F431529

General Info

Members Datasets Scaffolds Average Seq Length
389 195 778 251

Family's Representative Sequence

Representative Sequence 3300046461|Ga0495641_0079785|Ga0495641_0079785_99_992
Length 289
Sequence VDRAGLRDLPDRVRGDPPCPVEPALVRVRIPQHPVDDRVRAMADVETTRDGAVLTITLNRPDSYNAFTTSMHAAAGDEIRAVVITGAGKGFCAGQDLGEFRELDHDVGEHLEATYHPNVRAIRALEKPVIAAVNGAAAGAGLSLACVCDYRIAADNAAFVPGFIGIGLVPDSGGSWFLTRLLGPSRAFTWMSSNRKLSAPEALAWGLVDEVVEADELDARAAELAADYASRPTRGIGMSKRLFDHAQNATLDEQLAFEGELQTEATKTSDFAEGVSAFLEKRPPNFTGR

Samples

Sample ID Description Type Environment
1 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
124 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
125 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
126 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
127 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
128 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.29
Nodule 0
Rhizoplane 15.68
Rhizosphere 81.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495641_0079785 3300046461 Bacteria 1466
2 JGI25407J50210_10000662 3300003373 Bacteria 7108
3 JGI25407J50210_10004596 3300003373 Bacteria 3360
4 Ga0070658_10003469 3300005327 Bacteria 12957
5 Ga0070683_100017812 3300005329 Bacteria 6277
6 Ga0070683_100102501 3300005329 Bacteria 2696
7 Ga0068869_100031994 3300005334 Bacteria 3704
8 Ga0070680_100278945 3300005336 Bacteria 1416
9 Ga0070682_100066177 3300005337 Bacteria 2298
10 Ga0068868_100062038 3300005338 Bacteria 2962
11 Ga0068868_100227144 3300005338 Bacteria 1565
12 Ga0070660_100002106 3300005339 Bacteria 13727
13 Ga0070660_100043222 3300005339 Bacteria 3443
14 Ga0070660_100125614 3300005339 Bacteria 2050
15 Ga0070689_100009219 3300005340 Bacteria 6987
16 Ga0070661_100047303 3300005344 Bacteria 3148
17 Ga0070675_100360629 3300005354 Bacteria 1290
18 Ga0070659_100216779 3300005366 Bacteria 1579
19 Ga0070709_10539076 3300005434 Bacteria 891
20 Ga0070714_100003133 3300005435 Bacteria 12281
21 Ga0070713_100028085 3300005436 Bacteria 4439
22 Ga0070713_100342900 3300005436 Bacteria 1385
23 Ga0070710_10167185 3300005437 Bacteria 1368
24 Ga0070711_100101653 3300005439 Bacteria 2092
25 Ga0070705_100004193 3300005440 Bacteria 7042
26 Ga0070708_100381958 3300005445 Bacteria 1328
27 Ga0070663_100031769 3300005455 Bacteria 3632
28 Ga0070678_100035495 3300005456 Bacteria 3482
29 Ga0070678_100111771 3300005456 Bacteria 2138
30 Ga0070678_100113854 3300005456 Bacteria 2121
31 Ga0070678_100290924 3300005456 Bacteria 1385
32 Ga0070681_10005169 3300005458 Bacteria 12592
33 Ga0070681_10029302 3300005458 Bacteria 5527
34 Ga0070681_10271971 3300005458 Bacteria 1606
35 Ga0068867_100041276 3300005459 Bacteria 3371
36 Ga0070706_100417745 3300005467 Bacteria 1248
37 Ga0070706_100647724 3300005467 Bacteria 981
38 Ga0070698_100008428 3300005471 Bacteria 11143
39 Ga0070698_100071836 3300005471 Bacteria 3470
40 Ga0070699_100188451 3300005518 Bacteria 1832
41 Ga0070679_100009415 3300005530 Bacteria 9240
42 Ga0070679_100025331 3300005530 Bacteria 5820
43 Ga0070684_100015239 3300005535 Bacteria 6253
44 Ga0070684_100071811 3300005535 Bacteria 3046
45 Ga0070684_100304201 3300005535 Bacteria 1463
46 Ga0070684_100508943 3300005535 Bacteria 1115
47 Ga0068853_100128931 3300005539 Bacteria 2262
48 Ga0070672_100043073 3300005543 Bacteria 3478
49 Ga0070695_100522522 3300005545 Bacteria 921
50 Ga0070696_100119639 3300005546 Bacteria 1905
51 Ga0070693_100004929 3300005547 Bacteria 6373
52 Ga0070704_100018974 3300005549 Bacteria 4412
53 Ga0070704_100344614 3300005549 Bacteria 1256
54 Ga0068855_100126435 3300005563 Bacteria 2922
55 Ga0070664_100190540 3300005564 Bacteria 1827
56 Ga0070702_100199211 3300005615 Bacteria 1324
57 Ga0068859_100314539 3300005617 Bacteria 1660
58 Ga0068861_100058985 3300005719 Bacteria 2937
59 Ga0068863_100057104 3300005841 Bacteria 3694
60 Ga0068858_100031499 3300005842 Bacteria 4926
61 Ga0068862_100177163 3300005844 Bacteria 1912
62 Ga0081455_10047414 3300005937 Bacteria 3722
63 Ga0081455_10099366 3300005937 Bacteria 2341
64 Ga0081538_10000052 3300005981 Bacteria 109642
