F431594
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 389 | 284 | 351 | 378 |
Family's Representative Sequence
| Representative Sequence | 3300053142|Ga0500577_0000088|Ga0500577_0000088_18234_19505 |
| Length | 423 |
| Sequence | MVNEIRFRHVEESLKHLVEFARMTRRVRLYLVGSVVLVSLAGCGKGLFQTEEREPWRAEAEVACLKSGTVKEGADLVRINPISGPGVCGAEFPLKVAALGESGGSFGFADELRPPGSVGNAGNQPRWPVQPQPVARQAYPNSYPEAAPRQPQPGFGATSNGPISLNAPGVAPEEDDIELPPQPTYQAAPQAXXXPRAPYGRYSSGVQAAPPQDYAPQRMGPSQGSATGSVGPVALKPTATLACPIVSALDKWLAEAVQPAAVRWFGARVVEIKQISAYSCRGMNGNSRSHISEHAFGNALDIASFTLADGRKISVKDGWKGMPEEQGFLRDVQGAACQVFNTVLAPGSNVFHYDHIHVDLMRRSSRRIICQPAAVSGEQIAARAMPRSGYSGRDPSVTGSLGNRNGKPGRKAAYDDAADYKNE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 4 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 5 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 6 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 7 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 8 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 9 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 10 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 11 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 12 | 2791355199 | |||
| 13 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 14 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 15 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 16 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 17 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 18 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 19 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 20 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 21 | 2904699407 | |||
| 22 | 2906610324 | |||
| 23 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 24 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 25 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 26 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 27 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 28 | 2922425934 | |||
| 29 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 30 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 31 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 32 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 33 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 34 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 35 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 67 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 127 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 128 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 129 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 130 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 132 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 133 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 134 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 135 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 136 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 137 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 138 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 139 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 140 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 141 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 142 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 143 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 144 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 145 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 146 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 147 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 149 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 150 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 153 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 154 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 202 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 203 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 204 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 205 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 206 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 209 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 210 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 211 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 212 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 213 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 214 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 215 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 216 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 217 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 218 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 219 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 220 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 221 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 244 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 245 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 249 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 250 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 251 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 252 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 253 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 254 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 255 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 256 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 257 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 258 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 259 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 260 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 261 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 262 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 263 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 264 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 265 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 266 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 267 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 268 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 269 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 270 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 271 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 272 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 273 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 274 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 275 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 276 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 277 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 278 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 279 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 280 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 281 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 282 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 283 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 284 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.17 |
