054114 Bacteria 10916
349 Ga0501082_0004609 3300060353 Bacteria 12037
350 Ga0501082_0494870 3300060353 Bacteria 1069
351 Ga0530510_0002511 3300061734 Bacteria 12598

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046492 Ga0495585_0160227 Ga0495585_0160227_27_506 159
2 3300047444 Ga0495675_0561400 Ga0495675_0561400_22_510 160
3 3300039437 Ga0436365_0888895 Ga0436365_0888895_1083_1619 174
4 3300046500 Ga0495596_0073003 Ga0495596_0073003_145_729 175
5 3300047323 Ga0495683_0019135 Ga0495683_0019135_216_800 175
6 3300031911 Ga0307412_10497776 Ga0307412_104977761 176
7 3300046542 Ga0495597_0248616 Ga0495597_0248616_66_653 176
8 3300009094 Ga0111539_10009753 Ga0111539_100097533 179
9 3300027907 Ga0207428_10008660 Ga0207428_100086607 179
10 3300046458 Ga0495591_000134 Ga0495591_000134_28480_29070 179
11 3300046528 Ga0495642_0096711 Ga0495642_0096711_97_687 179
12 3300050511 nmdc:mga08y16_6170_c1 nmdc:mga08y16_6170_c1_7532_8083 179
13 iso_pu_bacteria 8048746797 8048748037 179
14 3300005327 Ga0070658_10593001 Ga0070658_105930011 180
15 3300005436 Ga0070713_100185888 Ga0070713_1001858882 180
16 3300005458 Ga0070681_10198987 Ga0070681_101989872 180
17 3300005539 Ga0068853_100102068 Ga0068853_1001020683 180
18 3300005563 Ga0068855_100009378 Ga0068855_1000093783 180
19 3300005563 Ga0068855_100030430 Ga0068855_1000304305 180
20 3300005614 Ga0068856_100125516 Ga0068856_1001255163 180
21 3300009093 Ga0105240_10005115 Ga0105240_1000511513 180
22 3300009174 Ga0105241_10051043 Ga0105241_100510433 180
23 3300009551 Ga0105238_10039436 Ga0105238_100394364 180
24 3300010375 Ga0105239_10443121 Ga0105239_104431212 180
25 3300013102 Ga0157371_10354567 Ga0157371_103545672 180
26 3300013104 Ga0157370_10018733 Ga0157370_100187338 180
27 3300013105 Ga0157369_10091024 Ga0157369_100910244 180
28 3300013307 Ga0157372_10031589 Ga0157372_100315894 180
29 3300013307 Ga0157372_11245740 Ga0157372_112457402 180
30 3300014968 Ga0157379_10235689 Ga0157379_102356892 180
31 3300025909 Ga0207705_10504475 Ga0207705_105044751 180
32 3300025911 Ga0207654_10014232 Ga0207654_100142324 180
33 3300025912 Ga0207707_10230646 Ga0207707_102306462 180
34 3300025913 Ga0207695_10004235 Ga0207695_100042358 180
35 3300025924 Ga0207694_10211047 Ga0207694_102110472 180
36 3300025949 Ga0207667_10002533 Ga0207667_1000253314 180
37 3300026041 Ga0207639_10059711 Ga0207639_100597112 180
38 3300026078 Ga0207702_10221038 Ga0207702_102210382 180
39 3300026118 Ga0207675_100980557 Ga0207675_1009805572 180
40 3300031903 Ga0307407_10538750 Ga0307407_105387502 180
41 3300032002 Ga0307416_101232156 Ga0307416_1012321562 180
42 3300041406 Ga0439439_0053126 Ga0439439_0053126_300_845 180
43 3300049572 Ga0501036_0316222 Ga0501036_0316222_407_1021 180
44 3300049581 Ga0501047_0046556 Ga0501047_0046556_965_1519 180
45 3300049590 Ga0501074_0829489 Ga0501074_0829489_26_580 180
46 3300049591 Ga0501075_0785791 Ga0501075_0785791_87_701 180
47 3300049592 Ga0501076_0407955 Ga0501076_0407955_350_964 180
48 3300060353 Ga0501082_0494870 Ga0501082_0494870_85_639 180
49 3300003322 rootL2_10022186 rootL2_100221862 181
50 3300003322 rootL2_10175648 rootL2_101756482 181
51 3300003763 Ga0055529_1000068 Ga0055529_10000682 181
