F431594

General Info

Members Datasets Scaffolds Average Seq Length
389 284 351 378

Family's Representative Sequence

Representative Sequence 3300053142|Ga0500577_0000088|Ga0500577_0000088_18234_19505
Length 423
Sequence MVNEIRFRHVEESLKHLVEFARMTRRVRLYLVGSVVLVSLAGCGKGLFQTEEREPWRAEAEVACLKSGTVKEGADLVRINPISGPGVCGAEFPLKVAALGESGGSFGFADELRPPGSVGNAGNQPRWPVQPQPVARQAYPNSYPEAAPRQPQPGFGATSNGPISLNAPGVAPEEDDIELPPQPTYQAAPQAXXXPRAPYGRYSSGVQAAPPQDYAPQRMGPSQGSATGSVGPVALKPTATLACPIVSALDKWLAEAVQPAAVRWFGARVVEIKQISAYSCRGMNGNSRSHISEHAFGNALDIASFTLADGRKISVKDGWKGMPEEQGFLRDVQGAACQVFNTVLAPGSNVFHYDHIHVDLMRRSSRRIICQPAAVSGEQIAARAMPRSGYSGRDPSVTGSLGNRNGKPGRKAAYDDAADYKNE

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
6 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
7 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
8 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
9 2643221651 Afipia sp. Root123D2 Isolate Unclassified
10 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
11 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
12 2791355199
13 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
14 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
15 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
16 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
17 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
18 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
19 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
20 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
21 2904699407
22 2906610324
23 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
24 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
25 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
26 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
27 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
28 2922425934
29 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
30 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
31 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
32 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
33 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
34 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
129 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
130 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
133 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
142 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
143 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
176 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
249 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
250 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
251 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
252 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
253 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
254 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
255 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
256 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
257 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
258 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
259 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
260 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
261 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
262 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
263 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
264 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
265 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
266 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
267 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
268 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
269 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
270 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
271 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
272 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
273 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
274 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
275 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
276 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
277 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
278 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
279 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
280 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
281 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
282 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
283 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
284 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.17
Metatranscriptomes 0
Isolates 8.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.11
Nodule 5.66
Rhizoplane 8.23
Rhizosphere 63.75
Stem 0
Stem Tuber 0
Unclassified 9.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000068 3300003203 Bacteria 47530
2 JGI25406J46586_10000309 3300003203 Bacteria 21985
3 JGI25153J46596_10037976 3300003215 Bacteria 1525
4 Ga0070683_100281594 3300005329 Bacteria 1582
5 Ga0070680_100169124 3300005336 Bacteria 1839
6 Ga0068868_100049363 3300005338 Bacteria 3302
7 Ga0068868_100058770 3300005338 Bacteria 3040
8 Ga0070661_100046454 3300005344 Bacteria 3176
9 Ga0070668_100006702 3300005347 Bacteria 8536
10 Ga0070668_100064254 3300005347 Bacteria 2845
11 Ga0070668_100243544 3300005347 Bacteria 1490
12 Ga0070675_100040405 3300005354 Bacteria 3808
13 Ga0070675_100187683 3300005354 Bacteria 1790
14 Ga0070674_100005743 3300005356 Bacteria 7198
15 Ga0070709_10010676 3300005434 Bacteria 5094
16 Ga0070709_10026923 3300005434 Bacteria 3413
17 Ga0070714_100050772 3300005435 Bacteria 3535