| Metatranscriptomes | 0 |
| Isolates | 8.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.11 |
| Nodule | 5.66 |
| Rhizoplane | 8.23 |
| Rhizosphere | 63.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000068 | 3300003203 | Bacteria | 47530 |
| 2 | JGI25406J46586_10000309 | 3300003203 | Bacteria | 21985 |
| 3 | JGI25153J46596_10037976 | 3300003215 | Bacteria | 1525 |
| 4 | Ga0070683_100281594 | 3300005329 | Bacteria | 1582 |
| 5 | Ga0070680_100169124 | 3300005336 | Bacteria | 1839 |
| 6 | Ga0068868_100049363 | 3300005338 | Bacteria | 3302 |
| 7 | Ga0068868_100058770 | 3300005338 | Bacteria | 3040 |
| 8 | Ga0070661_100046454 | 3300005344 | Bacteria | 3176 |
| 9 | Ga0070668_100006702 | 3300005347 | Bacteria | 8536 |
| 10 | Ga0070668_100064254 | 3300005347 | Bacteria | 2845 |
| 11 | Ga0070668_100243544 | 3300005347 | Bacteria | 1490 |
| 12 | Ga0070675_100040405 | 3300005354 | Bacteria | 3808 |
| 13 | Ga0070675_100187683 | 3300005354 | Bacteria | 1790 |
| 14 | Ga0070674_100005743 | 3300005356 | Bacteria | 7198 |
| 15 | Ga0070709_10010676 | 3300005434 | Bacteria | 5094 |
| 16 | Ga0070709_10026923 | 3300005434 | Bacteria | 3413 |
| 17 | Ga0070714_100050772 | 3300005435 | Bacteria | 3535 |
| 18 | Ga0070713_100062112 | 3300005436 | Bacteria | 3128 |
| 19 | Ga0070711_100015573 | 3300005439 | Bacteria | 4813 |
| 20 | Ga0070663_100011588 | 3300005455 | Bacteria | 5541 |
| 21 | Ga0070678_100062598 | 3300005456 | Bacteria | 2748 |
| 22 | Ga0070681_10028014 | 3300005458 | Bacteria | 5663 |
| 23 | Ga0070681_10192915 | 3300005458 | Bacteria | 1956 |
| 24 | Ga0070681_10241874 | 3300005458 | Bacteria | 1718 |
| 25 | Ga0070679_100010878 | 3300005530 | Bacteria | 8644 |
| 26 | Ga0068853_100165443 | 3300005539 | Bacteria | 1998 |
| 27 | Ga0070672_100055422 | 3300005543 | Bacteria | 3105 |
| 28 | Ga0070665_100074171 | 3300005548 | Bacteria | 3408 |
| 29 | Ga0070665_100167440 | 3300005548 | Bacteria | 2200 |
| 30 | Ga0068855_100008500 | 3300005563 | Bacteria | 12410 |
| 31 | Ga0068855_100127686 | 3300005563 | Bacteria | 2906 |
| 32 | Ga0068855_100131476 | 3300005563 | Bacteria | 2858 |
| 33 | Ga0070664_100083584 | 3300005564 | Bacteria | 2754 |
| 34 | Ga0068857_100073345 | 3300005577 | Bacteria | 3049 |
| 35 | Ga0068854_100209236 | 3300005578 | Bacteria | 1538 |
| 36 | Ga0068856_100000434 | 3300005614 | Bacteria | 45889 |
| 37 | Ga0068856_100044127 | 3300005614 | Bacteria | 4386 |
| 38 | Ga0068861_100013444 | 3300005719 | Bacteria | 5729 |
| 39 | Ga0068861_100260835 | 3300005719 | Bacteria | 1483 |
| 40 | Ga0068862_100063093 | 3300005844 | Bacteria | 3188 |
| 41 | Ga0068862_100063940 | 3300005844 | Bacteria | 3166 |
| 42 | Ga0081455_10008312 | 3300005937 | Bacteria | 10812 |
| 43 | Ga0081540_1009207 | 3300005983 | Bacteria | 6810 |
| 44 | Ga0081540_1062191 | 3300005983 | Bacteria | 1775 |
| 45 | Ga0081539_10000321 | 3300005985 | Bacteria | 106887 |
| 46 | Ga0081539_10055939 | 3300005985 | Bacteria | 2192 |
| 47 | Ga0070717_10020500 | 3300006028 | Bacteria | 5200 |
| 48 | Ga0075365_10029139 | 3300006038 | Bacteria | 3525 |
| 49 | Ga0075365_10051509 | 3300006038 | Bacteria | 2719 |
| 50 | Ga0075368_10047595 | 3300006042 | Bacteria | 1698 |
| 51 | Ga0075369_10049326 | 3300006186 | Bacteria | 1818 |
| 52 | Ga0075434_100056710 | 3300006871 | Bacteria | 3894 |
| 53 | Ga0068865_100114056 | 3300006881 | Bacteria | 1998 |
| 54 | Ga0099795_10003118 | 3300007788 | Bacteria | 4058 |
| 55 | Ga0099795_10007795 | 3300007788 | Bacteria | 3014 |
| 56 | Ga0105240_10054802 | 3300009093 | Bacteria | 4995 |
| 57 | Ga0105245_10027777 | 3300009098 | Bacteria | 4986 |
| 58 | Ga0105241_10015674 | 3300009174 | Bacteria | 5554 |
| 59 | Ga0105241_10072304 | 3300009174 | Bacteria | 2680 |
| 60 | Ga0105248_10024128 | 3300009177 | Bacteria | 6759 |
| 61 | Ga0105237_10027055 | 3300009545 | Bacteria | 5858 |
| 62 | Ga0105237_10144158 | 3300009545 | Bacteria | 2376 |
| 63 | Ga0105249_10113738 | 3300009553 | Bacteria | 2562 |
| 64 | Ga0099796_10050487 | 3300010159 | Bacteria | 1442 |
| 65 | Ga0105239_10059602 | 3300010375 | Bacteria | 4189 |
| 66 | Ga0105239_10069917 | 3300010375 | Bacteria | 3856 |
| 67 | Ga0105246_10012667 | 3300011119 | Bacteria | 5268 |
| 68 | Ga0157378_10002611 | 3300013297 | Bacteria | 16027 |
| 69 | Ga0163162_10109662 | 3300013306 | Bacteria | 2857 |
| 70 | Ga0157372_10048388 | 3300013307 | Bacteria | 4727 |
| 71 | Ga0157375_10038948 | 3300013308 | Bacteria | 4569 |
| 72 | Ga0163163_10099723 | 3300014325 | Bacteria | 2926 |
| 73 | Ga0157380_10093924 | 3300014326 | Bacteria | 2481 |
| 74 | Ga0157376_10098042 | 3300014969 | Bacteria | 2554 |
| 75 | Ga0157376_10219048 | 3300014969 | Bacteria | 1762 |
| 76 | Ga0163161_10015384 | 3300017792 | Bacteria | 5333 |
| 77 | Ga0209233_1006561 | 3300025261 | Bacteria | 3741 |
| 78 | Ga0209564_1000485 | 3300025295 | Bacteria | 66032 |
| 79 | Ga0209758_1002269 | 3300025297 | Bacteria | 19924 |
| 80 | Ga0207688_10036334 | 3300025901 | Bacteria | 2730 |
| 81 | Ga0207699_10010698 | 3300025906 | Bacteria | 4614 |
| 82 | Ga0207699_10025960 | 3300025906 | Bacteria | 3223 |
| 83 | Ga0207643_10067505 | 3300025908 | Bacteria | 2052 |
| 84 | Ga0207684_10164438 | 3300025910 | Bacteria | 1912 |
| 85 | Ga0207707_10000178 | 3300025912 | Bacteria | 66057 |
| 86 | Ga0207671_10021505 | 3300025914 | Bacteria | 4892 |
| 87 | Ga0207671_10131392 | 3300025914 | Bacteria | 1922 |
| 88 | Ga0207663_10000620 | 3300025916 | Bacteria | 15733 |
| 89 | Ga0207657_10002789 | 3300025919 | Bacteria | 18797 |
| 90 | Ga0207657_10110535 | 3300025919 | Bacteria | 2270 |
| 91 | Ga0207652_10010016 | 3300025921 | Bacteria | 7635 |
| 92 | Ga0207652_10035564 | 3300025921 | Bacteria | 4205 |
| 93 | Ga0207646_10093587 | 3300025922 | Bacteria | 2691 |
| 94 | Ga0207694_10096789 | 3300025924 | Bacteria | 2335 |
| 95 | Ga0207659_10138332 | 3300025926 | Bacteria | 1888 |
| 96 | Ga0207687_10012709 | 3300025927 | Bacteria | 5501 |
| 97 | Ga0207664_10076203 | 3300025929 | Bacteria | 2714 |
| 98 | Ga0207669_10006489 | 3300025937 | Bacteria | 5353 |
| 99 | Ga0207669_10172056 | 3300025937 | Bacteria | 1543 |
| 100 | Ga0207665_10013471 | 3300025939 | Bacteria | 5377 |
| 101 | Ga0207691_10055407 | 3300025940 | Bacteria | 3613 |
| 102 | Ga0207689_10025603 | 3300025942 | Bacteria | 4943 |
| 103 | Ga0207661_10010489 | 3300025944 | Bacteria | 6668 |
| 104 | Ga0207679_10032499 | 3300025945 | Bacteria | 3664 |
| 105 | Ga0207667_10021533 | 3300025949 | Bacteria | 7143 |
| 106 | Ga0207667_10170449 | 3300025949 | Bacteria | 2237 |
| 107 | Ga0207712_10009695 | 3300025961 | Bacteria | 6104 |
| 108 | Ga0207668_10020825 | 3300025972 | Bacteria | 4174 |
| 109 | Ga0207640_10119091 | 3300025981 | Bacteria | 1887 |
| 110 | Ga0207640_10184277 | 3300025981 | Bacteria | 1568 |
| 111 | Ga0207639_10195526 | 3300026041 | Bacteria | 1731 |
| 112 | Ga0207678_10016644 | 3300026067 | Bacteria | 6459 |
| 113 | Ga0207678_10036799 | 3300026067 | Bacteria | 4261 |
| 114 | Ga0207678_10041547 | 3300026067 | Bacteria | 3987 |