52 3300005356 Ga0070674_101083951 Ga0070674_1010839511 181
53 3300014326 Ga0157380_10344837 Ga0157380_103448373 181
54 3300025233 Ga0209437_103873 Ga0209437_1038731 181
55 3300025272 Ga0209455_1000026 Ga0209455_1000026511 181
56 3300031507 Ga0307509_10238616 Ga0307509_102386162 181
57 3300042876 Ga0451577_0691962 Ga0451577_0691962_344_901 181
58 iso_pu_bacteria 2881927736 2881930454 181
59 3300005290 Ga0065712_10280450 Ga0065712_102804502 182
60 3300048921 Ga0496118_0019933 Ga0496118_0019933_350_958 182
61 3300005327 Ga0070658_10190386 Ga0070658_101903862 183
62 3300028794 Ga0307515_10007367 Ga0307515_1000736721 183
63 3300031548 Ga0307408_100536994 Ga0307408_1005369942 183
64 3300031911 Ga0307412_10211097 Ga0307412_102110972 183
65 3300032002 Ga0307416_100060515 Ga0307416_1000605154 183
66 3300046616 Ga0495668_0094846 Ga0495668_0094846_727_1341 183
67 3300049760 Ga0501263_014205 Ga0501263_014205_126_689 183
68 3300053094 Ga0500566_0141162 Ga0500566_0141162_398_952 183
69 3300005331 Ga0070670_100547927 Ga0070670_1005479272 184
70 3300046507 Ga0495606_0194465 Ga0495606_0194465_157_741 184
71 iso_pu_bacteria 2585428057 2587731008 184
72 iso_pu_bacteria 2585428058 2587735752 184
73 iso_pu_bacteria 2643221592 2643969139 184
74 iso_pu_bacteria 2643221625 2644141155 184
75 iso_pu_bacteria 2643221648 2644274442 184
76 3300026095 Ga0207676_10405054 Ga0207676_104050542 185
77 iso_pu_bacteria 2588253510 2588295891 185
78 3300005289 Ga0065704_10302042 Ga0065704_103020422 186
79 3300005367 Ga0070667_100777902 Ga0070667_1007779021 186
80 3300025925 Ga0207650_10093097 Ga0207650_100930972 186
81 3300032002 Ga0307416_101669295 Ga0307416_1016692951 186
82 3300047443 Ga0495687_000642 Ga0495687_000642_6844_7425 186
83 3300006353 Ga0075370_10203275 Ga0075370_102032752 187
84 iso_pu_bacteria 2844315083 2844322006 187
85 iso_pu_bacteria 2903727486 2903729920 187
86 iso_pu_bacteria 2906602504 2906603293 187
87 iso_pu_bacteria 3005594810 3005602398 187
88 iso_pu_bacteria 3005718088 3005725868 187
89 iso_pu_bacteria 8056967851 8056970214 187
90 3300005262 Ga0065165_1001001 Ga0065165_10010013 188
91 3300006178 Ga0075367_10010051 Ga0075367_100100517 188
92 3300006178 Ga0075367_10542925 Ga0075367_105429251 188
93 3300006195 Ga0075366_10003431 Ga0075366_100034314 188
94 3300006353 Ga0075370_10018059 Ga0075370_100180596 188
95 3300031730 Ga0307516_10433165 Ga0307516_104331651 188
96 3300041452 Ga0451793_1753175 Ga0451793_1753175_4072_4638 188
97 3300041459 Ga0451800_1228714 Ga0451800_1228714_100_666 188
98 3300041498 Ga0451841_1165116 Ga0451841_1165116_450_1016 188
99 3300046471 Ga0495650_0000595 Ga0495650_0000595_17428_18006 188
100 3300046522 Ga0495643_0154427 Ga0495643_0154427_496_1080 188
101 3300048924 Ga0496121_0001819 Ga0496121_0001819_19841_20407 188
102 3300050493 nmdc:mga0k408_17794_c1 nmdc:mga0k408_17794_c1_1105_1674 188
103 3300050493 nmdc:mga0k408_242107_c1 nmdc:mga0k408_242107_c1_138_704 188
104 3300050496 nmdc:mga07m45_14990_c1 nmdc:mga07m45_14990_c1_3160_3729 188
105 3300053090 Ga0500646_0020351 Ga0500646_0020351_918_1484 188
106 3300053093 Ga0500651_0079655 Ga0500651_0079655_794_1360 188
107 3300053129 Ga0500628_047302 Ga0500628_047302_274_840 188