18 Ga0070713_100062112 3300005436 Bacteria 3128
19 Ga0070711_100015573 3300005439 Bacteria 4813
20 Ga0070663_100011588 3300005455 Bacteria 5541
21 Ga0070678_100062598 3300005456 Bacteria 2748
22 Ga0070681_10028014 3300005458 Bacteria 5663
23 Ga0070681_10192915 3300005458 Bacteria 1956
24 Ga0070681_10241874 3300005458 Bacteria 1718
25 Ga0070679_100010878 3300005530 Bacteria 8644
26 Ga0068853_100165443 3300005539 Bacteria 1998
27 Ga0070672_100055422 3300005543 Bacteria 3105
28 Ga0070665_100074171 3300005548 Bacteria 3408
29 Ga0070665_100167440 3300005548 Bacteria 2200
30 Ga0068855_100008500 3300005563 Bacteria 12410
31 Ga0068855_100127686 3300005563 Bacteria 2906
32 Ga0068855_100131476 3300005563 Bacteria 2858
33 Ga0070664_100083584 3300005564 Bacteria 2754
34 Ga0068857_100073345 3300005577 Bacteria 3049
35 Ga0068854_100209236 3300005578 Bacteria 1538
36 Ga0068856_100000434 3300005614 Bacteria 45889
37 Ga0068856_100044127 3300005614 Bacteria 4386
38 Ga0068861_100013444 3300005719 Bacteria 5729
39 Ga0068861_100260835 3300005719 Bacteria 1483
40 Ga0068862_100063093 3300005844 Bacteria 3188
41 Ga0068862_100063940 3300005844 Bacteria 3166
42 Ga0081455_10008312 3300005937 Bacteria 10812
43 Ga0081540_1009207 3300005983 Bacteria 6810
44 Ga0081540_1062191 3300005983 Bacteria 1775
45 Ga0081539_10000321 3300005985 Bacteria 106887
46 Ga0081539_10055939 3300005985 Bacteria 2192
47 Ga0070717_10020500 3300006028 Bacteria 5200
48 Ga0075365_10029139 3300006038 Bacteria 3525
49 Ga0075365_10051509 3300006038 Bacteria 2719
50 Ga0075368_10047595 3300006042 Bacteria 1698
51 Ga0075369_10049326 3300006186 Bacteria 1818
52 Ga0075434_100056710 3300006871 Bacteria 3894
53 Ga0068865_100114056 3300006881 Bacteria 1998
54 Ga0099795_10003118 3300007788 Bacteria 4058
55 Ga0099795_10007795 3300007788 Bacteria 3014
56 Ga0105240_10054802 3300009093 Bacteria 4995
57 Ga0105245_10027777 3300009098 Bacteria 4986
58 Ga0105241_10015674 3300009174 Bacteria 5554
59 Ga0105241_10072304 3300009174 Bacteria 2680
60 Ga0105248_10024128 3300009177 Bacteria 6759
61 Ga0105237_10027055 3300009545 Bacteria 5858
62 Ga0105237_10144158 3300009545 Bacteria 2376
63 Ga0105249_10113738 3300009553 Bacteria 2562
64 Ga0099796_10050487 3300010159 Bacteria 1442
65 Ga0105239_10059602 3300010375 Bacteria 4189
66 Ga0105239_10069917 3300010375 Bacteria 3856
67 Ga0105246_10012667 3300011119 Bacteria 5268
68 Ga0157378_10002611 3300013297 Bacteria 16027
69 Ga0163162_10109662 3300013306 Bacteria 2857
70 Ga0157372_10048388 3300013307 Bacteria 4727
71 Ga0157375_10038948 3300013308 Bacteria 4569
72 Ga0163163_10099723 3300014325 Bacteria 2926
73 Ga0157380_10093924 3300014326 Bacteria 2481
74 Ga0157376_10098042 3300014969 Bacteria 2554
75 Ga0157376_10219048 3300014969 Bacteria 1762
76 Ga0163161_10015384 3300017792 Bacteria 5333
77 Ga0209233_1006561 3300025261 Bacteria 3741
78 Ga0209564_1000485 3300025295 Bacteria 66032
79 Ga0209758_1002269 3300025297 Bacteria 19924
80 Ga0207688_10036334 3300025901 Bacteria 2730
81 Ga0207699_10010698 3300025906 Bacteria 4614
82 Ga0207699_10025960 3300025906 Bacteria 3223
83 Ga0207643_10067505 3300025908 Bacteria 2052
84 Ga0207684_10164438 3300025910 Bacteria 1912
85 Ga0207707_10000178 3300025912 Bacteria 66057
86 Ga0207671_10021505 3300025914 Bacteria 4892
87 Ga0207671_10131392 3300025914 Bacteria 1922
88 Ga0207663_10000620 3300025916 Bacteria 15733
89 Ga0207657_10002789 3300025919 Bacteria 18797
90 Ga0207657_10110535 3300025919 Bacteria 2270
91 Ga0207652_10010016 3300025921 Bacteria 7635
92 Ga0207652_10035564 3300025921 Bacteria 4205
93 Ga0207646_10093587 3300025922 Bacteria 2691
94 Ga0207694_10096789 3300025924 Bacteria 2335
95 Ga0207659_10138332 3300025926 Bacteria 1888
96 Ga0207687_10012709 3300025927 Bacteria 5501
97 Ga0207664_10076203 3300025929 Bacteria 2714
98 Ga0207669_10006489 3300025937 Bacteria 5353
99 Ga0207669_10172056 3300025937 Bacteria 1543
100 Ga0207665_10013471 3300025939 Bacteria 5377
101 Ga0207691_10055407 3300025940 Bacteria 3613
102 Ga0207689_10025603 3300025942 Bacteria 4943
103 Ga0207661_10010489 3300025944 Bacteria 6668
104 Ga0207679_10032499 3300025945 Bacteria 3664
105 Ga0207667_10021533 3300025949 Bacteria 7143
106 Ga0207667_10170449 3300025949 Bacteria 2237
107 Ga0207712_10009695 3300025961 Bacteria 6104
108 Ga0207668_10020825 3300025972 Bacteria 4174
109 Ga0207640_10119091 3300025981 Bacteria 1887
110 Ga0207640_10184277 3300025981 Bacteria 1568
111 Ga0207639_10195526 3300026041 Bacteria 1731
112 Ga0207678_10016644 3300026067 Bacteria 6459
113 Ga0207678_10036799 3300026067 Bacteria 4261
114 Ga0207678_10041547 3300026067 Bacteria 3987
115 Ga0207678_10047996 3300026067 Bacteria 3691
116 Ga0207708_10034452 3300026075 Bacteria 3851
117 Ga0207702_10000041 3300026078 Bacteria 150754
118 Ga0207648_10058284 3300026089 Bacteria 3368
119 Ga0207648_10201565 3300026089 Bacteria 1765
120 Ga0207675_100015802 3300026118 Bacteria 7039
121 Ga0207675_100030754 3300026118 Bacteria 5000
122 Ga0207675_100197669 3300026118 Bacteria 1930
123 Ga0207683_10018417 3300026121 Bacteria 5958
124 Ga0207683_10030668 3300026121 Bacteria 4661
125 Ga0207683_10267450 3300026121 Bacteria 1561
126 Ga0209179_1000968 3300027512 Bacteria 3265
127 Ga0209179_1013424 3300027512 Bacteria 1488
128 Ga0209588_1014312 3300027671 Bacteria 2427
129 Ga0268266_10019218 3300028379 Bacteria 5818
130 Ga0268266_10021703 3300028379 Bacteria 5472
131 Ga0268266_10049188 3300028379 Bacteria 3614
132 Ga0268265_10154693 3300028380 Bacteria 1939
133 Ga0268265_10217415 3300028380 Bacteria 1669
134 Ga0307517_10003969 3300028786 Bacteria 22921
135 Ga0307515_10102117 3300028794 Bacteria 3453
136 Ga0307515_10182430 3300028794 Bacteria 2042