| 115 | Ga0207678_10047996 | 3300026067 | Bacteria | 3691 |
| 116 | Ga0207708_10034452 | 3300026075 | Bacteria | 3851 |
| 117 | Ga0207702_10000041 | 3300026078 | Bacteria | 150754 |
| 118 | Ga0207648_10058284 | 3300026089 | Bacteria | 3368 |
| 119 | Ga0207648_10201565 | 3300026089 | Bacteria | 1765 |
| 120 | Ga0207675_100015802 | 3300026118 | Bacteria | 7039 |
| 121 | Ga0207675_100030754 | 3300026118 | Bacteria | 5000 |
| 122 | Ga0207675_100197669 | 3300026118 | Bacteria | 1930 |
| 123 | Ga0207683_10018417 | 3300026121 | Bacteria | 5958 |
| 124 | Ga0207683_10030668 | 3300026121 | Bacteria | 4661 |
| 125 | Ga0207683_10267450 | 3300026121 | Bacteria | 1561 |
| 126 | Ga0209179_1000968 | 3300027512 | Bacteria | 3265 |
| 127 | Ga0209179_1013424 | 3300027512 | Bacteria | 1488 |
| 128 | Ga0209588_1014312 | 3300027671 | Bacteria | 2427 |
| 129 | Ga0268266_10019218 | 3300028379 | Bacteria | 5818 |
| 130 | Ga0268266_10021703 | 3300028379 | Bacteria | 5472 |
| 131 | Ga0268266_10049188 | 3300028379 | Bacteria | 3614 |
| 132 | Ga0268265_10154693 | 3300028380 | Bacteria | 1939 |
| 133 | Ga0268265_10217415 | 3300028380 | Bacteria | 1669 |
| 134 | Ga0307517_10003969 | 3300028786 | Bacteria | 22921 |
| 135 | Ga0307515_10102117 | 3300028794 | Bacteria | 3453 |
| 136 | Ga0307515_10182430 | 3300028794 | Bacteria | 2042 |
| 137 | Ga0307511_10120867 | 3300030521 | Bacteria | 1620 |
| 138 | Ga0265330_10012656 | 3300031235 | Bacteria | 3942 |
| 139 | Ga0265330_10023235 | 3300031235 | Bacteria | 2817 |
| 140 | Ga0265332_10008603 | 3300031238 | Bacteria | 4584 |
| 141 | Ga0265325_10003305 | 3300031241 | Bacteria | 10607 |
| 142 | Ga0265340_10049511 | 3300031247 | Bacteria | 2040 |
| 143 | Ga0265339_10000560 | 3300031249 | Bacteria | 29070 |
| 144 | Ga0307513_10151459 | 3300031456 | Bacteria | 2227 |
| 145 | Ga0307508_10082443 | 3300031616 | Bacteria | 2798 |
| 146 | Ga0265314_10006246 | 3300031711 | Bacteria | 10581 |
| 147 | Ga0265342_10020622 | 3300031712 | Bacteria | 4223 |
| 148 | Ga0307516_10006009 | 3300031730 | Bacteria | 14346 |
| 149 | Ga0307406_10094820 | 3300031901 | Bacteria | 2018 |
| 150 | Ga0307412_10048000 | 3300031911 | Bacteria | 2806 |
| 151 | Ga0307507_10108837 | 3300033179 | Bacteria | 2276 |
| 152 | Ga0315911_1000010 | 3300033442 | Bacteria | 322197 |
| 153 | Ga0373923_0008777 | 3300035111 | Bacteria | 3623 |
| 154 | Ga0373953_0004950 | 3300035117 | Bacteria | 4288 |
| 155 | Ga0373953_0010738 | 3300035117 | Bacteria | 3197 |
| 156 | Ga0373954_0018253 | 3300035118 | Bacteria | 3156 |
| 157 | Ga0373956_0005202 | 3300035119 | Bacteria | 5208 |
| 158 | Ga0373956_0009264 | 3300035119 | Bacteria | 4000 |
| 159 | Ga0373956_0042225 | 3300035119 | Bacteria | 2027 |
| 160 | Ga0373955_0017147 | 3300035172 | Bacteria | 3578 |
| 161 | Ga0373935_0130083 | 3300035692 | Bacteria | 1691 |
| 162 | Ga0373933_0011029 | 3300035724 | Bacteria | 4966 |
| 163 | Ga0373933_0021712 | 3300035724 | Bacteria | 3650 |
| 164 | Ga0373937_0001368 | 3300036401 | Bacteria | 20378 |
| 165 | Ga0373925_0021132 | 3300037068 | Bacteria | 4741 |
| 166 | Ga0395899_0007702 | 3300037312 | Bacteria | 8304 |
| 167 | Ga0395898_0028013 | 3300037466 | Bacteria | 5649 |
| 168 | Ga0495592_0034801 | 3300046454 | Bacteria | 3796 |
| 169 | Ga0495592_0064989 | 3300046454 | Bacteria | 2672 |
| 170 | Ga0495603_0063584 | 3300046455 | Bacteria | 2177 |
| 171 | Ga0495651_0008507 | 3300046462 | Bacteria | 7862 |
| 172 | Ga0495651_0032781 | 3300046462 | Bacteria | 4051 |
| 173 | Ga0495653_0007319 | 3300046463 | Bacteria | 9040 |
| 174 | Ga0495580_0020227 | 3300046472 | Bacteria | 4930 |
| 175 | Ga0495582_0005947 | 3300046473 | Bacteria | 6804 |
| 176 | Ga0495582_0083497 | 3300046473 | Bacteria | 1775 |
| 177 | Ga0495639_0022505 | 3300046475 | Bacteria | 2765 |
| 178 | Ga0495662_0023617 | 3300046476 | Bacteria | 2969 |
| 179 | Ga0495664_0020394 | 3300046477 | Bacteria | 3823 |
| 180 | Ga0495607_0026685 | 3300046501 | Bacteria | 3582 |
| 181 | Ga0495606_0000960 | 3300046507 | Bacteria | 42272 |
| 182 | Ga0495608_0026929 | 3300046511 | Bacteria | 3916 |
| 183 | Ga0495608_0061403 | 3300046511 | Bacteria | 2471 |
| 184 | Ga0495610_0048137 | 3300046512 | Bacteria | 2094 |
| 185 | Ga0495618_0051235 | 3300046514 | Bacteria | 2608 |
| 186 | Ga0495618_0076562 | 3300046514 | Bacteria | 2132 |
| 187 | Ga0495620_0016815 | 3300046515 | Bacteria | 3660 |
| 188 | Ga0495628_0029809 | 3300046516 | Bacteria | 4421 |
| 189 | Ga0495628_0066349 | 3300046516 | Bacteria | 2821 |
| 190 | Ga0495630_0068346 | 3300046517 | Bacteria | 2671 |
| 191 | Ga0495632_0060673 | 3300046519 | Bacteria | 1837 |
| 192 | Ga0495637_0037923 | 3300046520 | Bacteria | 2089 |
| 193 | Ga0495648_0002325 | 3300046524 | Bacteria | 17689 |
| 194 | Ga0495652_0009678 | 3300046529 | Bacteria | 8744 |
| 195 | Ga0495654_0054125 | 3300046530 | Bacteria | 1947 |
| 196 | Ga0495665_0025542 | 3300046531 | Bacteria | 3174 |
| 197 | Ga0495640_0021097 | 3300046533 | Bacteria | 4788 |
| 198 | Ga0495640_0024411 | 3300046533 | Bacteria | 4398 |
| 199 | Ga0495586_0082962 | 3300046535 | Bacteria | 1763 |
| 200 | Ga0495587_0008333 | 3300046536 | Bacteria | 6674 |
| 201 | Ga0495645_0048841 | 3300046543 | Bacteria | 3081 |
| 202 | Ga0495645_0128050 | 3300046543 | Bacteria | 1782 |
| 203 | Ga0495622_0014054 | 3300046557 | Bacteria | 3714 |
| 204 | Ga0495634_0005809 | 3300046642 | Bacteria | 9415 |
| 205 | Ga0495634_0014475 | 3300046642 | Bacteria | 5687 |
| 206 | Ga0495661_0012341 | 3300046665 | Bacteria | 5769 |
| 207 | Ga0495657_0001697 | 3300046675 | Bacteria | 18874 |
| 208 | Ga0495657_0028991 | 3300046675 | Bacteria | 3885 |
| 209 | Ga0495599_0010540 | 3300046678 | Bacteria | 5655 |
| 210 | Ga0495599_0040757 | 3300046678 | Bacteria | 2916 |
| 211 | Ga0495623_0001818 | 3300046679 | Bacteria | 14319 |
| 212 | Ga0495623_0008919 | 3300046679 | Bacteria | 6511 |
| 213 | Ga0495658_0006723 | 3300046683 | Bacteria | 5656 |
| 214 | Ga0495669_0008386 | 3300046684 | Bacteria | 4344 |
| 215 | Ga0495669_0050996 | 3300046684 | Bacteria | 1857 |
| 216 | Ga0495613_0067029 | 3300046689 | Bacteria | 2620 |
| 217 | Ga0495604_0003151 | 3300047317 | Bacteria | 13179 |
| 218 | Ga0495604_0018118 | 3300047317 | Bacteria | 5637 |
| 219 | Ga0495674_0007504 | 3300047319 | Bacteria | 10411 |
| 220 | Ga0495674_0013371 | 3300047319 | Bacteria | 7719 |
| 221 | Ga0495672_0050147 | 3300047320 | Bacteria | 2466 |
| 222 | Ga0495680_0008019 | 3300047322 | Bacteria | 9629 |
| 223 | Ga0495680_0017598 | 3300047322 | Bacteria | 6093 |
| 224 | Ga0495675_0012583 | 3300047444 | Bacteria | 5325 |
| 225 | Ga0495684_0004204 | 3300047471 | Bacteria | 11245 |
| 226 | Ga0495684_0024690 | 3300047471 | Bacteria | 4625 |
| 227 | Ga0495684_0031031 | 3300047471 | Bacteria | 4103 |
| 228 | Ga0495686_0010918 | 3300047472 | Bacteria | 6431 |
| 229 | Ga0495686_0059588 | 3300047472 | Bacteria | 2376 |
| 230 | Ga0495593_0006898 | 3300047673 | Bacteria | 6652 |
| 231 | Ga0495602_0046633 | 3300048088 | Bacteria | 3912 |
| 232 | Ga0496100_0004736 | 3300048903 | Bacteria | 7255 |
| 233 | Ga0496101_0003216 | 3300048904 | Bacteria | 10129 |