108 3300053131 Ga0500652_000039 Ga0500652_000039_44255_44824 188
109 3300053131 Ga0500652_001815 Ga0500652_001815_747_1313 188
110 3300053133 Ga0500655_006261 Ga0500655_006261_813_1379 188
111 3300053156 Ga0500622_0002773 Ga0500622_0002773_808_1374 188
112 3300053177 Ga0500636_0032970 Ga0500636_0032970_1453_2022 188
113 3300053724 Ga0500570_146104 Ga0500570_146104_22_588 188
114 3300046506 Ga0495583_0104566 Ga0495583_0104566_442_1026 189
115 3300046616 Ga0495668_0000007 Ga0495668_0000007_155191_155775 189
116 3300053092 Ga0500583_0097071 Ga0500583_0097071_544_1113 189
117 3300053726 Ga0500584_109030 Ga0500584_109030_210_779 189
118 3300046518 Ga0495631_0135585 Ga0495631_0135585_260_847 190
119 3300046558 Ga0495633_0000621 Ga0495633_0000621_123_710 190
120 3300046660 Ga0495625_0412992 Ga0495625_0412992_93_680 190
121 3300046691 Ga0495670_0209317 Ga0495670_0209317_288_875 190
122 3300047470 Ga0495681_0047298 Ga0495681_0047298_920_1507 190
123 3300048924 Ga0496121_0066792 Ga0496121_0066792_196_783 190
124 3300048927 Ga0496124_0000004 Ga0496124_0000004_219012_219599 190
125 3300049568 Ga0501031_0353638 Ga0501031_0353638_38_652 190
126 3300049572 Ga0501036_0062375 Ga0501036_0062375_204_818 190
127 3300049575 Ga0501039_0005189 Ga0501039_0005189_654_1268 190
128 3300049576 Ga0501040_0055270 Ga0501040_0055270_1757_2371 190
129 3300049577 Ga0501041_0003354 Ga0501041_0003354_5021_5635 190
130 3300049578 Ga0501042_0014654 Ga0501042_0014654_513_1127 190
131 3300049580 Ga0501046_0173407 Ga0501046_0173407_725_1339 190
132 3300049582 Ga0501048_0036205 Ga0501048_0036205_144_758 190
133 3300049587 Ga0501071_0012082 Ga0501071_0012082_3858_4472 190
134 3300049588 Ga0501072_0003605 Ga0501072_0003605_9161_9775 190
135 3300049591 Ga0501075_0001715 Ga0501075_0001715_4343_4957 190
136 3300049592 Ga0501076_0011627 Ga0501076_0011627_3271_3885 190
137 3300049593 Ga0501077_0040802 Ga0501077_0040802_1483_2097 190
138 3300049741 Ga0501079_0006495 Ga0501079_0006495_4007_4621 190
139 3300049742 Ga0501080_0480588 Ga0501080_0480588_46_660 190
140 3300049743 Ga0501081_0039836 Ga0501081_0039836_2160_2774 190
141 3300049822 Ga0501035_0133820 Ga0501035_0133820_307_921 190
142 3300049824 Ga0501045_0001821 Ga0501045_0001821_2737_3351 190
143 3300054114 Ga0501084_0004919 Ga0501084_0004919_4264_4878 190
144 3300060353 Ga0501082_0004609 Ga0501082_0004609_2255_2869 190
145 3300061734 Ga0530510_0002511 Ga0530510_0002511_9264_9878 190
146 iso_pu_bacteria 2834641062 2834643709 190
147 iso_pu_bacteria 8003400568 8003405092 190
148 3300005563 Ga0068855_100011788 Ga0068855_1000117883 191
149 3300005937 Ga0081455_10015969 Ga0081455_100159691 191
150 3300021388 Ga0213875_10019294 Ga0213875_100192943 191
151 3300025949 Ga0207667_10021099 Ga0207667_100210995 191
152 3300037853 Ga0436364_1037032 Ga0436364_1037032_965_1576 191
153 3300042001 Ga0439441_059049 Ga0439441_059049_29_610 191
154 3300046507 Ga0495606_0018038 Ga0495606_0018038_2019_2606 191
155 3300047320 Ga0495672_0360321 Ga0495672_0360321_45_623 191
156 3300048924 Ga0496121_0152059 Ga0496121_0152059_900_1511 191
157 3300048928 Ga0496125_0005560 Ga0496125_0005560_1369_1950 191
158 3300006195 Ga0075366_10038658 Ga0075366_100386583 192