65 Ga0081538_10000518 3300005981 Bacteria 43151
66 Ga0081538_10000921 3300005981 Bacteria 31717
67 Ga0081538_10002738 3300005981 Bacteria 16921
68 Ga0081538_10056653 3300005981 Bacteria 2293
69 Ga0081538_10072646 3300005981 Bacteria 1885
70 Ga0081540_1021518 3300005983 Bacteria 3836
71 Ga0081539_10008240 3300005985 Bacteria 9158
72 Ga0070717_10033080 3300006028 Bacteria 4169
73 Ga0075365_10032550 3300006038 Bacteria 3352
74 Ga0075365_10039815 3300006038 Bacteria 3062
75 Ga0070716_100114308 3300006173 Bacteria 1678
76 Ga0097621_100031170 3300006237 Bacteria 4229
77 Ga0068871_100092249 3300006358 Bacteria 2525
78 Ga0075428_100010505 3300006844 Bacteria 10287
79 Ga0075428_100163387 3300006844 Bacteria 2416
80 Ga0075428_100177925 3300006844 Bacteria 2303
81 Ga0075430_100048297 3300006846 Bacteria 3594
82 Ga0075430_100392274 3300006846 Bacteria 1145
83 Ga0075431_100154459 3300006847 Bacteria 2362
84 Ga0075431_100210628 3300006847 Bacteria 1985
85 Ga0075431_100411489 3300006847 Bacteria 1352
86 Ga0075434_100355377 3300006871 Bacteria 1486
87 Ga0075429_100010892 3300006880 Bacteria 7865
88 Ga0075429_100044144 3300006880 Bacteria 3877
89 Ga0075429_100089776 3300006880 Bacteria 2679
90 Ga0097620_100314533 3300006931 Bacteria 1660
91 Ga0105240_10017656 3300009093 Bacteria 9607
92 Ga0105240_10732779 3300009093 Bacteria 1076
93 Ga0111539_10221885 3300009094 Bacteria 2201
94 Ga0111539_10322274 3300009094 Bacteria 1798
95 Ga0111539_10389285 3300009094 Bacteria 1623
96 Ga0105245_10026148 3300009098 Bacteria 5136
97 Ga0105245_10341389 3300009098 Bacteria 1481
98 Ga0105245_10579172 3300009098 Bacteria 1147
99 Ga0114129_10009275 3300009147 Bacteria 14030
100 Ga0114129_10100698 3300009147 Bacteria 3998
101 Ga0114129_10730767 3300009147 Bacteria 1269
102 Ga0105241_10707877 3300009174 Bacteria 920
103 Ga0105242_10589652 3300009176 Bacteria 1072
104 Ga0105248_10303034 3300009177 Bacteria 1799
105 Ga0105238_10973266 3300009551 Bacteria 869
106 Ga0105239_10131576 3300010375 Bacteria 2783
107 Ga0105239_10244348 3300010375 Bacteria 2015
108 Ga0157373_10043262 3300013100 Bacteria 3218
109 Ga0157373_10330252 3300013100 Bacteria 1086
110 Ga0157370_10015828 3300013104 Bacteria 7653
111 Ga0157370_10027050 3300013104 Bacteria 5656
112 Ga0157369_10033325 3300013105 Bacteria 5661
113 Ga0157369_10115945 3300013105 Bacteria 2845
114 Ga0157378_10248556 3300013297 Bacteria 1702
115 Ga0163162_10156381 3300013306 Bacteria 2400
116 Ga0163162_10479164 3300013306 Bacteria 1376
117 Ga0157372_10263171 3300013307 Bacteria 2003
118 Ga0157372_11314083 3300013307 Bacteria 834
119 Ga0157375_10465620 3300013308 Bacteria 1429
120 Ga0163163_10367175 3300014325 Bacteria 1496
121 Ga0157380_10204331 3300014326 Bacteria 1755
122 Ga0157376_10044341 3300014969 Bacteria 3655
123 Ga0157376_10434310 3300014969 Bacteria 1277
124 Ga0163161_10247693 3300017792 Bacteria 1388
125 Ga0206356_10908635 3300020070 Bacteria 2768
126 Ga0206353_11386084 3300020082 Bacteria 6683
127 Ga0207692_10060248 3300025898 Bacteria 1962
128 Ga0207647_10031247 3300025904 Bacteria 3428
129 Ga0207705_10139376 3300025909 Bacteria 1810
130 Ga0207705_10160303 3300025909 Bacteria 1690
131 Ga0207654_10071980 3300025911 Bacteria 2057
132 Ga0207707_10005792 3300025912 Bacteria 10807
133 Ga0207693_10176502 3300025915 Bacteria 1681
134 Ga0207663_10018297 3300025916 Bacteria 3924
135 Ga0207660_10109726 3300025917 Bacteria 2074
136 Ga0207657_10008993 3300025919 Bacteria 10087
137 Ga0207657_10009023 3300025919 Bacteria 10069
138 Ga0207657_10030157 3300025919 Bacteria 4927
139 Ga0207657_10080021 3300025919 Bacteria 2748
140 Ga0207652_10004740 3300025921 Bacteria 11025
141 Ga0207652_10014981 3300025921 Bacteria 6289
142 Ga0207652_10063869 3300025921 Bacteria 3185
143 Ga0207664_10001609 3300025929 Bacteria 14849
144 Ga0207664_10232109 3300025929 Bacteria 1604
145 Ga0207690_10222399 3300025932 Bacteria 1445
146 Ga0207706_10226206 3300025933 Bacteria 1637
147 Ga0207706_10290926 3300025933 Bacteria 1424
148 Ga0207670_10033469 3300025936 Bacteria 3312
149 Ga0207665_10015212 3300025939 Bacteria 5053