| 234 | Ga0496101_0061495 | 3300048904 | Bacteria | 2728 |
| 235 | Ga0496101_0085912 | 3300048904 | Bacteria | 2332 |
| 236 | Ga0496102_0032936 | 3300048905 | Bacteria | 4657 |
| 237 | Ga0496104_0032401 | 3300048907 | Bacteria | 4863 |
| 238 | Ga0496105_0073318 | 3300048908 | Bacteria | 2828 |
| 239 | Ga0496105_0140778 | 3300048908 | Bacteria | 1986 |
| 240 | Ga0496106_0002192 | 3300048909 | Bacteria | 14600 |
| 241 | Ga0496106_0005945 | 3300048909 | Bacteria | 9013 |
| 242 | Ga0496106_0064335 | 3300048909 | Bacteria | 2790 |
| 243 | Ga0496107_0058166 | 3300048910 | Bacteria | 2795 |
| 244 | Ga0496107_0079987 | 3300048910 | Bacteria | 2383 |
| 245 | Ga0496108_0009100 | 3300048911 | Bacteria | 8041 |
| 246 | Ga0496108_0108933 | 3300048911 | Bacteria | 2366 |
| 247 | Ga0496108_0463514 | 3300048911 | Bacteria | 1107 |
| 248 | Ga0496109_0000958 | 3300048912 | Bacteria | 23843 |
| 249 | Ga0496109_0055801 | 3300048912 | Bacteria | 3604 |
| 250 | Ga0496109_0061455 | 3300048912 | Bacteria | 3434 |
| 251 | Ga0496110_0024761 | 3300048913 | Bacteria | 5120 |
| 252 | Ga0496111_0033593 | 3300048914 | Bacteria | 3659 |
| 253 | Ga0496111_0059046 | 3300048914 | Bacteria | 2779 |
| 254 | Ga0496112_0000037 | 3300048915 | Bacteria | 96876 |
| 255 | Ga0496112_0037145 | 3300048915 | Bacteria | 4755 |
| 256 | Ga0496112_0059917 | 3300048915 | Bacteria | 3751 |
| 257 | Ga0496112_0071870 | 3300048915 | Bacteria | 3420 |
| 258 | Ga0496112_0109419 | 3300048915 | Bacteria | 2733 |
| 259 | Ga0496113_0037488 | 3300048916 | Bacteria | 3558 |
| 260 | Ga0496114_0045013 | 3300048917 | Bacteria | 3664 |
| 261 | Ga0496115_0217714 | 3300048918 | Bacteria | 1576 |
| 262 | Ga0496117_0081400 | 3300048920 | Bacteria | 2125 |
| 263 | Ga0496118_0025076 | 3300048921 | Bacteria | 5126 |
| 264 | Ga0496118_0084152 | 3300048921 | Bacteria | 2220 |
| 265 | Ga0496120_0044043 | 3300048923 | Bacteria | 2595 |
| 266 | Ga0496120_0048527 | 3300048923 | Bacteria | 2443 |
| 267 | Ga0496121_0001497 | 3300048924 | Bacteria | 39336 |
| 268 | Ga0496121_0018554 | 3300048924 | Bacteria | 7007 |
| 269 | Ga0496121_0019602 | 3300048924 | Bacteria | 6755 |
| 270 | Ga0496122_0053032 | 3300048925 | Bacteria | 3061 |
| 271 | Ga0496125_0000154 | 3300048928 | Bacteria | 152240 |
| 272 | Ga0496125_0001251 | 3300048928 | Bacteria | 37908 |
| 273 | Ga0496126_0033246 | 3300048929 | Bacteria | 4852 |
| 274 | Ga0496126_0077783 | 3300048929 | Bacteria | 2940 |
| 275 | Ga0495682_0014644 | 3300049460 | Bacteria | 2973 |
| 276 | Ga0501031_0009269 | 3300049568 | Bacteria | 6395 |
| 277 | Ga0501032_0000421 | 3300049569 | Bacteria | 35100 |
| 278 | Ga0501033_0000124 | 3300049570 | Bacteria | 74731 |
| 279 | Ga0501033_0056939 | 3300049570 | Bacteria | 2889 |
| 280 | Ga0501034_0014541 | 3300049571 | Bacteria | 8105 |
| 281 | Ga0501034_0086342 | 3300049571 | Bacteria | 3139 |
| 282 | Ga0501036_0001379 | 3300049572 | Bacteria | 18654 |
| 283 | Ga0501037_0002855 | 3300049573 | Bacteria | 12528 |
| 284 | Ga0501038_0000041 | 3300049574 | Bacteria | 120557 |
| 285 | Ga0501038_0138033 | 3300049574 | Bacteria | 1997 |
| 286 | Ga0501039_0000472 | 3300049575 | Bacteria | 29218 |
| 287 | Ga0501042_0091935 | 3300049578 | Bacteria | 2178 |
| 288 | Ga0501043_0109216 | 3300049579 | Bacteria | 2172 |
| 289 | Ga0501043_0141721 | 3300049579 | Bacteria | 1882 |
| 290 | Ga0501047_0001740 | 3300049581 | Bacteria | 21108 |
| 291 | Ga0501047_0012149 | 3300049581 | Bacteria | 8150 |
| 292 | Ga0501047_0029310 | 3300049581 | Bacteria | 5309 |
| 293 | Ga0501047_0249149 | 3300049581 | Bacteria | 1625 |
| 294 | Ga0501048_0016125 | 3300049582 | Bacteria | 5509 |
| 295 | Ga0501067_0053885 | 3300049583 | Bacteria | 2228 |
| 296 | Ga0501068_0021817 | 3300049584 | Bacteria | 3742 |
| 297 | Ga0501070_0000175 | 3300049586 | Bacteria | 59483 |
| 298 | Ga0501071_0045200 | 3300049587 | Bacteria | 3161 |
| 299 | Ga0501073_0044719 | 3300049589 | Bacteria | 3121 |
| 300 | Ga0501079_0046896 | 3300049741 | Bacteria | 3334 |
| 301 | Ga0501080_0000638 | 3300049742 | Bacteria | 27778 |
| 302 | Ga0501044_0000393 | 3300049823 | Bacteria | 54257 |
| 303 | Ga0501044_0024727 | 3300049823 | Bacteria | 6371 |
| 304 | Ga0501044_0279086 | 3300049823 | Bacteria | 1605 |
| 305 | Ga0501045_0014907 | 3300049824 | Bacteria | 5514 |
| 306 | nmdc:mga03n38_7444_c1 | 3300050490 | Bacteria | 3092 |
| 307 | nmdc:mga0yw44_10401_c1 | 3300050492 | Bacteria | 4752 |
| 308 | nmdc:mga0yw44_37321_c1 | 3300050492 | Bacteria | 2869 |
| 309 | nmdc:mga05p37_286535_c1 | 3300050507 | Bacteria | 1962 |
| 310 | Ga0495601_0020707 | 3300053077 | Bacteria | 4019 |
| 311 | Ga0495595_0094977 | 3300053084 | Bacteria | 1434 |
| 312 | Ga0500578_0080540 | 3300053086 | Bacteria | 2071 |
| 313 | Ga0500643_010680 | 3300053087 | Bacteria | 3399 |
| 314 | Ga0500647_0048653 | 3300053091 | Bacteria | 2038 |
| 315 | Ga0500651_0005279 | 3300053093 | Bacteria | 7359 |
| 316 | Ga0500651_0008860 | 3300053093 | Bacteria | 5949 |
| 317 | Ga0500566_0000157 | 3300053094 | Bacteria | 34534 |
| 318 | Ga0500566_0000439 | 3300053094 | Bacteria | 23159 |
| 319 | Ga0500640_000465 | 3300053095 | Bacteria | 9969 |
| 320 | Ga0500641_0061754 | 3300053096 | Bacteria | 1561 |
| 321 | Ga0500650_0000424 | 3300053098 | Bacteria | 10499 |
| 322 | Ga0500554_021007 | 3300053102 | Bacteria | 1803 |
| 323 | Ga0500556_0000413 | 3300053104 | Bacteria | 31142 |
| 324 | Ga0500572_000678 | 3300053111 | Bacteria | 11189 |
| 325 | Ga0500593_022126 | 3300053117 | Bacteria | 2806 |
| 326 | Ga0500595_000331 | 3300053119 | Bacteria | 31133 |
| 327 | Ga0500595_003271 | 3300053119 | Bacteria | 7651 |
| 328 | Ga0500595_005861 | 3300053119 | Bacteria | 5293 |
| 329 | Ga0500607_051920 | 3300053121 | Bacteria | 2179 |
| 330 | Ga0500642_0000005 | 3300053130 | Bacteria | 422725 |
| 331 | Ga0500642_0003432 | 3300053130 | Bacteria | 4795 |
| 332 | Ga0500652_000113 | 3300053131 | Bacteria | 31589 |
| 333 | Ga0500559_0001538 | 3300053136 | Bacteria | 12922 |
| 334 | Ga0500568_0002393 | 3300053139 | Bacteria | 11075 |
| 335 | Ga0500573_0003895 | 3300053140 | Bacteria | 7790 |
| 336 | Ga0500577_0000088 | 3300053142 | Bacteria | 21585 |
| 337 | Ga0500586_000609 | 3300053145 | Bacteria | 7271 |
| 338 | Ga0500590_050996 | 3300053148 | Bacteria | 2103 |
| 339 | Ga0500604_0004894 | 3300053151 | Bacteria | 3551 |
| 340 | Ga0500604_0025262 | 3300053151 | Bacteria | 1707 |
| 341 | Ga0500616_0000180 | 3300053153 | Bacteria | 106053 |
| 342 | Ga0500630_000096 | 3300053159 | Bacteria | 27855 |
| 343 | Ga0500634_0051356 | 3300053161 | Bacteria | 2218 |
| 344 | Ga0500638_000982 | 3300053162 | Bacteria | 8203 |
| 345 | Ga0500638_002673 | 3300053162 | Bacteria | 6317 |
| 346 | Ga0500639_000014 | 3300053163 | Bacteria | 122926 |
| 347 | Ga0500636_0071340 | 3300053177 | Bacteria | 2014 |
| 348 | Ga0500636_0097817 | 3300053177 | Bacteria | 1672 |
| 349 | Ga0500637_0000236 | 3300053178 | Bacteria | 20611 |
| 350 | Ga0500596_000211 | 3300053735 | Bacteria | 9776 |
| 351 | Ga0500661_000089 | 3300055283 | Bacteria | 14508 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035119 | Ga0373956_0042225 | Ga0373956_0042225_14_1114 | 266 |