159 3300006353 Ga0075370_10001002 Ga0075370_100010029 192
160 3300009093 Ga0105240_10000220 Ga0105240_1000022085 192
161 3300009545 Ga0105237_10000099 Ga0105237_1000009927 192
162 3300009551 Ga0105238_10337081 Ga0105238_103370812 192
163 3300010375 Ga0105239_10000111 Ga0105239_1000011186 192
164 3300025913 Ga0207695_10000213 Ga0207695_1000021369 192
165 3300025914 Ga0207671_10000788 Ga0207671_1000078826 192
166 3300025924 Ga0207694_10281172 Ga0207694_102811722 192
167 3300025942 Ga0207689_10353654 Ga0207689_103536541 192
168 3300044735 Ga0466968_0081369 Ga0466968_0081369_602_1195 192
169 3300046459 Ga0495629_0098928 Ga0495629_0098928_160_741 192
170 3300046557 Ga0495622_0000012 Ga0495622_0000012_130116_130730 192
171 3300047319 Ga0495674_0036831 Ga0495674_0036831_272_853 192
172 3300039438 Ga0436360_1062972 Ga0436360_1062972_375_992 193
173 3300053087 Ga0500643_006689 Ga0500643_006689_121_705 193
174 iso_pu_bacteria 2643221552 2643782146 193
175 iso_pu_bacteria 2643221584 2643927776 193
176 iso_pu_bacteria 2818991435 2819538017 193
177 iso_pu_bacteria 2818991454 2819648422 193
178 3300046457 Ga0495590_0228790 Ga0495590_0228790_57_644 194
179 3300046472 Ga0495580_0154796 Ga0495580_0154796_770_1372 194
180 3300046499 Ga0495594_0018055 Ga0495594_0018055_1674_2276 194
181 3300046519 Ga0495632_0000267 Ga0495632_0000267_20587_21174 194
182 3300046526 Ga0495666_0003887 Ga0495666_0003887_4978_5580 194
183 3300046531 Ga0495665_0001430 Ga0495665_0001430_6370_6972 194
184 3300046664 Ga0495659_0091414 Ga0495659_0091414_149_736 194
185 3300046810 Ga0495660_0193840 Ga0495660_0193840_151_738 194
186 3300047317 Ga0495604_0098858 Ga0495604_0098858_651_1253 194
187 3300047318 Ga0495636_0013753 Ga0495636_0013753_1705_2307 194
188 3300049459 Ga0495678_001149 Ga0495678_001149_463_1050 194
189 3300053080 Ga0500635_0000020 Ga0500635_0000020_108496_109128 194
190 3300053091 Ga0500647_0016779 Ga0500647_0016779_2703_3335 194
191 3300053178 Ga0500637_0002671 Ga0500637_0002671_563_1195 194
192 iso_pu_bacteria 2501025502 2501079769 194
193 iso_pu_bacteria 2510917013 2511094107 194
194 iso_pu_bacteria 2585428106 2587918834 194
195 iso_pu_bacteria 2643221640 2644225479 194
196 iso_pu_bacteria 2643221642 2644232788 194
197 iso_pu_bacteria 2857357740 2857364596 194
198 iso_pu_bacteria 2857504554 2857507752 194
199 iso_pu_bacteria 2883087390 2883092834 194
200 iso_pu_bacteria 2928531327 2928533774 194
201 3300042876 Ga0451577_0013199 Ga0451577_0013199_1160_1747 195
202 3300046460 Ga0495638_0014015 Ga0495638_0014015_3113_3703 195
203 3300053111 Ga0500572_006862 Ga0500572_006862_152_742 195
204 3300053136 Ga0500559_0000439 Ga0500559_0000439_13119_13709 195
205 3300053163 Ga0500639_060106 Ga0500639_060106_875_1465 195
206 3300053725 Ga0500576_041459 Ga0500576_041459_1145_1735 195
207 3300003322 rootL2_10229018 rootL2_102290182 196
208 3300003781 Ga0055536_1000027 Ga0055536_100002752 196
209 3300003791 Ga0055530_10000079 Ga0055530_1000007952 196
210 3300003792 Ga0055540_1032166 Ga0055540_10321661 196
211 3300003794 Ga0055531_10006811 Ga0055531_100068115 196
212 3300006186 Ga0075369_10002376 Ga0075369_100023764 196
213 3300006195 Ga0075366_10023970 Ga0075366_100239703 196