137 Ga0307511_10120867 3300030521 Bacteria 1620
138 Ga0265330_10012656 3300031235 Bacteria 3942
139 Ga0265330_10023235 3300031235 Bacteria 2817
140 Ga0265332_10008603 3300031238 Bacteria 4584
141 Ga0265325_10003305 3300031241 Bacteria 10607
142 Ga0265340_10049511 3300031247 Bacteria 2040
143 Ga0265339_10000560 3300031249 Bacteria 29070
144 Ga0307513_10151459 3300031456 Bacteria 2227
145 Ga0307508_10082443 3300031616 Bacteria 2798
146 Ga0265314_10006246 3300031711 Bacteria 10581
147 Ga0265342_10020622 3300031712 Bacteria 4223
148 Ga0307516_10006009 3300031730 Bacteria 14346
149 Ga0307406_10094820 3300031901 Bacteria 2018
150 Ga0307412_10048000 3300031911 Bacteria 2806
151 Ga0307507_10108837 3300033179 Bacteria 2276
152 Ga0315911_1000010 3300033442 Bacteria 322197
153 Ga0373923_0008777 3300035111 Bacteria 3623
154 Ga0373953_0004950 3300035117 Bacteria 4288
155 Ga0373953_0010738 3300035117 Bacteria 3197
156 Ga0373954_0018253 3300035118 Bacteria 3156
157 Ga0373956_0005202 3300035119 Bacteria 5208
158 Ga0373956_0009264 3300035119 Bacteria 4000
159 Ga0373956_0042225 3300035119 Bacteria 2027
160 Ga0373955_0017147 3300035172 Bacteria 3578
161 Ga0373935_0130083 3300035692 Bacteria 1691
162 Ga0373933_0011029 3300035724 Bacteria 4966
163 Ga0373933_0021712 3300035724 Bacteria 3650
164 Ga0373937_0001368 3300036401 Bacteria 20378
165 Ga0373925_0021132 3300037068 Bacteria 4741
166 Ga0395899_0007702 3300037312 Bacteria 8304
167 Ga0395898_0028013 3300037466 Bacteria 5649
168 Ga0495592_0034801 3300046454 Bacteria 3796
169 Ga0495592_0064989 3300046454 Bacteria 2672
170 Ga0495603_0063584 3300046455 Bacteria 2177
171 Ga0495651_0008507 3300046462 Bacteria 7862
172 Ga0495651_0032781 3300046462 Bacteria 4051
173 Ga0495653_0007319 3300046463 Bacteria 9040
174 Ga0495580_0020227 3300046472 Bacteria 4930
175 Ga0495582_0005947 3300046473 Bacteria 6804
176 Ga0495582_0083497 3300046473 Bacteria 1775
177 Ga0495639_0022505 3300046475 Bacteria 2765
178 Ga0495662_0023617 3300046476 Bacteria 2969
179 Ga0495664_0020394 3300046477 Bacteria 3823
180 Ga0495607_0026685 3300046501 Bacteria 3582
181 Ga0495606_0000960 3300046507 Bacteria 42272
182 Ga0495608_0026929 3300046511 Bacteria 3916
183 Ga0495608_0061403 3300046511 Bacteria 2471
184 Ga0495610_0048137 3300046512 Bacteria 2094
185 Ga0495618_0051235 3300046514 Bacteria 2608
186 Ga0495618_0076562 3300046514 Bacteria 2132
187 Ga0495620_0016815 3300046515 Bacteria 3660
188 Ga0495628_0029809 3300046516 Bacteria 4421
189 Ga0495628_0066349 3300046516 Bacteria 2821
190 Ga0495630_0068346 3300046517 Bacteria 2671
191 Ga0495632_0060673 3300046519 Bacteria 1837
192 Ga0495637_0037923 3300046520 Bacteria 2089
193 Ga0495648_0002325 3300046524 Bacteria 17689
194 Ga0495652_0009678 3300046529 Bacteria 8744
195 Ga0495654_0054125 3300046530 Bacteria 1947
196 Ga0495665_0025542 3300046531 Bacteria 3174
197 Ga0495640_0021097 3300046533 Bacteria 4788
198 Ga0495640_0024411 3300046533 Bacteria 4398
199 Ga0495586_0082962 3300046535 Bacteria 1763
200 Ga0495587_0008333 3300046536 Bacteria 6674
201 Ga0495645_0048841 3300046543 Bacteria 3081
202 Ga0495645_0128050 3300046543 Bacteria 1782
203 Ga0495622_0014054 3300046557 Bacteria 3714
204 Ga0495634_0005809 3300046642 Bacteria 9415
205 Ga0495634_0014475 3300046642 Bacteria 5687
206 Ga0495661_0012341 3300046665 Bacteria 5769
207 Ga0495657_0001697 3300046675 Bacteria 18874
208 Ga0495657_0028991 3300046675 Bacteria 3885
209 Ga0495599_0010540 3300046678 Bacteria 5655
210 Ga0495599_0040757 3300046678 Bacteria 2916
211 Ga0495623_0001818 3300046679 Bacteria 14319
212 Ga0495623_0008919 3300046679 Bacteria 6511
213 Ga0495658_0006723 3300046683 Bacteria 5656
214 Ga0495669_0008386 3300046684 Bacteria 4344
215 Ga0495669_0050996 3300046684 Bacteria 1857
216 Ga0495613_0067029 3300046689 Bacteria 2620
217 Ga0495604_0003151 3300047317 Bacteria 13179
218 Ga0495604_0018118 3300047317 Bacteria 5637
219 Ga0495674_0007504 3300047319 Bacteria 10411
220 Ga0495674_0013371 3300047319 Bacteria 7719
221 Ga0495672_0050147 3300047320 Bacteria 2466
222 Ga0495680_0008019 3300047322 Bacteria 9629
223 Ga0495680_0017598 3300047322 Bacteria 6093
224 Ga0495675_0012583 3300047444 Bacteria 5325
225 Ga0495684_0004204 3300047471 Bacteria 11245
226 Ga0495684_0024690 3300047471 Bacteria 4625
227 Ga0495684_0031031 3300047471 Bacteria 4103
228 Ga0495686_0010918 3300047472 Bacteria 6431
229 Ga0495686_0059588 3300047472 Bacteria 2376
230 Ga0495593_0006898 3300047673 Bacteria 6652
231 Ga0495602_0046633 3300048088 Bacteria 3912
232 Ga0496100_0004736 3300048903 Bacteria 7255
233 Ga0496101_0003216 3300048904 Bacteria 10129
234 Ga0496101_0061495 3300048904 Bacteria 2728
235 Ga0496101_0085912 3300048904 Bacteria 2332
236 Ga0496102_0032936 3300048905 Bacteria 4657
237 Ga0496104_0032401 3300048907 Bacteria 4863
238 Ga0496105_0073318 3300048908 Bacteria 2828
239 Ga0496105_0140778 3300048908 Bacteria 1986
240 Ga0496106_0002192 3300048909 Bacteria 14600
241 Ga0496106_0005945 3300048909 Bacteria 9013
242 Ga0496106_0064335 3300048909 Bacteria 2790
243 Ga0496107_0058166 3300048910 Bacteria 2795
244 Ga0496107_0079987 3300048910 Bacteria 2383
245 Ga0496108_0009100 3300048911 Bacteria 8041
246 Ga0496108_0108933 3300048911 Bacteria 2366
247 Ga0496108_0463514 3300048911 Bacteria 1107
248 Ga0496109_0000958 3300048912 Bacteria 23843
249 Ga0496109_0055801 3300048912 Bacteria 3604
250 Ga0496109_0061455 3300048912 Bacteria 3434
251 Ga0496110_0024761 3300048913 Bacteria 5120
252 Ga0496111_0033593 3300048914 Bacteria 3659
253 Ga0496111_0059046 3300048914 Bacteria 2779
254 Ga0496112_0000037 3300048915 Bacteria 96876
255 Ga0496112_0037145 3300048915 Bacteria 4755