| 2 | 3300048911 | Ga0496108_0463514 | Ga0496108_0463514_29_1051 | 300 |
| 3 | 3300025914 | Ga0207671_10131392 | Ga0207671_101313921 | 305 |
| 4 | 3300006871 | Ga0075434_100056710 | Ga0075434_1000567101 | 312 |
| 5 | 3300026118 | Ga0207675_100030754 | Ga0207675_1000307545 | 312 |
| 6 | 3300031911 | Ga0307412_10048000 | Ga0307412_100480003 | 313 |
| 7 | 3300048915 | Ga0496112_0059917 | Ga0496112_0059917_1853_3109 | 314 |
| 8 | 3300046530 | Ga0495654_0054125 | Ga0495654_0054125_25_1131 | 316 |
| 9 | 3300005455 | Ga0070663_100011588 | Ga0070663_1000115883 | 318 |
| 10 | 3300048908 | Ga0496105_0140778 | Ga0496105_0140778_116_1372 | 320 |
| 11 | 3300053145 | Ga0500586_000609 | Ga0500586_000609_1496_2755 | 320 |
| 12 | 3300053121 | Ga0500607_051920 | Ga0500607_051920_422_1696 | 321 |
| 13 | 3300025942 | Ga0207689_10025603 | Ga0207689_100256033 | 323 |
| 14 | 3300006186 | Ga0075369_10049326 | Ga0075369_100493263 | 324 |
| 15 | 3300049823 | Ga0501044_0279086 | Ga0501044_0279086_137_1426 | 324 |
| 16 | 3300050492 | nmdc:mga0yw44_37321_c1 | nmdc:mga0yw44_37321_c1_374_1618 | 324 |
| 17 | iso_pu_bacteria | 2643221651 | 2644287329 | 324 |
| 18 | 3300035724 | Ga0373933_0021712 | Ga0373933_0021712_2339_3634 | 328 |
| 19 | 3300036401 | Ga0373937_0001368 | Ga0373937_0001368_14858_16153 | 328 |
| 20 | 3300006028 | Ga0070717_10020500 | Ga0070717_100205004 | 330 |
| 21 | 3300005434 | Ga0070709_10026923 | Ga0070709_100269231 | 331 |
| 22 | 3300005436 | Ga0070713_100062112 | Ga0070713_1000621121 | 331 |
| 23 | 3300005439 | Ga0070711_100015573 | Ga0070711_1000155733 | 331 |
| 24 | 3300005539 | Ga0068853_100165443 | Ga0068853_1001654431 | 331 |
| 25 | 3300025906 | Ga0207699_10025960 | Ga0207699_100259603 | 331 |
| 26 | 3300025916 | Ga0207663_10000620 | Ga0207663_100006208 | 331 |
| 27 | 3300025919 | Ga0207657_10002789 | Ga0207657_1000278911 | 331 |
| 28 | 3300025929 | Ga0207664_10076203 | Ga0207664_100762031 | 331 |
| 29 | 3300025939 | Ga0207665_10013471 | Ga0207665_100134714 | 331 |
| 30 | 3300050507 | nmdc:mga05p37_286535_c1 | nmdc:mga05p37_286535_c1_261_1520 | 331 |
| 31 | 3300005614 | Ga0068856_100000434 | Ga0068856_10000043436 | 332 |
| 32 | 3300026078 | Ga0207702_10000041 | Ga0207702_10000041107 | 332 |
| 33 | 3300005347 | Ga0070668_100064254 | Ga0070668_1000642543 | 334 |
| 34 | 3300005719 | Ga0068861_100260835 | Ga0068861_1002608351 | 334 |
| 35 | 3300005844 | Ga0068862_100063093 | Ga0068862_1000630932 | 334 |
| 36 | 3300026118 | Ga0207675_100197669 | Ga0207675_1001976692 | 334 |
| 37 | 3300046454 | Ga0495592_0064989 | Ga0495592_0064989_299_1498 | 334 |
| 38 | 3300046462 | Ga0495651_0008507 | Ga0495651_0008507_5641_6840 | 334 |
| 39 | 3300046476 | Ga0495662_0023617 | Ga0495662_0023617_1044_2243 | 334 |
| 40 | 3300046477 | Ga0495664_0020394 | Ga0495664_0020394_927_2126 | 334 |
| 41 | 3300046516 | Ga0495628_0029809 | Ga0495628_0029809_827_2026 | 334 |
| 42 | 3300046533 | Ga0495640_0021097 | Ga0495640_0021097_1877_3076 | 334 |
| 43 | 3300046536 | Ga0495587_0008333 | Ga0495587_0008333_2171_3370 | 334 |
| 44 | 3300046557 | Ga0495622_0014054 | Ga0495622_0014054_1415_2611 | 334 |
| 45 | 3300046642 | Ga0495634_0014475 | Ga0495634_0014475_2617_3816 | 334 |
| 46 | 3300046675 | Ga0495657_0001697 | Ga0495657_0001697_9613_10812 | 334 |
| 47 | 3300046679 | Ga0495623_0001818 | Ga0495623_0001818_6883_8082 | 334 |
| 48 | 3300047317 | Ga0495604_0018118 | Ga0495604_0018118_2037_3236 | 334 |
| 49 | 3300047322 | Ga0495680_0008019 | Ga0495680_0008019_2611_3810 | 334 |
| 50 | 3300047444 | Ga0495675_0012583 | Ga0495675_0012583_3300_4499 | 334 |
| 51 | 3300047471 | Ga0495684_0031031 | Ga0495684_0031031_867_2066 | 334 |
| 52 | 3300048088 | Ga0495602_0046633 | Ga0495602_0046633_1826_3025 | 334 |
| 53 | 3300046519 | Ga0495632_0060673 | Ga0495632_0060673_534_1733 | 335 |
| 54 | 3300048924 | Ga0496121_0001497 | Ga0496121_0001497_10204_11496 | 335 |
| 55 | 3300049460 | Ga0495682_0014644 | Ga0495682_0014644_1445_2644 | 335 |
| 56 | iso_pu_bacteria | 2908756301 | 2908757142 | 335 |
| 57 | 3300005336 | Ga0070680_100169124 | Ga0070680_1001691243 | 337 |
| 58 | 3300005983 | Ga0081540_1009207 | Ga0081540_10092074 | 337 |
| 59 | 3300025944 | Ga0207661_10010489 | Ga0207661_100104894 | 337 |
| 60 | 3300048925 | Ga0496122_0053032 | Ga0496122_0053032_1706_2959 | 338 |
| 61 | 3300005458 | Ga0070681_10241874 | Ga0070681_102418741 | 340 |
| 62 | 3300005530 | Ga0070679_100010878 | Ga0070679_1000108789 | 340 |
| 63 | 3300005563 | Ga0068855_100131476 | Ga0068855_1001314763 | 340 |
| 64 | 3300005719 | Ga0068861_100013444 | Ga0068861_1000134445 | 340 |
| 65 | 3300009174 | Ga0105241_10072304 | Ga0105241_100723043 | 340 |
| 66 | 3300013307 | Ga0157372_10048388 | Ga0157372_100483884 | 340 |
| 67 | 3300025912 | Ga0207707_10000178 | Ga0207707_1000017842 | 340 |
| 68 | 3300025919 | Ga0207657_10110535 | Ga0207657_101105353 | 340 |
| 69 | 3300025921 | Ga0207652_10010016 | Ga0207652_100100162 | 340 |
| 70 | 3300025949 | Ga0207667_10170449 | Ga0207667_101704493 | 340 |
| 71 | 3300026089 | Ga0207648_10058284 | Ga0207648_100582843 | 340 |
| 72 | 3300048909 | Ga0496106_0064335 | Ga0496106_0064335_1461_2654 | 340 |
| 73 | 3300048929 | Ga0496126_0033246 | Ga0496126_0033246_2415_3617 | 341 |
| 74 | 3300053117 | Ga0500593_022126 | Ga0500593_022126_535_1881 | 341 |
| 75 | 3300005985 | Ga0081539_10055939 | Ga0081539_100559392 | 342 |
| 76 | 3300028380 | Ga0268265_10154693 | Ga0268265_101546931 | 342 |
| 77 | 3300035111 | Ga0373923_0008777 | Ga0373923_0008777_1195_2547 | 342 |
| 78 | 3300035117 | Ga0373953_0010738 | Ga0373953_0010738_388_1740 | 342 |
| 79 | 3300049579 | Ga0501043_0141721 | Ga0501043_0141721_113_1498 | 342 |
| 80 | 3300035118 | Ga0373954_0018253 | Ga0373954_0018253_1688_3040 | 343 |
| 81 | 3300035119 | Ga0373956_0009264 | Ga0373956_0009264_2466_3818 | 343 |
| 82 | 3300035724 | Ga0373933_0011029 | Ga0373933_0011029_1650_3002 | 343 |
| 83 | 3300037068 | Ga0373925_0021132 | Ga0373925_0021132_577_1929 | 343 |
| 84 | 3300046454 | Ga0495592_0034801 | Ga0495592_0034801_1088_2440 | 343 |
| 85 | 3300046472 | Ga0495580_0020227 | Ga0495580_0020227_2384_3736 | 343 |
| 86 | 3300046473 | Ga0495582_0005947 | Ga0495582_0005947_1354_2706 | 343 |
| 87 | 3300046475 | Ga0495639_0022505 | Ga0495639_0022505_86_1438 | 343 |
| 88 | 3300046514 | Ga0495618_0076562 | Ga0495618_0076562_462_1814 | 343 |
| 89 | 3300046517 | Ga0495630_0068346 | Ga0495630_0068346_882_2234 | 343 |
| 90 | 3300046531 | Ga0495665_0025542 | Ga0495665_0025542_413_1765 | 343 |
| 91 | 3300046683 | Ga0495658_0006723 | Ga0495658_0006723_3125_4477 | 343 |
| 92 | 3300046689 | Ga0495613_0067029 | Ga0495613_0067029_1192_2544 | 343 |
| 93 | 3300047319 | Ga0495674_0007504 | Ga0495674_0007504_4241_5593 | 343 |
| 94 | 3300047471 | Ga0495684_0024690 | Ga0495684_0024690_3157_4509 | 343 |
| 95 | 3300005435 | Ga0070714_100050772 | Ga0070714_1000507723 | 344 |
| 96 | 3300046455 | Ga0495603_0063584 | Ga0495603_0063584_260_1612 | 344 |