214 3300025292 Ga0209676_1000087 Ga0209676_1000087170 196
215 3300025298 Ga0209050_1000083 Ga0209050_1000083170 196
216 3300025299 Ga0209256_1028661 Ga0209256_10286612 196
217 3300025303 Ga0209051_1001863 Ga0209051_100186310 196
218 3300025304 Ga0209257_1000350 Ga0209257_100035022 196
219 3300025304 Ga0209257_1014897 Ga0209257_10148972 196
220 3300042438 Ga0439459_0032392 Ga0439459_0032392_372_974 196
221 3300046542 Ga0495597_0018169 Ga0495597_0018169_675_1286 196
222 3300046616 Ga0495668_0076845 Ga0495668_0076845_888_1490 196
223 3300046660 Ga0495625_0149055 Ga0495625_0149055_527_1138 196
224 3300047472 Ga0495686_0223153 Ga0495686_0223153_260_871 196
225 3300048928 Ga0496125_0006394 Ga0496125_0006394_3935_4546 196
226 3300048929 Ga0496126_0002234 Ga0496126_0002234_6087_6698 196
227 3300053122 Ga0500608_000076 Ga0500608_000076_28599_29210 196
228 3300053136 Ga0500559_0002635 Ga0500559_0002635_905_1516 196
229 3300053156 Ga0500622_0017707 Ga0500622_0017707_296_907 196
230 3300053156 Ga0500622_0043612 Ga0500622_0043612_326_937 196
231 3300003316 rootH1_10079774 rootH1_100797742 197
232 3300005338 Ga0068868_100050748 Ga0068868_1000507483 197
233 3300005355 Ga0070671_100071101 Ga0070671_1000711013 197
234 3300005618 Ga0068864_100017048 Ga0068864_1000170484 197
235 3300005841 Ga0068863_100048230 Ga0068863_1000482303 197
236 3300005842 Ga0068858_100094557 Ga0068858_1000945572 197
237 3300005843 Ga0068860_100840993 Ga0068860_1008409932 197
238 3300009098 Ga0105245_10747907 Ga0105245_107479072 197
239 3300013306 Ga0163162_10100669 Ga0163162_101006693 197
240 3300025931 Ga0207644_10090397 Ga0207644_100903973 197
241 3300025961 Ga0207712_10776100 Ga0207712_107761002 197
242 3300026023 Ga0207677_10003700 Ga0207677_100037002 197
243 3300026023 Ga0207677_10050413 Ga0207677_100504132 197
244 3300026088 Ga0207641_10037047 Ga0207641_100370473 197
245 3300026095 Ga0207676_10012704 Ga0207676_100127044 197
246 3300026116 Ga0207674_10426395 Ga0207674_104263952 197
247 3300028381 Ga0268264_10070205 Ga0268264_100702052 197
248 3300046491 Ga0495584_0279625 Ga0495584_0279625_201_797 197
249 3300046507 Ga0495606_0068124 Ga0495606_0068124_382_978 197
250 3300046515 Ga0495620_0024768 Ga0495620_0024768_817_1413 197
251 3300046528 Ga0495642_0000306 Ga0495642_0000306_14302_14898 197
252 3300046615 Ga0495656_0046538 Ga0495656_0046538_918_1514 197
253 3300046616 Ga0495668_0233294 Ga0495668_0233294_328_924 197
254 3300046810 Ga0495660_0031715 Ga0495660_0031715_1506_2102 197
255 3300047323 Ga0495683_0084678 Ga0495683_0084678_273_869 197
256 3300047470 Ga0495681_0028608 Ga0495681_0028608_1948_2544 197
257 3300048925 Ga0496122_0136815 Ga0496122_0136815_813_1451 197
258 3300002741 JGI25157J39369_1016700 JGI25157J39369_10167001 198
259 3300003791 Ga0055530_10000066 Ga0055530_1000006677 198
260 3300003794 Ga0055531_10013286 Ga0055531_100132862 198
261 3300005355 Ga0070671_100174015 Ga0070671_1001740152 198
262 3300013306 Ga0163162_10493111 Ga0163162_104931112 198
263 3300025250 Ga0209026_1001729 Ga0209026_10017295 198
264 3300025297 Ga0209758_1001275 Ga0209758_100127517 198
265 3300025298 Ga0209050_1000038 Ga0209050_1000038305 198