150 Ga0207665_10402009 3300025939 Bacteria 1043
151 Ga0207691_10013703 3300025940 Bacteria 7748
152 Ga0207661_10074133 3300025944 Bacteria 2789
153 Ga0207661_10131811 3300025944 Bacteria 2142
154 Ga0207661_10224379 3300025944 Bacteria 1662
155 Ga0207679_10093652 3300025945 Bacteria 2331
156 Ga0207667_10067153 3300025949 Bacteria 3736
157 Ga0207667_10191560 3300025949 Bacteria 2098
158 Ga0207667_10542807 3300025949 Bacteria 1176
159 Ga0207712_10159315 3300025961 Bacteria 1752
160 Ga0207677_10179518 3300026023 Bacteria 1664
161 Ga0207702_10007589 3300026078 Bacteria 9234
162 Ga0207648_10172481 3300026089 Bacteria 1912
163 Ga0207676_10261635 3300026095 Bacteria 1562
164 Ga0207674_10216049 3300026116 Bacteria 1866
165 Ga0207675_100043859 3300026118 Bacteria 4177
166 Ga0207675_100232752 3300026118 Bacteria 1778
167 Ga0207683_10000689 3300026121 Bacteria 30988
168 Ga0207683_10061991 3300026121 Bacteria 3293
169 Ga0207683_10067027 3300026121 Bacteria 3166
170 Ga0207683_10561074 3300026121 Bacteria 1056
171 Ga0207698_10052327 3300026142 Bacteria 3128
172 Ga0268266_10060042 3300028379 Bacteria 3277
173 Ga0268264_10145222 3300028381 Bacteria 2120
174 Ga0265334_10045218 3300028573 Bacteria 1706
175 Ga0265320_10051702 3300031240 Bacteria 1992
176 Ga0307408_100216634 3300031548 Bacteria 1560
177 Ga0307416_100022914 3300032002 Bacteria 4520
178 Ga0307415_100609904 3300032126 Bacteria 973
179 Ga0373943_0036242 3300035170 Bacteria 2362
180 Ga0373925_0662622 3300037068 Bacteria 860
181 Ga0395899_0032528 3300037312 Bacteria 3918
182 Ga0395899_0050151 3300037312 Bacteria 3100
183 Ga0395899_0067228 3300037312 Bacteria 2630
184 Ga0395899_0103254 3300037312 Bacteria 2056
185 Ga0395899_0103257 3300037312 Bacteria 2056
186 Ga0395899_0137225 3300037312 Bacteria 1743
187 Ga0395899_0252904 3300037312 Bacteria 1208
188 Ga0395899_0353911 3300037312 Bacteria 981
189 Ga0395900_0005435 3300037418 Bacteria 13348
190 Ga0395900_0005871 3300037418 Bacteria 12817
191 Ga0395900_0013842 3300037418 Bacteria 8231
192 Ga0395900_0069858 3300037418 Bacteria 3610
193 Ga0395900_0080354 3300037418 Bacteria 3350
194 Ga0395900_0111616 3300037418 Bacteria 2808
195 Ga0395900_0132849 3300037418 Bacteria 2550
196 Ga0395900_0139115 3300037418 Bacteria 2487
197 Ga0395900_0287722 3300037418 Bacteria 1633
198 Ga0395900_0341472 3300037418 Bacteria 1473
199 Ga0395900_0465837 3300037418 Bacteria 1218
200 Ga0395898_0004415 3300037466 Bacteria 15390
201 Ga0395898_0014859 3300037466 Bacteria 7992
202 Ga0395898_0022392 3300037466 Bacteria 6399
203 Ga0395898_0028397 3300037466 Bacteria 5606
204 Ga0395898_0034297 3300037466 Bacteria 5059
205 Ga0395898_0065396 3300037466 Bacteria 3525
206 Ga0395898_0076143 3300037466 Bacteria 3240
207 Ga0395898_0103866 3300037466 Bacteria 2726
208 Ga0395898_0108473 3300037466 Bacteria 2662
209 Ga0395898_0152094 3300037466 Bacteria 2214
210 Ga0395898_0648030 3300037466 Bacteria 999
211 Ga0395898_0704770 3300037466 Bacteria 951
212 Ga0395905_0005063 3300037471 Bacteria 13564
213 Ga0395905_0055299 3300037471 Bacteria 3714
214 Ga0395905_0058152 3300037471 Bacteria 3616
215 Ga0395905_0061462 3300037471 Bacteria 3514
216 Ga0395905_0077623 3300037471 Bacteria 3112
217 Ga0395905_0114730 3300037471 Bacteria 2531
218 Ga0395905_0212540 3300037471 Bacteria 1812
219 Ga0395905_0345690 3300037471 Bacteria 1379
220 Ga0395901_0003449 3300038443 Bacteria 15941
221 Ga0395901_0005816 3300038443 Bacteria 12489
222 Ga0395901_0007899 3300038443 Bacteria 10732
223 Ga0395901_0023124 3300038443 Bacteria 6371
224 Ga0395901_0027791 3300038443 Bacteria 5817
225 Ga0395901_0033611 3300038443 Bacteria 5295
226 Ga0395901_0042590 3300038443 Bacteria 4708
227 Ga0395901_0057045 3300038443 Bacteria 4062
228 Ga0395901_0072879 3300038443 Bacteria 3581
229 Ga0395901_0190767 3300038443 Bacteria 2149
230 Ga0395901_0202047 3300038443 Bacteria 2083
231 Ga0395901_0353292 3300038443 Bacteria 1517
232 Ga0395901_0522799 3300038443 Bacteria 1205
233 Ga0395901_0523367 3300038443 Bacteria 1204
234 Ga0451793_1629930 3300041452 Bacteria 2883
235 Ga0451835_0509244 3300041492 Bacteria 1556