256 Ga0496112_0059917 3300048915 Bacteria 3751
257 Ga0496112_0071870 3300048915 Bacteria 3420
258 Ga0496112_0109419 3300048915 Bacteria 2733
259 Ga0496113_0037488 3300048916 Bacteria 3558
260 Ga0496114_0045013 3300048917 Bacteria 3664
261 Ga0496115_0217714 3300048918 Bacteria 1576
262 Ga0496117_0081400 3300048920 Bacteria 2125
263 Ga0496118_0025076 3300048921 Bacteria 5126
264 Ga0496118_0084152 3300048921 Bacteria 2220
265 Ga0496120_0044043 3300048923 Bacteria 2595
266 Ga0496120_0048527 3300048923 Bacteria 2443
267 Ga0496121_0001497 3300048924 Bacteria 39336
268 Ga0496121_0018554 3300048924 Bacteria 7007
269 Ga0496121_0019602 3300048924 Bacteria 6755
270 Ga0496122_0053032 3300048925 Bacteria 3061
271 Ga0496125_0000154 3300048928 Bacteria 152240
272 Ga0496125_0001251 3300048928 Bacteria 37908
273 Ga0496126_0033246 3300048929 Bacteria 4852
274 Ga0496126_0077783 3300048929 Bacteria 2940
275 Ga0495682_0014644 3300049460 Bacteria 2973
276 Ga0501031_0009269 3300049568 Bacteria 6395
277 Ga0501032_0000421 3300049569 Bacteria 35100
278 Ga0501033_0000124 3300049570 Bacteria 74731
279 Ga0501033_0056939 3300049570 Bacteria 2889
280 Ga0501034_0014541 3300049571 Bacteria 8105
281 Ga0501034_0086342 3300049571 Bacteria 3139
282 Ga0501036_0001379 3300049572 Bacteria 18654
283 Ga0501037_0002855 3300049573 Bacteria 12528
284 Ga0501038_0000041 3300049574 Bacteria 120557
285 Ga0501038_0138033 3300049574 Bacteria 1997
286 Ga0501039_0000472 3300049575 Bacteria 29218
287 Ga0501042_0091935 3300049578 Bacteria 2178
288 Ga0501043_0109216 3300049579 Bacteria 2172
289 Ga0501043_0141721 3300049579 Bacteria 1882
290 Ga0501047_0001740 3300049581 Bacteria 21108
291 Ga0501047_0012149 3300049581 Bacteria 8150
292 Ga0501047_0029310 3300049581 Bacteria 5309
293 Ga0501047_0249149 3300049581 Bacteria 1625
294 Ga0501048_0016125 3300049582 Bacteria 5509
295 Ga0501067_0053885 3300049583 Bacteria 2228
296 Ga0501068_0021817 3300049584 Bacteria 3742
297 Ga0501070_0000175 3300049586 Bacteria 59483
298 Ga0501071_0045200 3300049587 Bacteria 3161
299 Ga0501073_0044719 3300049589 Bacteria 3121
300 Ga0501079_0046896 3300049741 Bacteria 3334
301 Ga0501080_0000638 3300049742 Bacteria 27778
302 Ga0501044_0000393 3300049823 Bacteria 54257
303 Ga0501044_0024727 3300049823 Bacteria 6371
304 Ga0501044_0279086 3300049823 Bacteria 1605
305 Ga0501045_0014907 3300049824 Bacteria 5514
306 nmdc:mga03n38_7444_c1 3300050490 Bacteria 3092
307 nmdc:mga0yw44_10401_c1 3300050492 Bacteria 4752
308 nmdc:mga0yw44_37321_c1 3300050492 Bacteria 2869
309 nmdc:mga05p37_286535_c1 3300050507 Bacteria 1962
310 Ga0495601_0020707 3300053077 Bacteria 4019
311 Ga0495595_0094977 3300053084 Bacteria 1434
312 Ga0500578_0080540 3300053086 Bacteria 2071
313 Ga0500643_010680 3300053087 Bacteria 3399
314 Ga0500647_0048653 3300053091 Bacteria 2038
315 Ga0500651_0005279 3300053093 Bacteria 7359
316 Ga0500651_0008860 3300053093 Bacteria 5949
317 Ga0500566_0000157 3300053094 Bacteria 34534
318 Ga0500566_0000439 3300053094 Bacteria 23159
319 Ga0500640_000465 3300053095 Bacteria 9969
320 Ga0500641_0061754 3300053096 Bacteria 1561
321 Ga0500650_0000424 3300053098 Bacteria 10499
322 Ga0500554_021007 3300053102 Bacteria 1803
323 Ga0500556_0000413 3300053104 Bacteria 31142
324 Ga0500572_000678 3300053111 Bacteria 11189
325 Ga0500593_022126 3300053117 Bacteria 2806
326 Ga0500595_000331 3300053119 Bacteria 31133
327 Ga0500595_003271 3300053119 Bacteria 7651
328 Ga0500595_005861 3300053119 Bacteria 5293
329 Ga0500607_051920 3300053121 Bacteria 2179
330 Ga0500642_0000005 3300053130 Bacteria 422725
331 Ga0500642_0003432 3300053130 Bacteria 4795
332 Ga0500652_000113 3300053131 Bacteria 31589
333 Ga0500559_0001538 3300053136 Bacteria 12922
334 Ga0500568_0002393 3300053139 Bacteria 11075
335 Ga0500573_0003895 3300053140 Bacteria 7790
336 Ga0500577_0000088 3300053142 Bacteria 21585
337 Ga0500586_000609 3300053145 Bacteria 7271
338 Ga0500590_050996 3300053148 Bacteria 2103
339 Ga0500604_0004894 3300053151 Bacteria 3551
340 Ga0500604_0025262 3300053151 Bacteria 1707
341 Ga0500616_0000180 3300053153 Bacteria 106053
342 Ga0500630_000096 3300053159 Bacteria 27855
343 Ga0500634_0051356 3300053161 Bacteria 2218
344 Ga0500638_000982 3300053162 Bacteria 8203
345 Ga0500638_002673 3300053162 Bacteria 6317
346 Ga0500639_000014 3300053163 Bacteria 122926
347 Ga0500636_0071340 3300053177 Bacteria 2014
348 Ga0500636_0097817 3300053177 Bacteria 1672
349 Ga0500637_0000236 3300053178 Bacteria 20611
350 Ga0500596_000211 3300053735 Bacteria 9776
351 Ga0500661_000089 3300055283 Bacteria 14508

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035119 Ga0373956_0042225 Ga0373956_0042225_14_1114 266
2 3300048911 Ga0496108_0463514 Ga0496108_0463514_29_1051 300
3 3300025914 Ga0207671_10131392 Ga0207671_101313921 305
4 3300006871 Ga0075434_100056710 Ga0075434_1000567101 312
5 3300026118 Ga0207675_100030754 Ga0207675_1000307545 312
6 3300031911 Ga0307412_10048000 Ga0307412_100480003 313
7 3300048915 Ga0496112_0059917 Ga0496112_0059917_1853_3109 314
8 3300046530 Ga0495654_0054125 Ga0495654_0054125_25_1131 316
9 3300005455 Ga0070663_100011588 Ga0070663_1000115883 318
10 3300048908 Ga0496105_0140778 Ga0496105_0140778_116_1372 320
11 3300053145 Ga0500586_000609 Ga0500586_000609_1496_2755 320
12 3300053121 Ga0500607_051920 Ga0500607_051920_422_1696 321
13 3300025942 Ga0207689_10025603 Ga0207689_100256033 323
14 3300006186 Ga0075369_10049326 Ga0075369_100493263 324
15 3300049823 Ga0501044_0279086 Ga0501044_0279086_137_1426 324
16 3300050492 nmdc:mga0yw44_37321_c1 nmdc:mga0yw44_37321_c1_374_1618 324
17 iso_pu_bacteria 2643221651 2644287329 324
18 3300035724 Ga0373933_0021712 Ga0373933_0021712_2339_3634 328