| 97 | 3300046511 | Ga0495608_0061403 | Ga0495608_0061403_241_1440 | 344 |
| 98 | 3300048920 | Ga0496117_0081400 | Ga0496117_0081400_209_1423 | 345 |
| 99 | 3300048921 | Ga0496118_0084152 | Ga0496118_0084152_452_1666 | 345 |
| 100 | 3300005356 | Ga0070674_100005743 | Ga0070674_1000057432 | 346 |
| 101 | 3300005456 | Ga0070678_100062598 | Ga0070678_1000625984 | 346 |
| 102 | 3300009553 | Ga0105249_10113738 | Ga0105249_101137381 | 346 |
| 103 | 3300017792 | Ga0163161_10015384 | Ga0163161_100153846 | 346 |
| 104 | 3300025937 | Ga0207669_10006489 | Ga0207669_100064895 | 346 |
| 105 | 3300025961 | Ga0207712_10009695 | Ga0207712_100096952 | 346 |
| 106 | 3300026121 | Ga0207683_10018417 | Ga0207683_100184172 | 346 |
| 107 | 3300048904 | Ga0496101_0085912 | Ga0496101_0085912_159_1454 | 346 |
| 108 | 3300048928 | Ga0496125_0001251 | Ga0496125_0001251_27291_28502 | 346 |
| 109 | 3300053091 | Ga0500647_0048653 | Ga0500647_0048653_293_1471 | 346 |
| 110 | 3300053094 | Ga0500566_0000439 | Ga0500566_0000439_1894_3072 | 346 |
| 111 | 3300053102 | Ga0500554_021007 | Ga0500554_021007_467_1687 | 346 |
| 112 | 3300053111 | Ga0500572_000678 | Ga0500572_000678_8186_9364 | 346 |
| 113 | 3300053119 | Ga0500595_000331 | Ga0500595_000331_4296_5516 | 346 |
| 114 | 3300053148 | Ga0500590_050996 | Ga0500590_050996_753_1931 | 346 |
| 115 | 3300053159 | Ga0500630_000096 | Ga0500630_000096_20024_21202 | 346 |
| 116 | 3300053162 | Ga0500638_000982 | Ga0500638_000982_4250_5470 | 346 |
| 117 | 3300053162 | Ga0500638_002673 | Ga0500638_002673_4390_5568 | 346 |
| 118 | 3300053163 | Ga0500639_000014 | Ga0500639_000014_36819_37997 | 346 |
| 119 | 3300053178 | Ga0500637_0000236 | Ga0500637_0000236_4274_5494 | 346 |
| 120 | 3300053735 | Ga0500596_000211 | Ga0500596_000211_6722_7900 | 346 |
| 121 | 3300055283 | Ga0500661_000089 | Ga0500661_000089_4826_6046 | 346 |
| 122 | 3300006881 | Ga0068865_100114056 | Ga0068865_1001140562 | 347 |
| 123 | 3300009545 | Ga0105237_10027055 | Ga0105237_100270554 | 347 |
| 124 | 3300025922 | Ga0207646_10093587 | Ga0207646_100935872 | 347 |
| 125 | 3300053095 | Ga0500640_000465 | Ga0500640_000465_6892_8070 | 347 |
| 126 | 3300025261 | Ga0209233_1006561 | Ga0209233_10065614 | 348 |
| 127 | 3300025910 | Ga0207684_10164438 | Ga0207684_101644382 | 348 |
| 128 | 3300037312 | Ga0395899_0007702 | Ga0395899_0007702_3399_4691 | 348 |
| 129 | 3300046684 | Ga0495669_0008386 | Ga0495669_0008386_1163_2464 | 348 |
| 130 | 3300009093 | Ga0105240_10054802 | Ga0105240_100548021 | 349 |
| 131 | 3300033442 | Ga0315911_1000010 | Ga0315911_1000010120 | 349 |
| 132 | 3300031730 | Ga0307516_10006009 | Ga0307516_100060096 | 350 |
| 133 | 3300005937 | Ga0081455_10008312 | Ga0081455_100083125 | 352 |
| 134 | 3300026089 | Ga0207648_10201565 | Ga0207648_102015651 | 352 |
| 135 | 3300031711 | Ga0265314_10006246 | Ga0265314_100062465 | 352 |
| 136 | 3300005548 | Ga0070665_100074171 | Ga0070665_1000741712 | 353 |
| 137 | 3300013297 | Ga0157378_10002611 | Ga0157378_100026119 | 353 |
| 138 | 3300006038 | Ga0075365_10051509 | Ga0075365_100515092 | 354 |
| 139 | 3300005434 | Ga0070709_10010676 | Ga0070709_100106765 | 355 |
| 140 | 3300025906 | Ga0207699_10010698 | Ga0207699_100106983 | 355 |
| 141 | 3300048929 | Ga0496126_0077783 | Ga0496126_0077783_451_1635 | 355 |
| 142 | 3300049574 | Ga0501038_0138033 | Ga0501038_0138033_151_1443 | 355 |
| 143 | 3300049581 | Ga0501047_0249149 | Ga0501047_0249149_279_1460 | 355 |
| 144 | 3300053119 | Ga0500595_005861 | Ga0500595_005861_3020_4240 | 355 |
| 145 | 3300046501 | Ga0495607_0026685 | Ga0495607_0026685_582_1826 | 356 |
| 146 | 3300048924 | Ga0496121_0019602 | Ga0496121_0019602_5269_6495 | 356 |
| 147 | 3300053094 | Ga0500566_0000157 | Ga0500566_0000157_30903_32153 | 356 |
| 148 | 3300053136 | Ga0500559_0001538 | Ga0500559_0001538_4545_5792 | 356 |
| 149 | 3300005458 | Ga0070681_10192915 | Ga0070681_101929152 | 357 |
| 150 | 3300005563 | Ga0068855_100008500 | Ga0068855_1000085004 | 357 |
| 151 | 3300005577 | Ga0068857_100073345 | Ga0068857_1000733453 | 357 |
| 152 | 3300005614 | Ga0068856_100044127 | Ga0068856_1000441273 | 357 |
| 153 | 3300006038 | Ga0075365_10029139 | Ga0075365_100291392 | 357 |
| 154 | 3300010375 | Ga0105239_10059602 | Ga0105239_100596023 | 357 |
| 155 | 3300025914 | Ga0207671_10021505 | Ga0207671_100215052 | 357 |
| 156 | 3300025921 | Ga0207652_10035564 | Ga0207652_100355645 | 357 |
| 157 | 3300025927 | Ga0207687_10012709 | Ga0207687_100127095 | 357 |
| 158 | 3300025949 | Ga0207667_10021533 | Ga0207667_100215332 | 357 |
| 159 | 3300025972 | Ga0207668_10020825 | Ga0207668_100208254 | 357 |
| 160 | 3300026041 | Ga0207639_10195526 | Ga0207639_101955261 | 357 |
| 161 | 3300028379 | Ga0268266_10019218 | Ga0268266_100192185 | 357 |
| 162 | 3300005347 | Ga0070668_100243544 | Ga0070668_1002435441 | 358 |
| 163 | 3300005458 | Ga0070681_10028014 | Ga0070681_100280142 | 358 |
| 164 | 3300005543 | Ga0070672_100055422 | Ga0070672_1000554224 | 358 |
| 165 | 3300005844 | Ga0068862_100063940 | Ga0068862_1000639403 | 358 |
| 166 | 3300014326 | Ga0157380_10093924 | Ga0157380_100939241 | 358 |
| 167 | 3300014969 | Ga0157376_10219048 | Ga0157376_102190481 | 358 |
| 168 | 3300025940 | Ga0207691_10055407 | Ga0207691_100554073 | 358 |
| 169 | 3300048924 | Ga0496121_0018554 | Ga0496121_0018554_1511_2761 | 358 |
| 170 | 3300049570 | Ga0501033_0056939 | Ga0501033_0056939_1453_2682 | 358 |
| 171 | 3300053093 | Ga0500651_0005279 | Ga0500651_0005279_2593_3813 | 358 |
| 172 | 3300037466 | Ga0395898_0028013 | Ga0395898_0028013_914_2182 | 359 |
| 173 | 3300048923 | Ga0496120_0044043 | Ga0496120_0044043_724_1947 | 359 |
| 174 | 3300053130 | Ga0500642_0003432 | Ga0500642_0003432_2125_3345 | 359 |
| 175 | 3300025924 | Ga0207694_10096789 | Ga0207694_100967893 | 360 |
| 176 | 3300031901 | Ga0307406_10094820 | Ga0307406_100948202 | 360 |
| 177 | 3300005983 | Ga0081540_1062191 | Ga0081540_10621912 | 361 |
| 178 | 3300031249 | Ga0265339_10000560 | Ga0265339_1000056023 | 361 |
| 179 | 3300033179 | Ga0307507_10108837 | Ga0307507_101088372 | 361 |
| 180 | 3300048923 | Ga0496120_0048527 | Ga0496120_0048527_120_1367 | 361 |
| 181 | 3300048928 | Ga0496125_0000154 | Ga0496125_0000154_64682_65893 | 361 |
| 182 | 3300049571 | Ga0501034_0086342 | Ga0501034_0086342_1606_2808 | 361 |
| 183 | 3300049581 | Ga0501047_0012149 | Ga0501047_0012149_6591_7793 | 361 |
| 184 | iso_pu_bacteria | 2904699407 | 2904705919 | 361 |
| 185 | 3300025295 | Ga0209564_1000485 | Ga0209564_100048541 | 362 |
| 186 | 3300053104 | Ga0500556_0000413 | Ga0500556_0000413_28369_29622 | 362 |
| 187 | 3300005338 | Ga0068868_100049363 | Ga0068868_1000493633 | 363 |
| 188 | 3300005347 | Ga0070668_100006702 | Ga0070668_1000067023 | 363 |
| 189 | 3300005354 | Ga0070675_100040405 | Ga0070675_1000404052 | 363 |
| 190 | 3300005563 | Ga0068855_100127686 | Ga0068855_1001276863 | 363 |
| 191 | 3300009174 | Ga0105241_10015674 | Ga0105241_100156743 | 363 |
| 192 | 3300025908 | Ga0207643_10067505 | Ga0207643_100675051 | 363 |
| 193 | 3300026067 | Ga0207678_10016644 | Ga0207678_100166444 | 363 |