236 Ga0451839_0529865 3300041496 Bacteria 2706
237 Ga0451849_1515604 3300041505 Bacteria 1955
238 Ga0451851_0521764 3300041507 Bacteria 2729
239 Ga0451855_0338644 3300041511 Bacteria 3889
240 Ga0451853_1023761 3300041512 Bacteria 1242
241 Ga0451853_2617189 3300041512 Bacteria 1977
242 Ga0450918_012940 3300042531 Bacteria 1452
243 Ga0466963_0006171 3300044694 Bacteria 7073
244 Ga0466963_0043002 3300044694 Bacteria 2968
245 Ga0466963_0070172 3300044694 Bacteria 2356
246 Ga0466964_0017204 3300044706 Bacteria 2767
247 Ga0466964_0026244 3300044706 Bacteria 2280
248 Ga0466964_0053952 3300044706 Bacteria 1656
249 Ga0466968_0162635 3300044735 Bacteria 1031
250 Ga0466957_0099267 3300044842 Bacteria 1833
251 Ga0466960_0031808 3300044901 Bacteria 2437
252 Ga0466959_0082205 3300045049 Bacteria 2321
253 Ga0466958_0020929 3300045836 Bacteria 3818
254 Ga0466958_0041124 3300045836 Bacteria 2780
255 Ga0466967_0004455 3300045976 Bacteria 9448
256 Ga0466967_0040743 3300045976 Bacteria 4000
257 Ga0466967_0053234 3300045976 Bacteria 3556
258 Ga0466967_0097640 3300045976 Bacteria 2681
259 Ga0466967_0202878 3300045976 Bacteria 1878
260 Ga0466967_0393412 3300045976 Bacteria 1347
261 Ga0495653_0068258 3300046463 Bacteria 2667
262 Ga0495630_0191069 3300046517 Bacteria 1562
263 Ga0495630_0553154 3300046517 Bacteria 882
264 Ga0495667_0035948 3300046559 Bacteria 3309
265 Ga0495634_0047302 3300046642 Bacteria 2900
266 Ga0495634_0051620 3300046642 Bacteria 2759
267 Ga0495635_0153695 3300046663 Bacteria 1567
268 Ga0495613_0172970 3300046689 Bacteria 1532
269 Ga0495674_0222445 3300047319 Bacteria 1560
270 Ga0496100_0019535 3300048903 Bacteria 4045
271 Ga0496100_0138728 3300048903 Bacteria 1721
272 Ga0496101_0007084 3300048904 Bacteria 7249
273 Ga0496101_0036551 3300048904 Bacteria 3479
274 Ga0496102_0021317 3300048905 Bacteria 5731
275 Ga0496102_0314832 3300048905 Bacteria 1474
276 Ga0496103_0009557 3300048906 Bacteria 5740
277 Ga0496103_0072772 3300048906 Bacteria 2153
278 Ga0496103_0107371 3300048906 Bacteria 1771
279 Ga0496104_0000134 3300048907 Bacteria 68737
280 Ga0496104_0030557 3300048907 Bacteria 5006
281 Ga0496104_0030712 3300048907 Bacteria 4994
282 Ga0496104_0032930 3300048907 Bacteria 4825
283 Ga0496104_0049516 3300048907 Bacteria 3962
284 Ga0496105_0000429 3300048908 Bacteria 27568
285 Ga0496105_0021065 3300048908 Bacteria 5273
286 Ga0496105_0059029 3300048908 Bacteria 3165
287 Ga0496105_0086020 3300048908 Bacteria 2598
288 Ga0496105_0091043 3300048908 Bacteria 2519
289 Ga0496106_0013479 3300048909 Bacteria 6035
290 Ga0496106_0169340 3300048909 Bacteria 1730
291 Ga0496107_0003330 3300048910 Bacteria 10741
292 Ga0496107_0014321 3300048910 Bacteria 5554
293 Ga0496107_0099537 3300048910 Bacteria 2131
294 Ga0496107_0107295 3300048910 Bacteria 2051
295 Ga0496107_0110372 3300048910 Bacteria 2021
296 Ga0496107_0486490 3300048910 Bacteria 915
297 Ga0496108_0010318 3300048911 Bacteria 7586
298 Ga0496109_0000806 3300048912 Bacteria 26126
299 Ga0496109_0001908 3300048912 Bacteria 17322
300 Ga0496109_0003117 3300048912 Bacteria 13826
301 Ga0496109_0045978 3300048912 Bacteria 3963
302 Ga0496109_0173118 3300048912 Bacteria 2026
303 Ga0496109_0691345 3300048912 Bacteria 957
304 Ga0496110_0000164 3300048913 Bacteria 40268
305 Ga0496110_0001563 3300048913 Bacteria 16687
306 Ga0496110_0035747 3300048913 Bacteria 4312
307 Ga0496110_0993754 3300048913 Bacteria 746
308 Ga0496111_0000295 3300048914 Bacteria 24339
309 Ga0496111_0001223 3300048914 Bacteria 14347
310 Ga0496111_0024680 3300048914 Bacteria 4237
311 Ga0496111_0126127 3300048914 Bacteria 1892
312 Ga0496111_0249951 3300048914 Bacteria 1316
313 Ga0496112_0009795 3300048915 Bacteria 8654
314 Ga0496112_0014430 3300048915 Bacteria 7330
315 Ga0496112_0036529 3300048915 Bacteria 4792
316 Ga0496112_0086656 3300048915 Bacteria 3098
317 Ga0496112_0090866 3300048915 Bacteria 3022
318 Ga0496112_0316192 3300048915 Bacteria 1506
319 Ga0496112_0338600 3300048915 Bacteria 1448
320 Ga0496113_0014618 3300048916 Bacteria 5363
321 Ga0496113_0272435 3300048916 Bacteria 1353