266 3300025304 Ga0209257_1001060 Ga0209257_100106030 198
267 3300030083 Ga0237817_11246 Ga0237817_112462 198
268 3300046454 Ga0495592_0054100 Ga0495592_0054100_2131_2727 198
269 3300046455 Ga0495603_0001333 Ga0495603_0001333_10885_11481 198
270 3300046459 Ga0495629_0004376 Ga0495629_0004376_5992_6588 198
271 3300046461 Ga0495641_0010834 Ga0495641_0010834_980_1576 198
272 3300046463 Ga0495653_0003641 Ga0495653_0003641_5933_6529 198
273 3300046472 Ga0495580_0000150 Ga0495580_0000150_18036_18632 198
274 3300046472 Ga0495580_0192497 Ga0495580_0192497_291_887 198
275 3300046473 Ga0495582_0000275 Ga0495582_0000275_7905_8501 198
276 3300046477 Ga0495664_0002137 Ga0495664_0002137_5974_6570 198
277 3300046507 Ga0495606_0075079 Ga0495606_0075079_336_932 198
278 3300046514 Ga0495618_0025617 Ga0495618_0025617_1823_2419 198
279 3300046516 Ga0495628_0003722 Ga0495628_0003722_11284_11880 198
280 3300046517 Ga0495630_0016973 Ga0495630_0016973_445_1041 198
281 3300046524 Ga0495648_0002476 Ga0495648_0002476_5502_6098 198
282 3300046524 Ga0495648_0023016 Ga0495648_0023016_1392_1988 198
283 3300046526 Ga0495666_0001783 Ga0495666_0001783_7878_8474 198
284 3300046529 Ga0495652_0012104 Ga0495652_0012104_1696_2292 198
285 3300046531 Ga0495665_0002268 Ga0495665_0002268_2329_2925 198
286 3300046533 Ga0495640_0000749 Ga0495640_0000749_1257_1853 198
287 3300046535 Ga0495586_0010165 Ga0495586_0010165_2375_2971 198
288 3300046536 Ga0495587_0002770 Ga0495587_0002770_2852_3448 198
289 3300046543 Ga0495645_0001413 Ga0495645_0001413_2375_2971 198
290 3300046642 Ga0495634_0006970 Ga0495634_0006970_5336_5932 198
291 3300046648 Ga0495611_0016404 Ga0495611_0016404_1271_1867 198
292 3300046660 Ga0495625_0166924 Ga0495625_0166924_639_1235 198
293 3300046663 Ga0495635_0005422 Ga0495635_0005422_5901_6497 198
294 3300046665 Ga0495661_0003551 Ga0495661_0003551_1889_2485 198
295 3300046674 Ga0495588_0015188 Ga0495588_0015188_2614_3210 198
296 3300046678 Ga0495599_0004448 Ga0495599_0004448_2082_2678 198
297 3300046679 Ga0495623_0005452 Ga0495623_0005452_2105_2701 198
298 3300046680 Ga0495646_0000743 Ga0495646_0000743_6257_6853 198
299 3300046689 Ga0495613_0010279 Ga0495613_0010279_3758_4354 198
300 3300046690 Ga0495624_0014977 Ga0495624_0014977_4287_4883 198
301 3300046809 Ga0495600_0230806 Ga0495600_0230806_212_808 198
302 3300047315 Ga0495581_0002589 Ga0495581_0002589_7305_7901 198
303 3300047317 Ga0495604_0001220 Ga0495604_0001220_5658_6254 198
304 3300047319 Ga0495674_0008602 Ga0495674_0008602_8495_9091 198
305 3300047320 Ga0495672_0074034 Ga0495672_0074034_513_1109 198
306 3300047321 Ga0495676_0005430 Ga0495676_0005430_8494_9090 198
307 3300047322 Ga0495680_0006903 Ga0495680_0006903_5892_6488 198
308 3300047446 Ga0495679_001330 Ga0495679_001330_6779_7375 198
309 3300047446 Ga0495679_010297 Ga0495679_010297_1803_2399 198
310 3300047673 Ga0495593_0000988 Ga0495593_0000988_9495_10091 198
311 3300048088 Ga0495602_0035266 Ga0495602_0035266_1696_2292 198
312 3300048089 Ga0495614_0003878 Ga0495614_0003878_623_1219 198
313 3300048090 Ga0495615_0073254 Ga0495615_0073254_69_671 198
314 iso_pu_bacteria 2842454564 2842460616 198
315 iso_pu_bacteria 2848858292 2848863851 198
316 iso_pu_bacteria 2900634093 2900635391 198