19 3300036401 Ga0373937_0001368 Ga0373937_0001368_14858_16153 328
20 3300006028 Ga0070717_10020500 Ga0070717_100205004 330
21 3300005434 Ga0070709_10026923 Ga0070709_100269231 331
22 3300005436 Ga0070713_100062112 Ga0070713_1000621121 331
23 3300005439 Ga0070711_100015573 Ga0070711_1000155733 331
24 3300005539 Ga0068853_100165443 Ga0068853_1001654431 331
25 3300025906 Ga0207699_10025960 Ga0207699_100259603 331
26 3300025916 Ga0207663_10000620 Ga0207663_100006208 331
27 3300025919 Ga0207657_10002789 Ga0207657_1000278911 331
28 3300025929 Ga0207664_10076203 Ga0207664_100762031 331
29 3300025939 Ga0207665_10013471 Ga0207665_100134714 331
30 3300050507 nmdc:mga05p37_286535_c1 nmdc:mga05p37_286535_c1_261_1520 331
31 3300005614 Ga0068856_100000434 Ga0068856_10000043436 332
32 3300026078 Ga0207702_10000041 Ga0207702_10000041107 332
33 3300005347 Ga0070668_100064254 Ga0070668_1000642543 334
34 3300005719 Ga0068861_100260835 Ga0068861_1002608351 334
35 3300005844 Ga0068862_100063093 Ga0068862_1000630932 334
36 3300026118 Ga0207675_100197669 Ga0207675_1001976692 334
37 3300046454 Ga0495592_0064989 Ga0495592_0064989_299_1498 334
38 3300046462 Ga0495651_0008507 Ga0495651_0008507_5641_6840 334
39 3300046476 Ga0495662_0023617 Ga0495662_0023617_1044_2243 334
40 3300046477 Ga0495664_0020394 Ga0495664_0020394_927_2126 334
41 3300046516 Ga0495628_0029809 Ga0495628_0029809_827_2026 334
42 3300046533 Ga0495640_0021097 Ga0495640_0021097_1877_3076 334
43 3300046536 Ga0495587_0008333 Ga0495587_0008333_2171_3370 334
44 3300046557 Ga0495622_0014054 Ga0495622_0014054_1415_2611 334
45 3300046642 Ga0495634_0014475 Ga0495634_0014475_2617_3816 334
46 3300046675 Ga0495657_0001697 Ga0495657_0001697_9613_10812 334
47 3300046679 Ga0495623_0001818 Ga0495623_0001818_6883_8082 334
48 3300047317 Ga0495604_0018118 Ga0495604_0018118_2037_3236 334
49 3300047322 Ga0495680_0008019 Ga0495680_0008019_2611_3810 334
50 3300047444 Ga0495675_0012583 Ga0495675_0012583_3300_4499 334
51 3300047471 Ga0495684_0031031 Ga0495684_0031031_867_2066 334
52 3300048088 Ga0495602_0046633 Ga0495602_0046633_1826_3025 334
53 3300046519 Ga0495632_0060673 Ga0495632_0060673_534_1733 335
54 3300048924 Ga0496121_0001497 Ga0496121_0001497_10204_11496 335
55 3300049460 Ga0495682_0014644 Ga0495682_0014644_1445_2644 335
56 iso_pu_bacteria 2908756301 2908757142 335
57 3300005336 Ga0070680_100169124 Ga0070680_1001691243 337
58 3300005983 Ga0081540_1009207 Ga0081540_10092074 337
59 3300025944 Ga0207661_10010489 Ga0207661_100104894 337
60 3300048925 Ga0496122_0053032 Ga0496122_0053032_1706_2959 338
61 3300005458 Ga0070681_10241874 Ga0070681_102418741 340
62 3300005530 Ga0070679_100010878 Ga0070679_1000108789 340
63 3300005563 Ga0068855_100131476 Ga0068855_1001314763 340
64 3300005719 Ga0068861_100013444 Ga0068861_1000134445 340
65 3300009174 Ga0105241_10072304 Ga0105241_100723043 340
66 3300013307 Ga0157372_10048388 Ga0157372_100483884 340
67 3300025912 Ga0207707_10000178 Ga0207707_1000017842 340
68 3300025919 Ga0207657_10110535 Ga0207657_101105353 340
69 3300025921 Ga0207652_10010016 Ga0207652_100100162 340
70 3300025949 Ga0207667_10170449 Ga0207667_101704493 340
71 3300026089 Ga0207648_10058284 Ga0207648_100582843 340
72 3300048909 Ga0496106_0064335 Ga0496106_0064335_1461_2654 340
73 3300048929 Ga0496126_0033246 Ga0496126_0033246_2415_3617 341
74 3300053117 Ga0500593_022126 Ga0500593_022126_535_1881 341
75 3300005985 Ga0081539_10055939 Ga0081539_100559392 342
76 3300028380 Ga0268265_10154693 Ga0268265_101546931 342
77 3300035111 Ga0373923_0008777 Ga0373923_0008777_1195_2547 342
78 3300035117 Ga0373953_0010738 Ga0373953_0010738_388_1740 342
79 3300049579 Ga0501043_0141721 Ga0501043_0141721_113_1498 342
80 3300035118 Ga0373954_0018253 Ga0373954_0018253_1688_3040 343
81 3300035119 Ga0373956_0009264 Ga0373956_0009264_2466_3818 343
82 3300035724 Ga0373933_0011029 Ga0373933_0011029_1650_3002 343
83 3300037068 Ga0373925_0021132 Ga0373925_0021132_577_1929 343
84 3300046454 Ga0495592_0034801 Ga0495592_0034801_1088_2440 343
85 3300046472 Ga0495580_0020227 Ga0495580_0020227_2384_3736 343
86 3300046473 Ga0495582_0005947 Ga0495582_0005947_1354_2706 343
87 3300046475 Ga0495639_0022505 Ga0495639_0022505_86_1438 343
88 3300046514 Ga0495618_0076562 Ga0495618_0076562_462_1814 343
89 3300046517 Ga0495630_0068346 Ga0495630_0068346_882_2234 343
90 3300046531 Ga0495665_0025542 Ga0495665_0025542_413_1765 343
91 3300046683 Ga0495658_0006723 Ga0495658_0006723_3125_4477 343
92 3300046689 Ga0495613_0067029 Ga0495613_0067029_1192_2544 343
93 3300047319 Ga0495674_0007504 Ga0495674_0007504_4241_5593 343
94 3300047471 Ga0495684_0024690 Ga0495684_0024690_3157_4509 343
95 3300005435 Ga0070714_100050772 Ga0070714_1000507723 344
96 3300046455 Ga0495603_0063584 Ga0495603_0063584_260_1612 344
97 3300046511 Ga0495608_0061403 Ga0495608_0061403_241_1440 344
98 3300048920 Ga0496117_0081400 Ga0496117_0081400_209_1423 345
99 3300048921 Ga0496118_0084152 Ga0496118_0084152_452_1666 345
100 3300005356 Ga0070674_100005743 Ga0070674_1000057432 346
101 3300005456 Ga0070678_100062598 Ga0070678_1000625984 346
102 3300009553 Ga0105249_10113738 Ga0105249_101137381 346
103 3300017792 Ga0163161_10015384 Ga0163161_100153846 346
104 3300025937 Ga0207669_10006489 Ga0207669_100064895 346
105 3300025961 Ga0207712_10009695 Ga0207712_100096952 346
106 3300026121 Ga0207683_10018417 Ga0207683_100184172 346
107 3300048904 Ga0496101_0085912 Ga0496101_0085912_159_1454 346
108 3300048928 Ga0496125_0001251 Ga0496125_0001251_27291_28502 346
109 3300053091 Ga0500647_0048653 Ga0500647_0048653_293_1471 346
110 3300053094 Ga0500566_0000439 Ga0500566_0000439_1894_3072 346
111 3300053102 Ga0500554_021007 Ga0500554_021007_467_1687 346
112 3300053111 Ga0500572_000678 Ga0500572_000678_8186_9364 346
113 3300053119 Ga0500595_000331 Ga0500595_000331_4296_5516 346
114 3300053148 Ga0500590_050996 Ga0500590_050996_753_1931 346
115 3300053159 Ga0500630_000096 Ga0500630_000096_20024_21202 346
116 3300053162 Ga0500638_000982 Ga0500638_000982_4250_5470 346
117 3300053162 Ga0500638_002673 Ga0500638_002673_4390_5568 346
118 3300053163 Ga0500639_000014 Ga0500639_000014_36819_37997 346
119 3300053178 Ga0500637_0000236 Ga0500637_0000236_4274_5494 346
120 3300053735 Ga0500596_000211 Ga0500596_000211_6722_7900 346
121 3300055283 Ga0500661_000089 Ga0500661_000089_4826_6046 346
122 3300006881 Ga0068865_100114056 Ga0068865_1001140562 347
123 3300009545 Ga0105237_10027055 Ga0105237_100270554 347
124 3300025922 Ga0207646_10093587 Ga0207646_100935872 347
125 3300053095 Ga0500640_000465 Ga0500640_000465_6892_8070 347
126 3300025261 Ga0209233_1006561 Ga0209233_10065614 348
127 3300025910 Ga0207684_10164438 Ga0207684_101644382 348
128 3300037312 Ga0395899_0007702 Ga0395899_0007702_3399_4691 348
129 3300046684 Ga0495669_0008386 Ga0495669_0008386_1163_2464 348
130 3300009093 Ga0105240_10054802 Ga0105240_100548021 349
131 3300033442 Ga0315911_1000010 Ga0315911_1000010120 349
132 3300031730 Ga0307516_10006009 Ga0307516_100060096 350
133 3300005937 Ga0081455_10008312 Ga0081455_100083125 352
134 3300026089 Ga0207648_10201565 Ga0207648_102015651 352
135 3300031711 Ga0265314_10006246 Ga0265314_100062465 352
136 3300005548 Ga0070665_100074171 Ga0070665_1000741712 353
137 3300013297 Ga0157378_10002611 Ga0157378_100026119 353
138 3300006038 Ga0075365_10051509 Ga0075365_100515092 354
139 3300005434 Ga0070709_10010676 Ga0070709_100106765 355
140 3300025906 Ga0207699_10010698 Ga0207699_100106983 355
141 3300048929 Ga0496126_0077783 Ga0496126_0077783_451_1635 355
142 3300049574 Ga0501038_0138033 Ga0501038_0138033_151_1443 355
143 3300049581 Ga0501047_0249149 Ga0501047_0249149_279_1460 355
144 3300053119 Ga0500595_005861 Ga0500595_005861_3020_4240 355
145 3300046501 Ga0495607_0026685 Ga0495607_0026685_582_1826 356
146 3300048924 Ga0496121_0019602 Ga0496121_0019602_5269_6495 356
147 3300053094 Ga0500566_0000157 Ga0500566_0000157_30903_32153 356
148 3300053136 Ga0500559_0001538 Ga0500559_0001538_4545_5792 356
149 3300005458 Ga0070681_10192915 Ga0070681_101929152 357
150 3300005563 Ga0068855_100008500 Ga0068855_1000085004 357
151 3300005577 Ga0068857_100073345 Ga0068857_1000733453 357
152 3300005614 Ga0068856_100044127 Ga0068856_1000441273 357
153 3300006038 Ga0075365_10029139 Ga0075365_100291392 357
154 3300010375 Ga0105239_10059602 Ga0105239_100596023 357
155 3300025914 Ga0207671_10021505 Ga0207671_100215052 357
156 3300025921 Ga0207652_10035564 Ga0207652_100355645 357
157 3300025927 Ga0207687_10012709 Ga0207687_100127095 357
158 3300025949 Ga0207667_10021533 Ga0207667_100215332 357
159 3300025972 Ga0207668_10020825 Ga0207668_100208254 357
160 3300026041 Ga0207639_10195526 Ga0207639_101955261 357
161 3300028379 Ga0268266_10019218 Ga0268266_100192185 357
162 3300005347 Ga0070668_100243544 Ga0070668_1002435441 358
163 3300005458 Ga0070681_10028014 Ga0070681_100280142 358
164 3300005543 Ga0070672_100055422 Ga0070672_1000554224 358
165 3300005844 Ga0068862_100063940 Ga0068862_1000639403 358
166 3300014326 Ga0157380_10093924 Ga0157380_100939241 358
167 3300014969 Ga0157376_10219048 Ga0157376_102190481 358
168 3300025940 Ga0207691_10055407 Ga0207691_100554073 358
169 3300048924 Ga0496121_0018554 Ga0496121_0018554_1511_2761 358
170 3300049570 Ga0501033_0056939 Ga0501033_0056939_1453_2682 358
171 3300053093 Ga0500651_0005279 Ga0500651_0005279_2593_3813 358
172 3300037466 Ga0395898_0028013 Ga0395898_0028013_914_2182 359
173 3300048923 Ga0496120_0044043 Ga0496120_0044043_724_1947 359
174 3300053130 Ga0500642_0003432 Ga0500642_0003432_2125_3345 359
175 3300025924 Ga0207694_10096789 Ga0207694_100967893 360
176 3300031901 Ga0307406_10094820 Ga0307406_100948202 360
177 3300005983 Ga0081540_1062191 Ga0081540_10621912 361
178 3300031249 Ga0265339_10000560 Ga0265339_1000056023 361
179 3300033179 Ga0307507_10108837 Ga0307507_101088372 361
180 3300048923 Ga0496120_0048527 Ga0496120_0048527_120_1367 361
181 3300048928 Ga0496125_0000154 Ga0496125_0000154_64682_65893 361
182 3300049571 Ga0501034_0086342 Ga0501034_0086342_1606_2808 361
183 3300049581 Ga0501047_0012149 Ga0501047_0012149_6591_7793 361
184 iso_pu_bacteria 2904699407 2904705919 361
185 3300025295 Ga0209564_1000485 Ga0209564_100048541 362
186 3300053104 Ga0500556_0000413 Ga0500556_0000413_28369_29622 362
187 3300005338 Ga0068868_100049363 Ga0068868_1000493633 363
188 3300005347 Ga0070668_100006702 Ga0070668_1000067023 363
189 3300005354 Ga0070675_100040405 Ga0070675_1000404052 363
190 3300005563 Ga0068855_100127686 Ga0068855_1001276863 363
191 3300009174 Ga0105241_10015674 Ga0105241_100156743 363
192 3300025908 Ga0207643_10067505 Ga0207643_100675051 363
193 3300026067 Ga0207678_10016644 Ga0207678_100166444 363
194 3300026067 Ga0207678_10041547 Ga0207678_100415474 363
195 3300028380 Ga0268265_10217415 Ga0268265_102174151 363
196 3300046515 Ga0495620_0016815 Ga0495620_0016815_1721_2968 363
197 3300046520 Ga0495637_0037923 Ga0495637_0037923_596_1843 363
198 3300046665 Ga0495661_0012341 Ga0495661_0012341_4184_5431 363
199 3300047472 Ga0495686_0010918 Ga0495686_0010918_1401_2648 363
200 3300048904 Ga0496101_0061495 Ga0496101_0061495_1375_2637 363
201 3300048912 Ga0496109_0055801 Ga0496109_0055801_1070_2332 363
202 3300048915 Ga0496112_0071870 Ga0496112_0071870_1929_3140 363
203 3300048921 Ga0496118_0025076 Ga0496118_0025076_3806_5047 363
204 3300050492 nmdc:mga0yw44_10401_c1 nmdc:mga0yw44_10401_c1_1580_2842 363
205 3300053086 Ga0500578_0080540 Ga0500578_0080540_616_1863 363
206 3300053087 Ga0500643_010680 Ga0500643_010680_746_1993 363
207 3300053093 Ga0500651_0008860 Ga0500651_0008860_1550_2797 363
208 3300053096 Ga0500641_0061754 Ga0500641_0061754_210_1457 363
209 3300053098 Ga0500650_0000424 Ga0500650_0000424_740_1987 363
210 3300053131 Ga0500652_000113 Ga0500652_000113_8820_10067 363
211 3300053139 Ga0500568_0002393 Ga0500568_0002393_1496_2743 363
212 3300053151 Ga0500604_0004894 Ga0500604_0004894_817_2064 363
213 3300053151 Ga0500604_0025262 Ga0500604_0025262_238_1476 363
214 3300053153 Ga0500616_0000180 Ga0500616_0000180_103224_104471 363
215 iso_pu_bacteria 2791355199 2793083654 363
216 3300031235 Ga0265330_10012656 Ga0265330_100126563 364
217 3300031235 Ga0265330_10023235 Ga0265330_100232353 364
218 3300031238 Ga0265332_10008603 Ga0265332_100086034 364
219 3300031241 Ga0265325_10003305 Ga0265325_100033056 364
220 3300031247 Ga0265340_10049511 Ga0265340_100495112 364
221 3300031712 Ga0265342_10020622 Ga0265342_100206223 364
222 3300046543 Ga0495645_0048841 Ga0495645_0048841_1863_3071 364
223 3300053130 Ga0500642_0000005 Ga0500642_0000005_1514_2761 364
224 3300053161 Ga0500634_0051356 Ga0500634_0051356_395_1633 364
225 3300053177 Ga0500636_0071340 Ga0500636_0071340_20_1240 364
226 3300053177 Ga0500636_0097817 Ga0500636_0097817_141_1370 364
227 iso_pu_bacteria 2893066018 2893069415 364
228 3300005548 Ga0070665_100167440 Ga0070665_1001674402 365
229 3300046473 Ga0495582_0083497 Ga0495582_0083497_271_1539 365
230 3300053142 Ga0500577_0000088 Ga0500577_0000088_18234_19505 365
231 3300028786 Ga0307517_10003969 Ga0307517_1000396924 366
232 3300046684 Ga0495669_0050996 Ga0495669_0050996_659_1828 366
233 3300049823 Ga0501044_0024727 Ga0501044_0024727_4046_5275 366
234 iso_pu_bacteria 2602042107 2603862597 366
235 iso_pu_bacteria 2857524615 2857529939 366
236 iso_pu_bacteria 2919073203 2919077205 366
237 3300028379 Ga0268266_10049188 Ga0268266_100491883 367
238 3300035117 Ga0373953_0004950 Ga0373953_0004950_2720_3970 367
239 3300047322 Ga0495680_0017598 Ga0495680_0017598_4625_5875 367
240 3300003215 JGI25153J46596_10037976 JGI25153J46596_100379761 368
241 3300025297 Ga0209758_1002269 Ga0209758_100226913 368
242 3300046524 Ga0495648_0002325 Ga0495648_0002325_10279_11508 368
243 3300047320 Ga0495672_0050147 Ga0495672_0050147_401_1609 368
244 iso_pu_bacteria 2524023205 2524438162 368
245 3300005564 Ga0070664_100083584 Ga0070664_1000835842 369
246 3300005578 Ga0068854_100209236 Ga0068854_1002092362 369
247 3300025901 Ga0207688_10036334 Ga0207688_100363343 369
248 3300025945 Ga0207679_10032499 Ga0207679_100324994 369
249 3300025981 Ga0207640_10184277 Ga0207640_101842772 369
250 3300028794 Ga0307515_10102117 Ga0307515_101021173 369
251 3300035692 Ga0373935_0130083 Ga0373935_0130083_93_1319 370
252 3300046516 Ga0495628_0066349 Ga0495628_0066349_1024_2250 370
253 3300046675 Ga0495657_0028991 Ga0495657_0028991_1785_3011 370
254 3300046678 Ga0495599_0040757 Ga0495599_0040757_1608_2834 370
255 3300047317 Ga0495604_0003151 Ga0495604_0003151_7742_8968 370
256 3300047472 Ga0495686_0059588 Ga0495686_0059588_182_1396 370
257 3300053119 Ga0500595_003271 Ga0500595_003271_4211_5425 370
258 iso_pu_bacteria 2885374607 2885378030 370
259 iso_pu_bacteria 2908739725 2908745084 370
260 3300046511 Ga0495608_0026929 Ga0495608_0026929_2352_3578 371
261 3300046678 Ga0495599_0010540 Ga0495599_0010540_219_1451 371
262 3300053077 Ga0495601_0020707 Ga0495601_0020707_143_1375 371
263 iso_pu_bacteria 2888388044 2888389148 371
264 3300026067 Ga0207678_10036799 Ga0207678_100367993 372
265 3300026075 Ga0207708_10034452 Ga0207708_100344524 372
266 3300046514 Ga0495618_0051235 Ga0495618_0051235_1333_2559 372
267 3300046535 Ga0495586_0082962 Ga0495586_0082962_146_1372 372
268 iso_pu_bacteria 2906635258 2906641665 372
269 3300026067 Ga0207678_10047996 Ga0207678_100479963 373
270 3300030521 Ga0307511_10120867 Ga0307511_101208671 373
271 3300046512 Ga0495610_0048137 Ga0495610_0048137_374_1711 373
272 3300046533 Ga0495640_0024411 Ga0495640_0024411_2893_4122 373
273 3300048914 Ga0496111_0059046 Ga0496111_0059046_1414_2724 373
274 3300035172 Ga0373955_0017147 Ga0373955_0017147_466_1698 374
275 3300046462 Ga0495651_0032781 Ga0495651_0032781_477_1709 374
276 3300046463 Ga0495653_0007319 Ga0495653_0007319_5106_6338 374
277 3300046679 Ga0495623_0008919 Ga0495623_0008919_1053_2285 374
278 3300047471 Ga0495684_0004204 Ga0495684_0004204_3547_4779 374
279 3300047673 Ga0495593_0006898 Ga0495593_0006898_5194_6426 374
280 3300049579 Ga0501043_0109216 Ga0501043_0109216_504_1736 374
281 3300049581 Ga0501047_0029310 Ga0501047_0029310_399_1631 374
282 iso_pu_bacteria 2524023210 2524468826 374
283 3300005329 Ga0070683_100281594 Ga0070683_1002815941 375
284 3300005338 Ga0068868_100058770 Ga0068868_1000587702 375
285 3300009098 Ga0105245_10027777 Ga0105245_100277773 375
286 3300010375 Ga0105239_10069917 Ga0105239_100699173 375
287 3300011119 Ga0105246_10012667 Ga0105246_100126673 375
288 3300013306 Ga0163162_10109662 Ga0163162_101096623 375
289 3300013308 Ga0157375_10038948 Ga0157375_100389485 375
290 3300014325 Ga0163163_10099723 Ga0163163_100997233 375
291 3300014969 Ga0157376_10098042 Ga0157376_100980423 375
292 3300026121 Ga0207683_10030668 Ga0207683_100306683 375
293 3300026121 Ga0207683_10267450 Ga0207683_102674501 375
294 3300028379 Ga0268266_10021703 Ga0268266_100217032 375
295 3300035119 Ga0373956_0005202 Ga0373956_0005202_2160_3362 375
296 3300046529 Ga0495652_0009678 Ga0495652_0009678_2931_4163 375
297 3300046543 Ga0495645_0128050 Ga0495645_0128050_287_1519 375
298 3300047319 Ga0495674_0013371 Ga0495674_0013371_5401_6603 375
299 3300048903 Ga0496100_0004736 Ga0496100_0004736_339_1559 375
300 3300048904 Ga0496101_0003216 Ga0496101_0003216_7440_8660 375
301 3300048905 Ga0496102_0032936 Ga0496102_0032936_1904_3124 375
302 3300048907 Ga0496104_0032401 Ga0496104_0032401_1708_2928 375
303 3300048908 Ga0496105_0073318 Ga0496105_0073318_175_1395 375
304 3300048909 Ga0496106_0005945 Ga0496106_0005945_3682_4902 375
305 3300048910 Ga0496107_0058166 Ga0496107_0058166_124_1344 375
306 3300048911 Ga0496108_0108933 Ga0496108_0108933_1069_2289 375
307 3300048912 Ga0496109_0061455 Ga0496109_0061455_1329_2549 375
308 3300048913 Ga0496110_0024761 Ga0496110_0024761_795_2015 375
309 3300048914 Ga0496111_0033593 Ga0496111_0033593_137_1357 375
310 3300048915 Ga0496112_0109419 Ga0496112_0109419_1012_2232 375
311 3300048917 Ga0496114_0045013 Ga0496114_0045013_2181_3401 375
312 3300048918 Ga0496115_0217714 Ga0496115_0217714_116_1339 375
313 3300025981 Ga0207640_10119091 Ga0207640_101190912 376
314 iso_pu_bacteria 2667528175 2671119192 376
315 iso_pu_bacteria 2903748898 2903749620 376
316 iso_pu_bacteria 8019565922 8019569697 376
317 iso_pu_bacteria 8056689827 8056695196 376
318 3300028794 Ga0307515_10182430 Ga0307515_101824301 377
319 3300031456 Ga0307513_10151459 Ga0307513_101514591 377
320 iso_pu_bacteria 2791355197 2793071250 377
321 iso_pu_bacteria 2906610324 2906611497 377
322 iso_pu_bacteria 2922425934 2922427858 377
323 iso_pu_bacteria 2935630451 2935632206 377
324 iso_pu_bacteria 2941507105 2941508154 377
325 iso_pu_bacteria 2941515067 2941515341 377
326 iso_pu_bacteria 2941523033 2941524084 377
327 iso_pu_bacteria 3005474847 3005477569 377
328 3300026118 Ga0207675_100015802 Ga0207675_1000158024 378
329 iso_pu_bacteria 2513237096 2513655061 378
330 iso_pu_bacteria 2513237137 2513861082 378
331 iso_pu_bacteria 2513237145 2513915916 378
332 iso_pu_bacteria 2517572143 2517894779 378
333 iso_pu_bacteria 2906660503 2906660767 378
334 iso_pu_bacteria 8006933436 8006933659 378
335 iso_pu_bacteria 8006973647 8006983331 378
336 3300053140 Ga0500573_0003895 Ga0500573_0003895_593_1816 379
337 iso_pu_bacteria 2513237098 2513678515 379
338 3300005354 Ga0070675_100187683 Ga0070675_1001876831 380
339 3300006042 Ga0075368_10047595 Ga0075368_100475952 380
340 3300007788 Ga0099795_10007795 Ga0099795_100077953 380
341 3300025926 Ga0207659_10138332 Ga0207659_101383322 380
342 3300031616 Ga0307508_10082443 Ga0307508_100824431 380
343 3300046642 Ga0495634_0005809 Ga0495634_0005809_252_1502 380
344 3300049568 Ga0501031_0009269 Ga0501031_0009269_3009_4262 380
345 3300049569 Ga0501032_0000421 Ga0501032_0000421_5051_6304 380
346 3300049570 Ga0501033_0000124 Ga0501033_0000124_54262_55515 380
347 3300049571 Ga0501034_0014541 Ga0501034_0014541_1571_2824 380
348 3300049572 Ga0501036_0001379 Ga0501036_0001379_17333_18586 380
349 3300049573 Ga0501037_0002855 Ga0501037_0002855_1217_2470 380
350 3300049574 Ga0501038_0000041 Ga0501038_0000041_18553_19806 380
351 3300049575 Ga0501039_0000472 Ga0501039_0000472_4758_6011 380
352 3300049578 Ga0501042_0091935 Ga0501042_0091935_333_1586 380
353 3300049581 Ga0501047_0001740 Ga0501047_0001740_6901_8154 380
354 3300049582 Ga0501048_0016125 Ga0501048_0016125_1485_2738 380
355 3300049583 Ga0501067_0053885 Ga0501067_0053885_458_1711 380
356 3300049584 Ga0501068_0021817 Ga0501068_0021817_2435_3688 380
357 3300049586 Ga0501070_0000175 Ga0501070_0000175_55902_57155 380
358 3300049587 Ga0501071_0045200 Ga0501071_0045200_1205_2458 380
359 3300049589 Ga0501073_0044719 Ga0501073_0044719_1432_2685 380
360 3300049741 Ga0501079_0046896 Ga0501079_0046896_1046_2299 380
361 3300049742 Ga0501080_0000638 Ga0501080_0000638_17105_18358 380
362 3300049823 Ga0501044_0000393 Ga0501044_0000393_4558_5811 380
363 3300049824 Ga0501045_0014907 Ga0501045_0014907_1490_2743 380
364 3300007788 Ga0099795_10003118 Ga0099795_100031185 381
365 3300025937 Ga0207669_10172056 Ga0207669_101720562 381
366 3300027512 Ga0209179_1013424 Ga0209179_10134241 381
367 3300027671 Ga0209588_1014312 Ga0209588_10143121 381
368 3300009177 Ga0105248_10024128 Ga0105248_100241283 382
369 iso_pu_bacteria 2876808645 2876810228 383
370 iso_pu_bacteria 2879110137 2879118071 383
371 3300050490 nmdc:mga03n38_7444_c1 nmdc:mga03n38_7444_c1_651_1853 384
372 3300027512 Ga0209179_1000968 Ga0209179_10009684 385
373 3300048909 Ga0496106_0002192 Ga0496106_0002192_388_1590 385
374 3300048910 Ga0496107_0079987 Ga0496107_0079987_407_1609 385
375 3300048911 Ga0496108_0009100 Ga0496108_0009100_787_1989 385
376 3300048912 Ga0496109_0000958 Ga0496109_0000958_20866_22068 385
377 3300048915 Ga0496112_0037145 Ga0496112_0037145_2028_3230 385
378 3300048916 Ga0496113_0037488 Ga0496113_0037488_16_1218 385
379 3300053084 Ga0495595_0094977 Ga0495595_0094977_143_1378 385
380 iso_pu_bacteria 2885383462 2885384519 385
381 iso_pu_bacteria 8056681323 8056682357 385
382 3300009545 Ga0105237_10144158 Ga0105237_101441582 386
383 3300010159 Ga0099796_10050487 Ga0099796_100504871 390
384 3300005344 Ga0070661_100046454 Ga0070661_1000464542 391
385 3300046507 Ga0495606_0000960 Ga0495606_0000960_37185_38453 399
386 3300003203 JGI25406J46586_10000068 JGI25406J46586_100000686 400
387 3300003203 JGI25406J46586_10000309 JGI25406J46586_100003097 400
388 3300005985 Ga0081539_10000321 Ga0081539_1000032157 400
389 3300048915 Ga0496112_0000037 Ga0496112_0000037_37013_38266 400

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06904

Extensin-like_C

Extensin-like protein C-terminus

203

371

0.93

Feature Viewer

pLDDT pTM Quality
52.01 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map