| 194 | 3300026067 | Ga0207678_10041547 | Ga0207678_100415474 | 363 |
| 195 | 3300028380 | Ga0268265_10217415 | Ga0268265_102174151 | 363 |
| 196 | 3300046515 | Ga0495620_0016815 | Ga0495620_0016815_1721_2968 | 363 |
| 197 | 3300046520 | Ga0495637_0037923 | Ga0495637_0037923_596_1843 | 363 |
| 198 | 3300046665 | Ga0495661_0012341 | Ga0495661_0012341_4184_5431 | 363 |
| 199 | 3300047472 | Ga0495686_0010918 | Ga0495686_0010918_1401_2648 | 363 |
| 200 | 3300048904 | Ga0496101_0061495 | Ga0496101_0061495_1375_2637 | 363 |
| 201 | 3300048912 | Ga0496109_0055801 | Ga0496109_0055801_1070_2332 | 363 |
| 202 | 3300048915 | Ga0496112_0071870 | Ga0496112_0071870_1929_3140 | 363 |
| 203 | 3300048921 | Ga0496118_0025076 | Ga0496118_0025076_3806_5047 | 363 |
| 204 | 3300050492 | nmdc:mga0yw44_10401_c1 | nmdc:mga0yw44_10401_c1_1580_2842 | 363 |
| 205 | 3300053086 | Ga0500578_0080540 | Ga0500578_0080540_616_1863 | 363 |
| 206 | 3300053087 | Ga0500643_010680 | Ga0500643_010680_746_1993 | 363 |
| 207 | 3300053093 | Ga0500651_0008860 | Ga0500651_0008860_1550_2797 | 363 |
| 208 | 3300053096 | Ga0500641_0061754 | Ga0500641_0061754_210_1457 | 363 |
| 209 | 3300053098 | Ga0500650_0000424 | Ga0500650_0000424_740_1987 | 363 |
| 210 | 3300053131 | Ga0500652_000113 | Ga0500652_000113_8820_10067 | 363 |
| 211 | 3300053139 | Ga0500568_0002393 | Ga0500568_0002393_1496_2743 | 363 |
| 212 | 3300053151 | Ga0500604_0004894 | Ga0500604_0004894_817_2064 | 363 |
| 213 | 3300053151 | Ga0500604_0025262 | Ga0500604_0025262_238_1476 | 363 |
| 214 | 3300053153 | Ga0500616_0000180 | Ga0500616_0000180_103224_104471 | 363 |
| 215 | iso_pu_bacteria | 2791355199 | 2793083654 | 363 |
| 216 | 3300031235 | Ga0265330_10012656 | Ga0265330_100126563 | 364 |
| 217 | 3300031235 | Ga0265330_10023235 | Ga0265330_100232353 | 364 |
| 218 | 3300031238 | Ga0265332_10008603 | Ga0265332_100086034 | 364 |
| 219 | 3300031241 | Ga0265325_10003305 | Ga0265325_100033056 | 364 |
| 220 | 3300031247 | Ga0265340_10049511 | Ga0265340_100495112 | 364 |
| 221 | 3300031712 | Ga0265342_10020622 | Ga0265342_100206223 | 364 |
| 222 | 3300046543 | Ga0495645_0048841 | Ga0495645_0048841_1863_3071 | 364 |
| 223 | 3300053130 | Ga0500642_0000005 | Ga0500642_0000005_1514_2761 | 364 |
| 224 | 3300053161 | Ga0500634_0051356 | Ga0500634_0051356_395_1633 | 364 |
| 225 | 3300053177 | Ga0500636_0071340 | Ga0500636_0071340_20_1240 | 364 |
| 226 | 3300053177 | Ga0500636_0097817 | Ga0500636_0097817_141_1370 | 364 |
| 227 | iso_pu_bacteria | 2893066018 | 2893069415 | 364 |
| 228 | 3300005548 | Ga0070665_100167440 | Ga0070665_1001674402 | 365 |
| 229 | 3300046473 | Ga0495582_0083497 | Ga0495582_0083497_271_1539 | 365 |
| 230 | 3300053142 | Ga0500577_0000088 | Ga0500577_0000088_18234_19505 | 365 |
| 231 | 3300028786 | Ga0307517_10003969 | Ga0307517_1000396924 | 366 |
| 232 | 3300046684 | Ga0495669_0050996 | Ga0495669_0050996_659_1828 | 366 |
| 233 | 3300049823 | Ga0501044_0024727 | Ga0501044_0024727_4046_5275 | 366 |
| 234 | iso_pu_bacteria | 2602042107 | 2603862597 | 366 |
| 235 | iso_pu_bacteria | 2857524615 | 2857529939 | 366 |
| 236 | iso_pu_bacteria | 2919073203 | 2919077205 | 366 |
| 237 | 3300028379 | Ga0268266_10049188 | Ga0268266_100491883 | 367 |
| 238 | 3300035117 | Ga0373953_0004950 | Ga0373953_0004950_2720_3970 | 367 |
| 239 | 3300047322 | Ga0495680_0017598 | Ga0495680_0017598_4625_5875 | 367 |
| 240 | 3300003215 | JGI25153J46596_10037976 | JGI25153J46596_100379761 | 368 |
| 241 | 3300025297 | Ga0209758_1002269 | Ga0209758_100226913 | 368 |
| 242 | 3300046524 | Ga0495648_0002325 | Ga0495648_0002325_10279_11508 | 368 |
| 243 | 3300047320 | Ga0495672_0050147 | Ga0495672_0050147_401_1609 | 368 |
| 244 | iso_pu_bacteria | 2524023205 | 2524438162 | 368 |
| 245 | 3300005564 | Ga0070664_100083584 | Ga0070664_1000835842 | 369 |
| 246 | 3300005578 | Ga0068854_100209236 | Ga0068854_1002092362 | 369 |
| 247 | 3300025901 | Ga0207688_10036334 | Ga0207688_100363343 | 369 |
| 248 | 3300025945 | Ga0207679_10032499 | Ga0207679_100324994 | 369 |
| 249 | 3300025981 | Ga0207640_10184277 | Ga0207640_101842772 | 369 |
| 250 | 3300028794 | Ga0307515_10102117 | Ga0307515_101021173 | 369 |
| 251 | 3300035692 | Ga0373935_0130083 | Ga0373935_0130083_93_1319 | 370 |
| 252 | 3300046516 | Ga0495628_0066349 | Ga0495628_0066349_1024_2250 | 370 |
| 253 | 3300046675 | Ga0495657_0028991 | Ga0495657_0028991_1785_3011 | 370 |
| 254 | 3300046678 | Ga0495599_0040757 | Ga0495599_0040757_1608_2834 | 370 |
| 255 | 3300047317 | Ga0495604_0003151 | Ga0495604_0003151_7742_8968 | 370 |
| 256 | 3300047472 | Ga0495686_0059588 | Ga0495686_0059588_182_1396 | 370 |
| 257 | 3300053119 | Ga0500595_003271 | Ga0500595_003271_4211_5425 | 370 |
| 258 | iso_pu_bacteria | 2885374607 | 2885378030 | 370 |
| 259 | iso_pu_bacteria | 2908739725 | 2908745084 | 370 |
| 260 | 3300046511 | Ga0495608_0026929 | Ga0495608_0026929_2352_3578 | 371 |
| 261 | 3300046678 | Ga0495599_0010540 | Ga0495599_0010540_219_1451 | 371 |
| 262 | 3300053077 | Ga0495601_0020707 | Ga0495601_0020707_143_1375 | 371 |
| 263 | iso_pu_bacteria | 2888388044 | 2888389148 | 371 |
| 264 | 3300026067 | Ga0207678_10036799 | Ga0207678_100367993 | 372 |
| 265 | 3300026075 | Ga0207708_10034452 | Ga0207708_100344524 | 372 |
| 266 | 3300046514 | Ga0495618_0051235 | Ga0495618_0051235_1333_2559 | 372 |
| 267 | 3300046535 | Ga0495586_0082962 | Ga0495586_0082962_146_1372 | 372 |
| 268 | iso_pu_bacteria | 2906635258 | 2906641665 | 372 |
| 269 | 3300026067 | Ga0207678_10047996 | Ga0207678_100479963 | 373 |
| 270 | 3300030521 | Ga0307511_10120867 | Ga0307511_101208671 | 373 |
| 271 | 3300046512 | Ga0495610_0048137 | Ga0495610_0048137_374_1711 | 373 |
| 272 | 3300046533 | Ga0495640_0024411 | Ga0495640_0024411_2893_4122 | 373 |
| 273 | 3300048914 | Ga0496111_0059046 | Ga0496111_0059046_1414_2724 | 373 |
| 274 | 3300035172 | Ga0373955_0017147 | Ga0373955_0017147_466_1698 | 374 |
| 275 | 3300046462 | Ga0495651_0032781 | Ga0495651_0032781_477_1709 | 374 |
| 276 | 3300046463 | Ga0495653_0007319 | Ga0495653_0007319_5106_6338 | 374 |
| 277 | 3300046679 | Ga0495623_0008919 | Ga0495623_0008919_1053_2285 | 374 |
| 278 | 3300047471 | Ga0495684_0004204 | Ga0495684_0004204_3547_4779 | 374 |
| 279 | 3300047673 | Ga0495593_0006898 | Ga0495593_0006898_5194_6426 | 374 |
| 280 | 3300049579 | Ga0501043_0109216 | Ga0501043_0109216_504_1736 | 374 |
| 281 | 3300049581 | Ga0501047_0029310 | Ga0501047_0029310_399_1631 | 374 |
| 282 | iso_pu_bacteria | 2524023210 | 2524468826 | 374 |
| 283 | 3300005329 | Ga0070683_100281594 | Ga0070683_1002815941 | 375 |
| 284 | 3300005338 | Ga0068868_100058770 | Ga0068868_1000587702 | 375 |
| 285 | 3300009098 | Ga0105245_10027777 | Ga0105245_100277773 | 375 |
| 286 | 3300010375 | Ga0105239_10069917 | Ga0105239_100699173 | 375 |
| 287 | 3300011119 | Ga0105246_10012667 | Ga0105246_100126673 | 375 |
| 288 | 3300013306 | Ga0163162_10109662 | Ga0163162_101096623 | 375 |
| 289 | 3300013308 | Ga0157375_10038948 | Ga0157375_100389485 | 375 |
| 290 | 3300014325 | Ga0163163_10099723 | Ga0163163_100997233 | 375 |