317 iso_pu_bacteria 2919527303 2919533035 198
318 3300044712 Ga0453684_0435905 Ga0453684_0435905_500_1105 199
319 iso_pu_bacteria 2524023250 2524613144 199
320 3300003751 Ga0055538_1000057 Ga0055538_100005736 201
321 3300005563 Ga0068855_100147512 Ga0068855_1001475122 201
322 3300005577 Ga0068857_100460148 Ga0068857_1004601482 201
323 3300021361 Ga0213872_10003406 Ga0213872_100034068 201
324 3300039447 Ga0436361_0153257 Ga0436361_0153257_5378_6010 201
325 3300046616 Ga0495668_0118349 Ga0495668_0118349_104_730 201
326 iso_pu_bacteria 2738541296 2738821590 201
327 iso_pu_bacteria 2738541298 2738834072 201
328 iso_pu_bacteria 2738541306 2738875276 201
329 iso_pu_bacteria 2738543002 2739187229 201
330 iso_pu_bacteria 2738543008 2739221874 201
331 3300002772 JGI25164J39214_1009009 JGI25164J39214_10090092 202
332 3300003214 JGI25165J46597_1001119 JGI25165J46597_100111914 202
333 3300003758 Ga0055532_1000010 Ga0055532_100001073 202
334 3300003760 Ga0055527_1000008 Ga0055527_100000873 202
335 3300003761 Ga0055535_1000007 Ga0055535_100000773 202
336 3300003762 Ga0055542_1000011 Ga0055542_100001173 202
337 3300003763 Ga0055529_1000009 Ga0055529_100000973 202
338 3300009011 Ga0105251_10316294 Ga0105251_103162941 202
339 3300009551 Ga0105238_10502463 Ga0105238_105024632 202
340 3300014497 Ga0182008_10373025 Ga0182008_103730252 202
341 3300025231 Ga0207427_101857 Ga0207427_1018572 202
342 3300025261 Ga0209233_1000061 Ga0209233_1000061265 202
343 3300046454 Ga0495592_0002259 Ga0495592_0002259_7721_8329 202
344 3300046459 Ga0495629_0000054 Ga0495629_0000054_94567_95175 202
345 3300046459 Ga0495629_0017812 Ga0495629_0017812_377_985 202
346 3300046462 Ga0495651_0126083 Ga0495651_0126083_759_1367 202
347 3300046463 Ga0495653_0000459 Ga0495653_0000459_24419_25027 202
348 3300046463 Ga0495653_0527097 Ga0495653_0527097_33_641 202
349 3300046471 Ga0495650_0007925 Ga0495650_0007925_4177_4785 202
350 3300046472 Ga0495580_0004465 Ga0495580_0004465_4598_5206 202
351 3300046473 Ga0495582_0008495 Ga0495582_0008495_3302_3910 202
352 3300046477 Ga0495664_0013852 Ga0495664_0013852_1708_2316 202
353 3300046500 Ga0495596_0141832 Ga0495596_0141832_203_811 202
354 3300046511 Ga0495608_0007608 Ga0495608_0007608_1721_2329 202
355 3300046514 Ga0495618_0010123 Ga0495618_0010123_946_1554 202
356 3300046516 Ga0495628_0012503 Ga0495628_0012503_2707_3315 202
357 3300046516 Ga0495628_0354203 Ga0495628_0354203_378_986 202
358 3300046517 Ga0495630_0249978 Ga0495630_0249978_117_725 202
359 3300046526 Ga0495666_0002435 Ga0495666_0002435_7694_8302 202
360 3300046531 Ga0495665_0013727 Ga0495665_0013727_3650_4258 202
361 3300046531 Ga0495665_0026626 Ga0495665_0026626_1323_1931 202
362 3300046543 Ga0495645_0182446 Ga0495645_0182446_360_968 202
363 3300046559 Ga0495667_0187524 Ga0495667_0187524_528_1136 202
364 3300046642 Ga0495634_0207176 Ga0495634_0207176_21_629 202
365 3300046679 Ga0495623_0048431 Ga0495623_0048431_1995_2603 202
366 3300046680 Ga0495646_0006856 Ga0495646_0006856_1455_2063 202
367 3300046680 Ga0495646_0058033 Ga0495646_0058033_334_942 202
368 3300046689 Ga0495613_0266374 Ga0495613_0266374_104_712 202
369 3300046690 Ga0495624_0004532 Ga0495624_0004532_4894_5502 202
370 3300046809 Ga0495600_0018655 Ga0495600_0018655_3498_4106 202
371 3300047315 Ga0495581_0006396 Ga0495581_0006396_4420_5028 202
372 3300047319 Ga0495674_0044088 Ga0495674_0044088_772_1380 202
373 3300047321 Ga0495676_0130651 Ga0495676_0130651_347_955 202
374 3300047321 Ga0495676_0269977 Ga0495676_0269977_335_943 202
375 3300047323 Ga0495683_0038072 Ga0495683_0038072_1585_2193 202
376 3300047673 Ga0495593_0003310 Ga0495593_0003310_3392_4000 202
377 3300047673 Ga0495593_0232416 Ga0495593_0232416_200_808 202
378 3300048088 Ga0495602_0047748 Ga0495602_0047748_1531_2139 202
379 3300048088 Ga0495602_0083295 Ga0495602_0083295_1633_2241 202
380 3300048089 Ga0495614_0005101 Ga0495614_0005101_378_986 202
381 3300048089 Ga0495614_0330120 Ga0495614_0330120_43_651 202
382 3300048905 Ga0496102_0106380 Ga0496102_0106380_1250_1858 202
383 3300048921 Ga0496118_0031461 Ga0496118_0031461_1896_2504 202
384 3300001979 JGI24740J21852_10010742 JGI24740J21852_100107423 205
385 3300002067 JGI24735J21928_10000061 JGI24735J21928_1000006139 205
386 3300005455 Ga0070663_100403591 Ga0070663_1004035911 205
387 3300025256 Ga0209759_1014571 Ga0209759_10145712 205
388 3300026067 Ga0207678_10375451 Ga0207678_103754512 205
389 3300031911 Ga0307412_10000003 Ga0307412_10000003571 205
390 3300046660 Ga0495625_0386649 Ga0495625_0386649_97_714 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05995

CDO_I

Cysteine dioxygenase type I

49

187

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wvz-assembly2.cif.gz_B crystal structure of artificial crosslinked thiol dioxygenase g95c variant from pseudomonas aeruginosa 0.9844 7 200
4tlf-assembly2.cif.gz_B crystal structure of thiol dioxygenase from pseudomonas aeruginosa 0.9844 8 199
6xb9-assembly6.cif.gz_L crystal structure of azotobacter vinelandii 3-mercaptopropionic acid dioxygenase in complex with 3-hydroxypropionic acid 0.9836 8 197
4qma-assembly1.cif.gz_A crystal structure of a putative cysteine dioxygnase from ralstonia eutropha: an alternative modeling of 2gm6 from jcsg target 361076 0.9833 10 199
7kov-assembly1.cif.gz_B crystal structure of azotobacter vinelandii 3-mercaptopropionic acid dioxygenase in complex with thiocyanate 0.9821 7 200
ID Description Score Start End Superfamily
4qmaA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9775 49 191 2.60.120.10
4qmaA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9707 49 191 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9003 63 164 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8901 63 163 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8896 65 162 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A439Q943-F1-model_v4 Cysteine dioxygenase 0.9883 34 196 GO:0008198
GO:0016702
AF-A0A4Q1KH43-F1-model_v4 Cysteine dioxygenase 0.9879 7 196 GO:0008198
GO:0016702
AF-A0A1X7L978-F1-model_v4 Predicted metal-dependent enzyme of the double-stranded beta helix superfamily 0.9877 8 194 GO:0008198
GO:0016702
AF-A0A7S7ZG96-F1-model_v4 Cysteine dioxygenase 0.9874 10 196 GO:0008198
GO:0016702
AF-A0A806H4M4-F1-model_v4 deleted 0.9871 4 196

Feature Viewer

pLDDT pTM Quality
93.23 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map