322 Ga0496114_0000281 3300048917 Bacteria 37054
323 Ga0496114_0004614 3300048917 Bacteria 10705
324 Ga0496114_0012457 3300048917 Bacteria 6808
325 Ga0496114_0018010 3300048917 Bacteria 5707
326 Ga0496114_0036335 3300048917 Bacteria 4072
327 Ga0496114_0116649 3300048917 Bacteria 2292
328 Ga0496115_0076079 3300048918 Bacteria 2728
329 Ga0496115_0466235 3300048918 Bacteria 1018
330 Ga0501032_0257367 3300049569 Bacteria 1132
331 Ga0501036_0251093 3300049572 Bacteria 1482
332 Ga0501038_0079723 3300049574 Bacteria 2760
333 Ga0501039_0050123 3300049575 Bacteria 3229
334 Ga0501040_0018867 3300049576 Bacteria 4583
335 Ga0501040_0116471 3300049576 Bacteria 1872
336 Ga0501040_0287025 3300049576 Bacteria 1176
337 Ga0501040_0396955 3300049576 Bacteria 990
338 Ga0501041_0239123 3300049577 Bacteria 1141
339 Ga0501042_0027539 3300049578 Bacteria 3997
340 Ga0501048_0007312 3300049582 Bacteria 8371
341 Ga0501068_0307807 3300049584 Bacteria 1015
342 Ga0501071_0011357 3300049587 Bacteria 5999
343 Ga0501072_0205589 3300049588 Bacteria 1570
344 Ga0501072_0242337 3300049588 Bacteria 1436
345 Ga0501075_0010831 3300049591 Bacteria 6427
346 Ga0501076_0024284 3300049592 Bacteria 4683
347 Ga0501076_0138745 3300049592 Bacteria 1975
348 Ga0501076_0140191 3300049592 Bacteria 1964
349 Ga0501076_0358463 3300049592 Bacteria 1198
350 Ga0501077_0147859 3300049593 Bacteria 1491
351 Ga0501079_0005933 3300049741 Bacteria 9149
352 Ga0501079_0175884 3300049741 Bacteria 1669
353 Ga0501080_0062249 3300049742 Bacteria 3473
354 Ga0501035_0399855 3300049822 Bacteria 1143
355 Ga0501045_0011218 3300049824 Bacteria 6286
356 Ga0501045_0036299 3300049824 Bacteria 3579
357 Ga0501045_0090265 3300049824 Bacteria 2264
358 nmdc:mga00v17_43251_c1 3300050491 Bacteria 2712
359 nmdc:mga0yw44_114736_c1 3300050492 Bacteria 1729
360 nmdc:mga0yw44_46688_c1 3300050492 Bacteria 2602
361 nmdc:mga05p37_13175_c1 3300050507 Bacteria 9898
362 nmdc:mga05p37_246373_c1 3300050507 Bacteria 2145
363 nmdc:mga09592_141505_c1 3300050508 Bacteria 2074
364 nmdc:mga09592_90997_c1 3300050508 Bacteria 2607
365 nmdc:mga0qj67_106138_c1 3300050509 Bacteria 2266
366 nmdc:mga0qj67_156003_c1 3300050509 Bacteria 1853
367 nmdc:mga0qj67_213789_c1 3300050509 Bacteria 1566
368 nmdc:mga06r32_171977_c1 3300050510 Bacteria 2150
369 nmdc:mga06r32_896254_c1 3300050510 Bacteria 844
370 nmdc:mga08y16_222366_c1 3300050511 Bacteria 1954
371 nmdc:mga08y16_348563_c1 3300050511 Bacteria 1521
372 nmdc:mga08y16_699632_c1 3300050511 Bacteria 1013
373 nmdc:mga08y16_755850_c1 3300050511 Bacteria 968
374 nmdc:mga0n895_149380_c1 3300050512 Bacteria 2366
375 nmdc:mga0rr50_478720_c1 3300050513 Bacteria 1057
376 nmdc:mga0a205_74328_c1 3300050515 Bacteria 3284
377 Ga0495619_0004146 3300053085 Bacteria 9262
378 Ga0501084_0006060 3300054114 Bacteria 9945
379 Ga0501084_0060739 3300054114 Bacteria 3164
380 Ga0501084_0168561 3300054114 Bacteria 1848
381 Ga0590071_036051 3300059421 Bacteria 1185
382 Ga0501082_0012997 3300060353 Bacteria 7156
383 Ga0501082_0029644 3300060353 Bacteria 4714
384 Ga0501082_0080990 3300060353 Bacteria 2802
385 Ga0466962_0033889 3300061719 Bacteria 2444
386 Ga0530510_0040817 3300061734 Bacteria 3349
387 Ga0530510_0065320 3300061734 Bacteria 2637
388 Ga0530510_0124747 3300061734 Bacteria 1892
389 Ga0530510_0394162 3300061734 Bacteria 1043
390 Ga0495641_0079785
391 JGI25407J50210_10000662
392 JGI25407J50210_10004596
393 Ga0070658_10003469
394 Ga0070683_100017812
395 Ga0070683_100102501
396 Ga0068869_100031994
397 Ga0070680_100278945
398 Ga0070682_100066177
399 Ga0068868_100062038
400 Ga0068868_100227144
401 Ga0070660_100002106
402 Ga0070660_100043222
403 Ga0070660_100125614
404 Ga0070689_100009219
405 Ga0070661_100047303
406 Ga0070675_100360629
407 Ga0070659_100216779
408 Ga0070709_10539076
409 Ga0070714_100003133
410 Ga0070713_100028085
411 Ga0070713_100342900
412 Ga0070710_10167185
413 Ga0070711_100101653
414 Ga0070705_100004193
415 Ga0070708_100381958
416 Ga0070663_100031769
417 Ga0070678_100035495
418 Ga0070678_100111771
419 Ga0070678_100113854
420 Ga0070678_100290924
421 Ga0070681_10005169
422 Ga0070681_10029302
423 Ga0070681_10271971
424 Ga0068867_100041276
425 Ga0070706_100417745
426 Ga0070706_100647724
427 Ga0070698_100008428
428 Ga0070698_100071836
429 Ga0070699_100188451
430 Ga0070679_100009415
431 Ga0070679_100025331
432 Ga0070684_100015239
433 Ga0070684_100071811
434 Ga0070684_100304201
435 Ga0070684_100508943
436 Ga0068853_100128931
437 Ga0070672_100043073
438 Ga0070695_100522522
439 Ga0070696_100119639
440 Ga0070693_100004929
441 Ga0070704_100018974
442 Ga0070704_100344614
443 Ga0068855_100126435
444 Ga0070664_100190540
445 Ga0070702_100199211
446 Ga0068859_100314539
447 Ga0068861_100058985
448 Ga0068863_100057104
449 Ga0068858_100031499
450 Ga0068862_100177163
451 Ga0081455_10047414
452 Ga0081455_10099366
453 Ga0081538_10000052
454 Ga0081538_10000518
455 Ga0081538_10000921
456 Ga0081538_10002738
457 Ga0081538_10056653
458 Ga0081538_10072646
459 Ga0081540_1021518
460 Ga0081539_10008240
461 Ga0070717_10033080
462 Ga0075365_10032550
463 Ga0075365_10039815
464 Ga0070716_100114308
465 Ga0097621_100031170
466 Ga0068871_100092249
467 Ga0075428_100010505
468 Ga0075428_100163387
469 Ga0075428_100177925
470 Ga0075430_100048297
471 Ga0075430_100392274
472 Ga0075431_100154459
473 Ga0075431_100210628
474 Ga0075431_100411489
475 Ga0075434_100355377
476 Ga0075429_100010892
477 Ga0075429_100044144
478 Ga0075429_100089776
479 Ga0097620_100314533
480 Ga0105240_10017656
481 Ga0105240_10732779
482 Ga0111539_10221885
483 Ga0111539_10322274
484 Ga0111539_10389285
485 Ga0105245_10026148
486 Ga0105245_10341389
487 Ga0105245_10579172
488 Ga0114129_10009275
489 Ga0114129_10100698
490 Ga0114129_10730767
491 Ga0105241_10707877
492 Ga0105242_10589652
493 Ga0105248_10303034
494 Ga0105238_10973266
495 Ga0105239_10131576
496 Ga0105239_10244348
497 Ga0157373_10043262
498 Ga0157373_10330252
499 Ga0157370_10015828
500 Ga0157370_10027050
501 Ga0157369_10033325
502 Ga0157369_10115945
503 Ga0157378_10248556
504 Ga0163162_10156381
505 Ga0163162_10479164
506 Ga0157372_10263171
507 Ga0157372_11314083
508 Ga0157375_10465620
509 Ga0163163_10367175
510 Ga0157380_10204331
511 Ga0157376_10044341
512 Ga0157376_10434310
513 Ga0163161_10247693
514 Ga0206356_10908635
515 Ga0206353_11386084
516 Ga0207692_10060248
517 Ga0207647_10031247
518 Ga0207705_10139376
519 Ga0207705_10160303
520 Ga0207654_10071980
521 Ga0207707_10005792
522 Ga0207693_10176502
523 Ga0207663_10018297
524 Ga0207660_10109726
525 Ga0207657_10008993
526 Ga0207657_10009023
527 Ga0207657_10030157
528 Ga0207657_10080021
529 Ga0207652_10004740
530 Ga0207652_10014981
531 Ga0207652_10063869
532 Ga0207664_10001609
533 Ga0207664_10232109
534 Ga0207690_10222399
535 Ga0207706_10226206
536 Ga0207706_10290926
537 Ga0207670_10033469
538 Ga0207665_10015212
539 Ga0207665_10402009
540 Ga0207691_10013703
541 Ga0207661_10074133
542 Ga0207661_10131811
543 Ga0207661_10224379
544 Ga0207679_10093652
545 Ga0207667_10067153
546 Ga0207667_10191560
547 Ga0207667_10542807
548 Ga0207712_10159315
549 Ga0207677_10179518
550 Ga0207702_10007589
551 Ga0207648_10172481
552 Ga0207676_10261635
553 Ga0207674_10216049
554 Ga0207675_100043859
555 Ga0207675_100232752
556 Ga0207683_10000689
557 Ga0207683_10061991
558 Ga0207683_10067027
559 Ga0207683_10561074
560 Ga0207698_10052327
561 Ga0268266_10060042
562 Ga0268264_10145222
563 Ga0265334_10045218
564 Ga0265320_10051702
565 Ga0307408_100216634
566 Ga0307416_100022914
567 Ga0307415_100609904
568 Ga0373943_0036242
569 Ga0373925_0662622
570 Ga0395899_0032528
571 Ga0395899_0050151
572 Ga0395899_0067228
573 Ga0395899_0103254
574 Ga0395899_0103257
575 Ga0395899_0137225
576 Ga0395899_0252904
577 Ga0395899_0353911
578 Ga0395900_0005435
579 Ga0395900_0005871
580 Ga0395900_0013842
581 Ga0395900_0069858
582 Ga0395900_0080354
583 Ga0395900_0111616
584 Ga0395900_0132849
585 Ga0395900_0139115
586 Ga0395900_0287722
587 Ga0395900_0341472
588 Ga0395900_0465837
589 Ga0395898_0004415
590 Ga0395898_0014859
591 Ga0395898_0022392
592 Ga0395898_0028397
593 Ga0395898_0034297
594 Ga0395898_0065396
595 Ga0395898_0076143
596 Ga0395898_0103866
597 Ga0395898_0108473
598 Ga0395898_0152094
599 Ga0395898_0648030
600 Ga0395898_0704770
601 Ga0395905_0005063
602 Ga0395905_0055299
603 Ga0395905_0058152
604 Ga0395905_0061462
605 Ga0395905_0077623
606 Ga0395905_0114730
607 Ga0395905_0212540
608 Ga0395905_0345690
609 Ga0395901_0003449
610 Ga0395901_0005816
611 Ga0395901_0007899
612 Ga0395901_0023124
613 Ga0395901_0027791
614 Ga0395901_0033611
615 Ga0395901_0042590
616 Ga0395901_0057045
617 Ga0395901_0072879
618 Ga0395901_0190767
619 Ga0395901_0202047
620 Ga0395901_0353292
621 Ga0395901_0522799
622 Ga0395901_0523367
623 Ga0451793_1629930
624 Ga0451835_0509244
625 Ga0451839_0529865
626 Ga0451849_1515604
627 Ga0451851_0521764
628 Ga0451855_0338644
629 Ga0451853_1023761
630 Ga0451853_2617189
631 Ga0450918_012940
632 Ga0466963_0006171
633 Ga0466963_0043002
634 Ga0466963_0070172
635 Ga0466964_0017204
636 Ga0466964_0026244
637 Ga0466964_0053952
638 Ga0466968_0162635
639 Ga0466957_0099267
640 Ga0466960_0031808
641 Ga0466959_0082205
642 Ga0466958_0020929
643 Ga0466958_0041124
644 Ga0466967_0004455
645 Ga0466967_0040743
646 Ga0466967_0053234
647 Ga0466967_0097640
648 Ga0466967_0202878
649 Ga0466967_0393412
650 Ga0495653_0068258
651 Ga0495630_0191069
652 Ga0495630_0553154
653 Ga0495667_0035948
654 Ga0495634_0047302
655 Ga0495634_0051620
656 Ga0495635_0153695
657 Ga0495613_0172970
658 Ga0495674_0222445
659 Ga0496100_0019535
660 Ga0496100_0138728
661 Ga0496101_0007084
662 Ga0496101_0036551
663 Ga0496102_0021317
664 Ga0496102_0314832
665 Ga0496103_0009557
666 Ga0496103_0072772
667 Ga0496103_0107371
668 Ga0496104_0000134
669 Ga0496104_0030557
670 Ga0496104_0030712
671 Ga0496104_0032930
672 Ga0496104_0049516
673 Ga0496105_0000429
674 Ga0496105_0021065
675 Ga0496105_0059029
676 Ga0496105_0086020
677 Ga0496105_0091043
678 Ga0496106_0013479
679 Ga0496106_0169340
680 Ga0496107_0003330
681 Ga0496107_0014321
682 Ga0496107_0099537
683 Ga0496107_0107295
684 Ga0496107_0110372
685 Ga0496107_0486490
686 Ga0496108_0010318
687 Ga0496109_0000806
688 Ga0496109_0001908
689 Ga0496109_0003117
690 Ga0496109_0045978
691 Ga0496109_0173118
692 Ga0496109_0691345
693 Ga0496110_0000164
694 Ga0496110_0001563
695 Ga0496110_0035747
696 Ga0496110_0993754
697 Ga0496111_0000295
698 Ga0496111_0001223
699 Ga0496111_0024680
700 Ga0496111_0126127
701 Ga0496111_0249951
702 Ga0496112_0009795
703 Ga0496112_0014430
704 Ga0496112_0036529
705 Ga0496112_0086656
706 Ga0496112_0090866
707 Ga0496112_0316192
708 Ga0496112_0338600
709 Ga0496113_0014618
710 Ga0496113_0272435
711 Ga0496114_0000281
712 Ga0496114_0004614
713 Ga0496114_0012457
714 Ga0496114_0018010
715 Ga0496114_0036335
716 Ga0496114_0116649
717 Ga0496115_0076079
718 Ga0496115_0466235
719 Ga0501032_0257367
720 Ga0501036_0251093
721 Ga0501038_0079723
722 Ga0501039_0050123
723 Ga0501040_0018867
724 Ga0501040_0116471
725 Ga0501040_0287025
726 Ga0501040_0396955
727 Ga0501041_0239123
728 Ga0501042_0027539
729 Ga0501048_0007312
730 Ga0501068_0307807
731 Ga0501071_0011357
732 Ga0501072_0205589
733 Ga0501072_0242337
734 Ga0501075_0010831
735 Ga0501076_0024284
736 Ga0501076_0138745
737 Ga0501076_0140191
738 Ga0501076_0358463
739 Ga0501077_0147859
740 Ga0501079_0005933
741 Ga0501079_0175884
742 Ga0501080_0062249
743 Ga0501035_0399855
744 Ga0501045_0011218
745 Ga0501045_0036299
746 Ga0501045_0090265
747 nmdc:mga00v17_43251_c1
748 nmdc:mga0yw44_114736_c1
749 nmdc:mga0yw44_46688_c1
750 nmdc:mga05p37_13175_c1
751 nmdc:mga05p37_246373_c1
752 nmdc:mga09592_141505_c1
753 nmdc:mga09592_90997_c1
754 nmdc:mga0qj67_106138_c1
755 nmdc:mga0qj67_156003_c1
756 nmdc:mga0qj67_213789_c1
757 nmdc:mga06r32_171977_c1
758 nmdc:mga06r32_896254_c1
759 nmdc:mga08y16_222366_c1
760 nmdc:mga08y16_348563_c1
761 nmdc:mga08y16_699632_c1
762 nmdc:mga08y16_755850_c1
763 nmdc:mga0n895_149380_c1
764 nmdc:mga0rr50_478720_c1
765 nmdc:mga0a205_74328_c1
766 Ga0495619_0004146
767 Ga0501084_0006060
768 Ga0501084_0060739
769 Ga0501084_0168561
770 Ga0590071_036051
771 Ga0501082_0012997
772 Ga0501082_0029644
773 Ga0501082_0080990
774 Ga0466962_0033889
775 Ga0530510_0040817
776 Ga0530510_0065320
777 Ga0530510_0124747
778 Ga0530510_0394162

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

48

289

0.97

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

53

240

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hrx-assembly2.cif.gz_E crystal structure of phenylacetic acid degradation protein paag 0.9403 2 245
3hrx-assembly2.cif.gz_F crystal structure of phenylacetic acid degradation protein paag 0.9366 2 245
6sl9-assembly1.cif.gz_AAA high resolution apo structure of isomerase paag 0.9358 2 245
3hrx-assembly2.cif.gz_E crystal structure of phenylacetic acid degradation protein paag 0.9329 2 245
3hrx-assembly2.cif.gz_F crystal structure of phenylacetic acid degradation protein paag 0.9292 2 245
ID Description Score Start End Superfamily
3hrxB02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 1.003 188 245 1.10.12.10
3hrxE02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 1.001 188 245 1.10.12.10
3gowE02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 1.001 188 245 1.10.12.10
af_P77467_205_262_1.10.12.10 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 1.001 192 245 1.10.12.10
3hrxA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 1 188 245 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A376RKK3-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9706 67 245 GO:0004300
GO:0016020
AF-A0A538IJW5-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9672 28 245
AF-A0A3C0UY61-F1-model_v4 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase 0.9665 52 245 GO:0016853
AF-A0A7W1N407-F1-model_v4 DUF4389 domain-containing protein 0.9647 2 245 GO:0003824
GO:0016020
AF-A0A3C0KP34-F1-model_v4 Enoyl-CoA hydratase 0.9629 73 245 GO:0006635
GO:0016836

Map