| 291 | 3300014969 | Ga0157376_10098042 | Ga0157376_100980423 | 375 |
| 292 | 3300026121 | Ga0207683_10030668 | Ga0207683_100306683 | 375 |
| 293 | 3300026121 | Ga0207683_10267450 | Ga0207683_102674501 | 375 |
| 294 | 3300028379 | Ga0268266_10021703 | Ga0268266_100217032 | 375 |
| 295 | 3300035119 | Ga0373956_0005202 | Ga0373956_0005202_2160_3362 | 375 |
| 296 | 3300046529 | Ga0495652_0009678 | Ga0495652_0009678_2931_4163 | 375 |
| 297 | 3300046543 | Ga0495645_0128050 | Ga0495645_0128050_287_1519 | 375 |
| 298 | 3300047319 | Ga0495674_0013371 | Ga0495674_0013371_5401_6603 | 375 |
| 299 | 3300048903 | Ga0496100_0004736 | Ga0496100_0004736_339_1559 | 375 |
| 300 | 3300048904 | Ga0496101_0003216 | Ga0496101_0003216_7440_8660 | 375 |
| 301 | 3300048905 | Ga0496102_0032936 | Ga0496102_0032936_1904_3124 | 375 |
| 302 | 3300048907 | Ga0496104_0032401 | Ga0496104_0032401_1708_2928 | 375 |
| 303 | 3300048908 | Ga0496105_0073318 | Ga0496105_0073318_175_1395 | 375 |
| 304 | 3300048909 | Ga0496106_0005945 | Ga0496106_0005945_3682_4902 | 375 |
| 305 | 3300048910 | Ga0496107_0058166 | Ga0496107_0058166_124_1344 | 375 |
| 306 | 3300048911 | Ga0496108_0108933 | Ga0496108_0108933_1069_2289 | 375 |
| 307 | 3300048912 | Ga0496109_0061455 | Ga0496109_0061455_1329_2549 | 375 |
| 308 | 3300048913 | Ga0496110_0024761 | Ga0496110_0024761_795_2015 | 375 |
| 309 | 3300048914 | Ga0496111_0033593 | Ga0496111_0033593_137_1357 | 375 |
| 310 | 3300048915 | Ga0496112_0109419 | Ga0496112_0109419_1012_2232 | 375 |
| 311 | 3300048917 | Ga0496114_0045013 | Ga0496114_0045013_2181_3401 | 375 |
| 312 | 3300048918 | Ga0496115_0217714 | Ga0496115_0217714_116_1339 | 375 |
| 313 | 3300025981 | Ga0207640_10119091 | Ga0207640_101190912 | 376 |
| 314 | iso_pu_bacteria | 2667528175 | 2671119192 | 376 |
| 315 | iso_pu_bacteria | 2903748898 | 2903749620 | 376 |
| 316 | iso_pu_bacteria | 8019565922 | 8019569697 | 376 |
| 317 | iso_pu_bacteria | 8056689827 | 8056695196 | 376 |
| 318 | 3300028794 | Ga0307515_10182430 | Ga0307515_101824301 | 377 |
| 319 | 3300031456 | Ga0307513_10151459 | Ga0307513_101514591 | 377 |
| 320 | iso_pu_bacteria | 2791355197 | 2793071250 | 377 |
| 321 | iso_pu_bacteria | 2906610324 | 2906611497 | 377 |
| 322 | iso_pu_bacteria | 2922425934 | 2922427858 | 377 |
| 323 | iso_pu_bacteria | 2935630451 | 2935632206 | 377 |
| 324 | iso_pu_bacteria | 2941507105 | 2941508154 | 377 |
| 325 | iso_pu_bacteria | 2941515067 | 2941515341 | 377 |
| 326 | iso_pu_bacteria | 2941523033 | 2941524084 | 377 |
| 327 | iso_pu_bacteria | 3005474847 | 3005477569 | 377 |
| 328 | 3300026118 | Ga0207675_100015802 | Ga0207675_1000158024 | 378 |
| 329 | iso_pu_bacteria | 2513237096 | 2513655061 | 378 |
| 330 | iso_pu_bacteria | 2513237137 | 2513861082 | 378 |
| 331 | iso_pu_bacteria | 2513237145 | 2513915916 | 378 |
| 332 | iso_pu_bacteria | 2517572143 | 2517894779 | 378 |
| 333 | iso_pu_bacteria | 2906660503 | 2906660767 | 378 |
| 334 | iso_pu_bacteria | 8006933436 | 8006933659 | 378 |
| 335 | iso_pu_bacteria | 8006973647 | 8006983331 | 378 |
| 336 | 3300053140 | Ga0500573_0003895 | Ga0500573_0003895_593_1816 | 379 |
| 337 | iso_pu_bacteria | 2513237098 | 2513678515 | 379 |
| 338 | 3300005354 | Ga0070675_100187683 | Ga0070675_1001876831 | 380 |
| 339 | 3300006042 | Ga0075368_10047595 | Ga0075368_100475952 | 380 |
| 340 | 3300007788 | Ga0099795_10007795 | Ga0099795_100077953 | 380 |
| 341 | 3300025926 | Ga0207659_10138332 | Ga0207659_101383322 | 380 |
| 342 | 3300031616 | Ga0307508_10082443 | Ga0307508_100824431 | 380 |
| 343 | 3300046642 | Ga0495634_0005809 | Ga0495634_0005809_252_1502 | 380 |
| 344 | 3300049568 | Ga0501031_0009269 | Ga0501031_0009269_3009_4262 | 380 |
| 345 | 3300049569 | Ga0501032_0000421 | Ga0501032_0000421_5051_6304 | 380 |
| 346 | 3300049570 | Ga0501033_0000124 | Ga0501033_0000124_54262_55515 | 380 |
| 347 | 3300049571 | Ga0501034_0014541 | Ga0501034_0014541_1571_2824 | 380 |
| 348 | 3300049572 | Ga0501036_0001379 | Ga0501036_0001379_17333_18586 | 380 |
| 349 | 3300049573 | Ga0501037_0002855 | Ga0501037_0002855_1217_2470 | 380 |
| 350 | 3300049574 | Ga0501038_0000041 | Ga0501038_0000041_18553_19806 | 380 |
| 351 | 3300049575 | Ga0501039_0000472 | Ga0501039_0000472_4758_6011 | 380 |
| 352 | 3300049578 | Ga0501042_0091935 | Ga0501042_0091935_333_1586 | 380 |
| 353 | 3300049581 | Ga0501047_0001740 | Ga0501047_0001740_6901_8154 | 380 |
| 354 | 3300049582 | Ga0501048_0016125 | Ga0501048_0016125_1485_2738 | 380 |
| 355 | 3300049583 | Ga0501067_0053885 | Ga0501067_0053885_458_1711 | 380 |
| 356 | 3300049584 | Ga0501068_0021817 | Ga0501068_0021817_2435_3688 | 380 |
| 357 | 3300049586 | Ga0501070_0000175 | Ga0501070_0000175_55902_57155 | 380 |
| 358 | 3300049587 | Ga0501071_0045200 | Ga0501071_0045200_1205_2458 | 380 |
| 359 | 3300049589 | Ga0501073_0044719 | Ga0501073_0044719_1432_2685 | 380 |
| 360 | 3300049741 | Ga0501079_0046896 | Ga0501079_0046896_1046_2299 | 380 |
| 361 | 3300049742 | Ga0501080_0000638 | Ga0501080_0000638_17105_18358 | 380 |
| 362 | 3300049823 | Ga0501044_0000393 | Ga0501044_0000393_4558_5811 | 380 |
| 363 | 3300049824 | Ga0501045_0014907 | Ga0501045_0014907_1490_2743 | 380 |
| 364 | 3300007788 | Ga0099795_10003118 | Ga0099795_100031185 | 381 |
| 365 | 3300025937 | Ga0207669_10172056 | Ga0207669_101720562 | 381 |
| 366 | 3300027512 | Ga0209179_1013424 | Ga0209179_10134241 | 381 |
| 367 | 3300027671 | Ga0209588_1014312 | Ga0209588_10143121 | 381 |
| 368 | 3300009177 | Ga0105248_10024128 | Ga0105248_100241283 | 382 |
| 369 | iso_pu_bacteria | 2876808645 | 2876810228 | 383 |
| 370 | iso_pu_bacteria | 2879110137 | 2879118071 | 383 |
| 371 | 3300050490 | nmdc:mga03n38_7444_c1 | nmdc:mga03n38_7444_c1_651_1853 | 384 |
| 372 | 3300027512 | Ga0209179_1000968 | Ga0209179_10009684 | 385 |
| 373 | 3300048909 | Ga0496106_0002192 | Ga0496106_0002192_388_1590 | 385 |
| 374 | 3300048910 | Ga0496107_0079987 | Ga0496107_0079987_407_1609 | 385 |
| 375 | 3300048911 | Ga0496108_0009100 | Ga0496108_0009100_787_1989 | 385 |
| 376 | 3300048912 | Ga0496109_0000958 | Ga0496109_0000958_20866_22068 | 385 |
| 377 | 3300048915 | Ga0496112_0037145 | Ga0496112_0037145_2028_3230 | 385 |
| 378 | 3300048916 | Ga0496113_0037488 | Ga0496113_0037488_16_1218 | 385 |
| 379 | 3300053084 | Ga0495595_0094977 | Ga0495595_0094977_143_1378 | 385 |
| 380 | iso_pu_bacteria | 2885383462 | 2885384519 | 385 |
| 381 | iso_pu_bacteria | 8056681323 | 8056682357 | 385 |
| 382 | 3300009545 | Ga0105237_10144158 | Ga0105237_101441582 | 386 |
| 383 | 3300010159 | Ga0099796_10050487 | Ga0099796_100504871 | 390 |
| 384 | 3300005344 | Ga0070661_100046454 | Ga0070661_1000464542 | 391 |
| 385 | 3300046507 | Ga0495606_0000960 | Ga0495606_0000960_37185_38453 | 399 |
| 386 | 3300003203 | JGI25406J46586_10000068 | JGI25406J46586_100000686 | 400 |
| 387 | 3300003203 | JGI25406J46586_10000309 | JGI25406J46586_100003097 | 400 |
| 388 | 3300005985 | Ga0081539_10000321 | Ga0081539_1000032157 | 400 |
| 389 | 3300048915 | Ga0496112_0000037 | Ga0496112_0000037_37013_38266 | 400 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar