F431526

General Info

Members Datasets Scaffolds Average Seq Length
389 224 778 324

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0473375|Ga0466967_0473375_231_1193
Length 313
Sequence VTAYIVRRVLWVIVLLFLVSAITFVIFFVLPSADPAQLRAGRQPNPALVQAIRHKLGLDKPVYVQYVHYMGRLVLHWDFGYSYQNNISVKSQIFDRLPATISLTVGAAVVWGTLSAVRRRSAFDRLAMTGALIGISAPVYWLGLVSLFLFSNDIGKFKLLPGSGSYVGLTQDPAKWFTSLLMPWFVLAASYAAFYARLLRGNLIDVMGEDYIRTARAKGLTERRVIARHGIRSAITPVVTALGLDIGFLLGGAILVEAVFNIPGVGRLAFDSIQNSDLPMIQGTVLLGAFFIVVMNLVVDVSYAFLDPRVRFG

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
93 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 2.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.43
Rhizosphere 91.52
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0473375 3300045976 Bacteria 1226
2 JGI24744J21845_10002270 3300002077 Bacteria 3914
3 Ga0070658_10006818 3300005327 Bacteria 9235
4 Ga0070683_100009775 3300005329 Bacteria 8218
5 Ga0070683_100019026 3300005329 Bacteria 6093
6 Ga0070683_100037964 3300005329 Bacteria 4412
7 Ga0070690_100094275 3300005330 Bacteria 1975
8 Ga0068869_100027747 3300005334 Bacteria 3950
9 Ga0070680_100013510 3300005336 Bacteria 6360
10 Ga0070680_100133879 3300005336 Bacteria 2075
11 Ga0070680_100320339 3300005336 Bacteria 1316
12 Ga0070682_100099629 3300005337 Bacteria 1916
13 Ga0068868_100048332 3300005338 Bacteria 3336
14 Ga0070660_100004569 3300005339 Bacteria 9569
15 Ga0070660_100012001 3300005339 Bacteria 6181
16 Ga0070660_100036637 3300005339 Bacteria 3716
17 Ga0070660_100257865 3300005339 Bacteria 1423
18 Ga0070660_100324006 3300005339 Bacteria 1266
19 Ga0070689_100015121 3300005340 Bacteria 5622
20 Ga0070691_10044149 3300005341 Bacteria 2113
21 Ga0070661_100043837 3300005344 Bacteria 3268
22 Ga0070692_10024357 3300005345 Bacteria 2974
23 Ga0070692_10050254 3300005345 Bacteria 2165
24 Ga0070669_100110571 3300005353 Bacteria 2085
25 Ga0070675_100141057 3300005354 Bacteria 2060
26 Ga0070671_100080016 3300005355 Bacteria 2732
27 Ga0070673_100039964 3300005364 Bacteria 3595
28 Ga0070673_100072484 3300005364 Bacteria 2770
29 Ga0070688_100027594 3300005365 Bacteria 3382
30 Ga0070688_100054651 3300005365 Bacteria 2501
31 Ga0070659_100002649 3300005366 Bacteria 12741
32 Ga0070659_100101773 3300005366 Bacteria 2313
33 Ga0070714_100028524 3300005435 Bacteria 4632
34 Ga0070714_100046646 3300005435 Bacteria 3677
35 Ga0070713_100056762 3300005436 Bacteria 3257
36 Ga0070710_10016357 3300005437 Bacteria 3773
37 Ga0070701_10058449 3300005438 Bacteria 2024
38 Ga0070700_100002179 3300005441 Bacteria 9949
39 Ga0070708_100218229 3300005445 Bacteria 1788
40 Ga0070663_100104064 3300005455 Bacteria 2123
41 Ga0070678_100030587 3300005456 Bacteria 3703
42 Ga0070662_100076450 3300005457 Bacteria 2482
43 Ga0070662_100200801 3300005457 Bacteria 1582
44 Ga0070681_10002734 3300005458 Bacteria 16258
45 Ga0070681_10010056 3300005458 Bacteria 9327
46 Ga0070681_10021274 3300005458 Bacteria 6500
47 Ga0070685_10014491 3300005466 Bacteria 4177
48 Ga0070685_10046199 3300005466 Bacteria 2499
49 Ga0070699_100100226 3300005518 Bacteria 2539
50 Ga0070699_100172309 3300005518 Bacteria 1918
51 Ga0070679_100002512 3300005530 Bacteria 16627
52 Ga0070679_100006326 3300005530 Bacteria 11023
53 Ga0070679_100007873 3300005530 Bacteria 9992
54 Ga0070679_100027098 3300005530 Bacteria 5636
55 Ga0070684_100006490 3300005535 Bacteria 9058
56 Ga0070684_100007246 3300005535 Bacteria 8620
57 Ga0070684_100016668 3300005535 Bacteria 6012
58 Ga0070684_100037722 3300005535 Bacteria 4147
59 Ga0070684_100053497 3300005535 Bacteria 3515
60 Ga0070684_100163369 3300005535 Bacteria 2021
61 Ga0068853_100155650 3300005539 Bacteria 2059
62 Ga0068853_100178868 3300005539 Bacteria 1923
63 Ga0070672_100006772 3300005543 Bacteria 7733
64 Ga0070672_100038256 3300005543 Bacteria 3665
65 Ga0070686_100001896 3300005544 Bacteria 11644
66 Ga0070686_100070337 3300005544 Bacteria 2288
67 Ga0070665_100068438 3300005548 Bacteria 3560
68 Ga0070665_100305813 3300005548 Bacteria 1593
69 Ga0070704_100025659 3300005549 Bacteria 3883
70 Ga0068855_100014252 3300005563 Bacteria 9576
71 Ga0070664_100034535 3300005564 Bacteria 4242
72 Ga0070664_100208302 3300005564 Bacteria 1747
73 Ga0070664_100223448 3300005564 Bacteria 1685
74 Ga0068857_100168536 3300005577 Bacteria 1990
75 Ga0068854_100034691 3300005578 Bacteria 3526
76 Ga0068856_100012743 3300005614 Bacteria 8140
77 Ga0068856_100041899 3300005614 Bacteria 4501
78 Ga0068856_100098234 3300005614 Bacteria 2918
79 Ga0068856_100215660 3300005614 Bacteria 1935
80 Ga0070702_100020638 3300005615 Bacteria 3454
81 Ga0068852_100018753 3300005616 Bacteria 5457
82 Ga0068852_100020348 3300005616 Bacteria 5276
83 Ga0068859_100153000 3300005617 Bacteria 2383
84 Ga0068864_100080918 3300005618 Bacteria 2847
85 Ga0068866_10003566 3300005718 Bacteria 6373
86 Ga0068870_10003958 3300005840 Bacteria 6327
87 Ga0068858_100013515 3300005842 Bacteria 7702
88 Ga0068860_100064332 3300005843 Bacteria 3484
89 Ga0081455_10007776 3300005937 Bacteria 11238
90 Ga0081455_10010645 3300005937 Bacteria 9306
91 Ga0081455_10017408 3300005937 Bacteria 6894
92 Ga0081455_10059351 3300005937 Bacteria 3231
93 Ga0081455_10116405 3300005937 Bacteria 2114
94 Ga0081455_10118665 3300005937 Bacteria 2088
95 Ga0081538_10000183 3300005981 Bacteria 68671
96 Ga0081539_10034274 3300005985 Bacteria 3073
97 Ga0070717_10037979 3300006028 Bacteria 3912
98 Ga0070717_10100278 3300006028 Bacteria 2458
99 Ga0070712_100007999 3300006175 Bacteria 6630
100 Ga0070712_100404044 3300006175 Bacteria 1129
101 Ga0068871_100165137 3300006358 Bacteria 1895
102 Ga0075430_100008993 3300006846 Bacteria 8440
103 Ga0068865_100001978 3300006881 Bacteria 12105
104 Ga0068865_100003700 3300006881 Bacteria 9190
105 Ga0068865_100044981 3300006881 Bacteria 3024
106 Ga0097620_100153007 3300006931 Bacteria 2383
107 Ga0105240_10050991 3300009093 Bacteria 5211
108 Ga0105240_10268201 3300009093 Bacteria 1967
109 Ga0105240_10704522 3300009093 Bacteria 1102
110 Ga0111539_10031307 3300009094 Bacteria 6463
111 Ga0111539_10056129 3300009094 Bacteria 4682
112 Ga0111539_10065226 3300009094 Bacteria 4304
113 Ga0111539_10679713 3300009094 Bacteria 1198
114 Ga0105245_10002933 3300009098 Bacteria 15313
115 Ga0105245_10054698 3300009098 Bacteria 3585
116 Ga0105245_10056753 3300009098 Bacteria 3520
117 Ga0105245_10065221 3300009098 Bacteria 3293
118 Ga0105245_10292604 3300009098 Bacteria 1596
119 Ga0105245_10296855 3300009098 Bacteria 1584
120 Ga0105247_10027942 3300009101 Bacteria 3412
121 Ga0114129_10125110 3300009147 Bacteria 3536
122 Ga0105243_10002113 3300009148 Bacteria 16802
123 Ga0105243_10008842 3300009148 Bacteria 7712
124 Ga0105241_10112527 3300009174 Bacteria 2181
125 Ga0105242_10001082 3300009176 Bacteria 21400
126 Ga0105242_10089846 3300009176 Bacteria 2583
127 Ga0105242_10243561 3300009176 Bacteria 1617
128 Ga0105248_10025781 3300009177 Bacteria 6539
129 Ga0105248_10096253 3300009177 Bacteria 3334
130 Ga0105237_10014291 3300009545 Bacteria 8310
131 Ga0105238_10048647 3300009551 Bacteria 4272
132 Ga0105238_10470401 3300009551 Bacteria 1255
133 Ga0105249_10032568 3300009553 Bacteria 4716
134 Ga0105249_10053207 3300009553 Bacteria 3701
135 Ga0105249_10325140 3300009553 Bacteria 1550
136 Ga0105239_10001972 3300010375 Bacteria 26696
137 Ga0105239_10010144 3300010375 Bacteria 10556
138 Ga0105239_10063389 3300010375 Bacteria 4058
139 Ga0105239_10085188 3300010375 Bacteria 3482
140 Ga0105246_10016047 3300011119 Bacteria 4739
141 Ga0105246_10183438 3300011119 Bacteria 1613
142 Ga0157370_10002521 3300013104 Bacteria 22023
143 Ga0157370_10018143 3300013104 Bacteria 7083
144 Ga0157369_10009648 3300013105 Bacteria 11039
145 Ga0157374_10297537 3300013296 Bacteria 1596
146 Ga0157378_10002101 3300013297 Bacteria 17759
147 Ga0163162_10046833 3300013306 Bacteria 4334
148 Ga0163162_10090455 3300013306 Bacteria 3142
149 Ga0163162_10131552 3300013306 Bacteria 2611
150 Ga0157372_10004073 3300013307 Bacteria 15669
151 Ga0157372_10013036 3300013307 Bacteria 8866
152 Ga0157372_10099041 3300013307 Bacteria 3325
153 Ga0157372_10258745 3300013307 Bacteria 2021
154 Ga0157372_10552983 3300013307 Bacteria 1342
155 Ga0157375_10020636 3300013308 Bacteria 6024
156 Ga0157375_10025145 3300013308 Bacteria 5525
157 Ga0157375_10030516 3300013308 Bacteria 5084
158 Ga0157375_10039958 3300013308 Bacteria 4518
159 Ga0163163_10012985 3300014325 Bacteria 7608
160 Ga0157380_10014257 3300014326 Bacteria 5815
161 Ga0157380_10016587 3300014326 Bacteria 5436
162 Ga0157377_10011919 3300014745 Bacteria 4356
163 Ga0157376_10047519 3300014969 Bacteria 3543
164 Ga0206351_10260040 3300020077 Bacteria 3594
165 Ga0206352_10846540 3300020078 Bacteria 3785
166 Ga0206350_10814570 3300020080 Bacteria 1565
167 Ga0206354_10770103 3300020081 Bacteria 6935
168 Ga0206353_10372580 3300020082 Bacteria 8232
169 Ga0206353_10797805 3300020082 Bacteria 4889
170 Ga0213874_10068425 3300021377 Bacteria 1127
171 Ga0224712_10001563 3300022467 Bacteria 5346
172 Ga0224712_10021986 3300022467 Bacteria 2192
173 Ga0207692_10020885 3300025898 Bacteria 2987
174 Ga0207642_10004149 3300025899 Bacteria 4652
175 Ga0207688_10024102 3300025901 Bacteria 3336
176 Ga0207643_10003937 3300025908 Bacteria 7991
177 Ga0207643_10083727 3300025908 Bacteria 1851
178 Ga0207705_10026782 3300025909 Bacteria 4109
179 Ga0207705_10144011 3300025909 Bacteria 1782
180 Ga0207707_10003341 3300025912 Bacteria 14243
181 Ga0207707_10017585 3300025912 Bacteria 6235
182 Ga0207707_10029284 3300025912 Bacteria 4814
183 Ga0207695_10008069 3300025913 Bacteria 13247
184 Ga0207695_10351619 3300025913 Bacteria 1361
185 Ga0207671_10032852 3300025914 Bacteria 3862
186 Ga0207693_10015184 3300025915 Bacteria 6180
187 Ga0207660_10027289 3300025917 Bacteria 3894
188 Ga0207660_10049331 3300025917 Bacteria 2983
189 Ga0207660_10168902 3300025917 Bacteria 1692
190 Ga0207660_10175865 3300025917 Bacteria 1660
191 Ga0207657_10000073 3300025919 Bacteria 93299
192 Ga0207657_10013936 3300025919 Bacteria 7865
193 Ga0207657_10111008 3300025919 Bacteria 2265
194 Ga0207657_10266048 3300025919 Bacteria 1364
195 Ga0207649_10005721 3300025920 Bacteria 6731
196 Ga0207652_10006646 3300025921 Bacteria 9317
197 Ga0207652_10007340 3300025921 Bacteria 8885
198 Ga0207652_10040449 3300025921 Bacteria 3959
199 Ga0207652_10041252 3300025921 Bacteria 3923
200 Ga0207694_10008546 3300025924 Bacteria 7730
201 Ga0207694_10417110 3300025924 Bacteria 1118
202 Ga0207659_10104697 3300025926 Bacteria 2140
203 Ga0207659_10132740 3300025926 Bacteria 1924
204 Ga0207687_10021763 3300025927 Bacteria 4261
205 Ga0207687_10069584 3300025927 Bacteria 2510
206 Ga0207687_10083297 3300025927 Bacteria 2315
207 Ga0207687_10126381 3300025927 Bacteria 1920
208 Ga0207687_10200745 3300025927 Bacteria 1558
209 Ga0207700_10048805 3300025928 Bacteria 3145
210 Ga0207664_10008189 3300025929 Bacteria 7277
211 Ga0207664_10121379 3300025929 Bacteria 2187
212 Ga0207664_10420991 3300025929 Bacteria 1190
213 Ga0207644_10030067 3300025931 Bacteria 3773
214 Ga0207690_10087264 3300025932 Bacteria 2195
215 Ga0207690_10188450 3300025932 Bacteria 1558
216 Ga0207706_10052812 3300025933 Bacteria 3588
217 Ga0207686_10017893 3300025934 Bacteria 4002
218 Ga0207709_10001307 3300025935 Bacteria 17736
219 Ga0207709_10021494 3300025935 Bacteria 3653
220 Ga0207670_10060789 3300025936 Bacteria 2575
221 Ga0207669_10045580 3300025937 Bacteria 2584
222 Ga0207704_10001093 3300025938 Bacteria 12036
223 Ga0207704_10015675 3300025938 Bacteria 3870
224 Ga0207665_10056841 3300025939 Bacteria 2642
225 Ga0207691_10040079 3300025940 Bacteria 4330
226 Ga0207691_10151978 3300025940 Bacteria 2035
227 Ga0207711_10108588 3300025941 Bacteria 2465
228 Ga0207661_10001962 3300025944 Bacteria 14159
229 Ga0207661_10004961 3300025944 Bacteria 9335
230 Ga0207661_10025588 3300025944 Bacteria 4488
231 Ga0207661_10138423 3300025944 Bacteria 2093
232 Ga0207679_10046031 3300025945 Bacteria 3160
233 Ga0207679_10049794 3300025945 Bacteria 3058
234 Ga0207679_10115729 3300025945 Bacteria 2125
235 Ga0207667_10430045 3300025949 Bacteria 1343
236 Ga0207712_10021058 3300025961 Bacteria 4276
237 Ga0207668_10092328 3300025972 Bacteria 2228
238 Ga0207668_10150280 3300025972 Bacteria 1802
239 Ga0207640_10012160 3300025981 Bacteria 4895
240 Ga0207640_10119491 3300025981 Bacteria 1885
241 Ga0207677_10017211 3300026023 Bacteria 4304
242 Ga0207703_10018682 3300026035 Bacteria 5415
243 Ga0207639_10181669 3300026041 Bacteria 1790
244 Ga0207678_10010414 3300026067 Bacteria 8163
245 Ga0207678_10481364 3300026067 Bacteria 1081
246 Ga0207708_10006452 3300026075 Bacteria 8693
247 Ga0207708_10016362 3300026075 Bacteria 5575
248 Ga0207702_10061335 3300026078 Bacteria 3207
249 Ga0207702_10092059 3300026078 Bacteria 2656
250 Ga0207702_10408520 3300026078 Bacteria 1311
251 Ga0207702_10410526 3300026078 Bacteria 1307
252 Ga0207648_10073405 3300026089 Bacteria 2982
253 Ga0207674_10271807 3300026116 Bacteria 1642
254 Ga0207675_100009858 3300026118 Bacteria 8935
255 Ga0207675_100106285 3300026118 Bacteria 2646
256 Ga0207683_10049062 3300026121 Bacteria 3695
257 Ga0207683_10101142 3300026121 Bacteria 2574
258 Ga0207698_10024871 3300026142 Bacteria 4209
259 Ga0207698_10062773 3300026142 Bacteria 2903
260 Ga0207428_10037971 3300027907 Bacteria 3918
261 Ga0268266_10246038 3300028379 Bacteria 1652
262 Ga0268265_10252430 3300028380 Unclassified 1563
263 Ga0268264_10043799 3300028381 Bacteria 3711
264 Ga0395899_0034987 3300037312 Bacteria 3772
265 Ga0395900_0002360 3300037418 Bacteria 20889
266 Ga0395900_0003447 3300037418 Bacteria 17104
267 Ga0395900_0004713 3300037418 Bacteria 14381
268 Ga0395900_0084788 3300037418 Bacteria 3256
269 Ga0395900_0202131 3300037418 Bacteria 2010
270 Ga0395900_0249997 3300037418 Bacteria 1775
271 Ga0395898_0005123 3300037466 Bacteria 14196
272 Ga0395898_0008791 3300037466 Bacteria 10642
273 Ga0395898_0033952 3300037466 Bacteria 5089
274 Ga0395898_0052558 3300037466 Bacteria 3981
275 Ga0395898_0176584 3300037466 Bacteria 2041
276 Ga0395898_0184661 3300037466 Bacteria 1993
277 Ga0395898_0237313 3300037466 Bacteria 1739
278 Ga0395898_0346630 3300037466 Bacteria 1416
279 Ga0395905_0003868 3300037471 Bacteria 15794
280 Ga0395905_0006654 3300037471 Bacteria 11588
281 Ga0395901_0003723 3300038443 Bacteria 15366
282 Ga0395901_0005777 3300038443 Bacteria 12529
283 Ga0395901_0008632 3300038443 Bacteria 10297
284 Ga0395901_0038834 3300038443 Bacteria 4924
285 Ga0395901_0368319 3300038443 Bacteria 1480
286 Ga0395901_0438510 3300038443 Bacteria 1337
287 Ga0395901_0483084 3300038443 Bacteria 1263
288 Ga0436365_1558660 3300039437 Bacteria 2821
289 Ga0436365_1910453 3300039437 Bacteria 7372
290 Ga0436363_0252198 3300039450 Bacteria 3188
291 Ga0436363_0265404 3300039450 Bacteria 3189
292 Ga0436363_0855321 3300039450 Bacteria 1310
293 Ga0436363_0919101 3300039450 Bacteria 21832
294 Ga0436362_0147193 3300039453 Bacteria 1441
295 Ga0466961_0008029 3300044693 Bacteria 6726
296 Ga0466963_0080998 3300044694 Bacteria 2198
297 Ga0466964_0111734 3300044706 Bacteria 1220
298 Ga0466968_0079604 3300044735 Bacteria 1438
299 Ga0466957_0118443 3300044842 Bacteria 1686
300 Ga0466960_0034231 3300044901 Bacteria 2366
301 Ga0466958_0008370 3300045836 Bacteria 5733
302 Ga0466967_0012848 3300045976 Bacteria 6435
303 Ga0466967_0055886 3300045976 Bacteria 3478
304 Ga0466967_0128141 3300045976 Bacteria 2353
305 Ga0466967_0135927 3300045976 Bacteria 2286
306 Ga0466967_0182804 3300045976 Bacteria 1978
307 Ga0466967_0224534 3300045976 Bacteria 1786
308 Ga0466967_0239008 3300045976 Bacteria 1732
309 Ga0466967_0267352 3300045976 Bacteria 1637
310 Ga0466967_0362030 3300045976 Bacteria 1405
311 Ga0495603_0020137 3300046455 Bacteria 4043
312 Ga0495652_0293132 3300046529 Bacteria 1186
313 Ga0495645_0000027 3300046543 Bacteria 115688
314 Ga0495599_0093226 3300046678 Bacteria 1879
315 Ga0495658_0209629 3300046683 Bacteria 1217
316 Ga0495658_0223838 3300046683 Bacteria 1179
317 Ga0495613_0172071 3300046689 Bacteria 1537
318 Ga0495600_0171961 3300046809 Bacteria 1398
319 Ga0495672_0026614 3300047320 Bacteria 3688
320 Ga0495680_0349244 3300047322 Bacteria 1030
321 Ga0496100_0006245 3300048903 Bacteria 6486
322 Ga0496101_0001199 3300048904 Bacteria 15511
323 Ga0496102_0001299 3300048905 Bacteria 22455
324 Ga0496103_0021695 3300048906 Bacteria 3864
325 Ga0496104_0056045 3300048907 Bacteria 3727
326 Ga0496105_0063730 3300048908 Bacteria 3041
327 Ga0496105_0066410 3300048908 Bacteria 2978
328 Ga0496106_0003702 3300048909 Bacteria 11405
329 Ga0496107_0000485 3300048910 Bacteria 21863
330 Ga0496108_0050126 3300048911 Bacteria 3494
331 Ga0496108_0195985 3300048911 Bacteria 1752
332 Ga0496109_0001423 3300048912 Bacteria 19859
333 Ga0496109_0010355 3300048912 Bacteria 7965
334 Ga0496109_0067583 3300048912 Bacteria 3274
335 Ga0496109_0374621 3300048912 Bacteria 1345
336 Ga0496110_0008768 3300048913 Bacteria 8148
337 Ga0496110_0121640 3300048913 Bacteria 2352
338 Ga0496111_0003942 3300048914 Bacteria 9310
339 Ga0496112_0000621 3300048915 Bacteria 24571
340 Ga0496112_0078665 3300048915 Bacteria 3261
341 Ga0496113_0113367 3300048916 Bacteria 2113
342 Ga0496113_0166915 3300048916 Bacteria 1742
343 Ga0496114_0005586 3300048917 Bacteria 9857
344 Ga0496115_0003289 3300048918 Bacteria 11600
345 Ga0496115_0033267 3300048918 Bacteria 4070
346 Ga0496121_0001205 3300048924 Bacteria 45237
347 Ga0501031_0000143 3300049568 Bacteria 40199
348 Ga0501032_0011519 3300049569 Bacteria 6353
349 Ga0501033_0002255 3300049570 Bacteria 16519
350 Ga0501036_0000767 3300049572 Bacteria 23813
351 Ga0501037_0010577 3300049573 Bacteria 6777
352 Ga0501038_0016888 3300049574 Bacteria 6605
353 Ga0501039_0000879 3300049575 Bacteria 21814
354 Ga0501040_0005998 3300049576 Bacteria 7865
355 Ga0501041_0000457 3300049577 Bacteria 20755
356 Ga0501042_0000198 3300049578 Bacteria 28655
357 Ga0501043_0000774 3300049579 Bacteria 28396
358 Ga0501046_0003551 3300049580 Bacteria 14280
359 Ga0501047_0001878 3300049581 Bacteria 20227
360 Ga0501048_0000104 3300049582 Bacteria 46669
361 Ga0501067_0019740 3300049583 Bacteria 3730
362 Ga0501068_0000186 3300049584 Bacteria 29144
363 Ga0501068_0198616 3300049584 Bacteria 1272
364 Ga0501069_0000164 3300049585 Bacteria 29328
365 Ga0501070_0001813 3300049586 Bacteria 18821
366 Ga0501071_0000448 3300049587 Bacteria 20743
367 Ga0501072_0019028 3300049588 Bacteria 5302
368 Ga0501073_0001629 3300049589 Bacteria 16658
369 Ga0501074_0000321 3300049590 Bacteria 27781
370 Ga0501075_0008775 3300049591 Bacteria 7044
371 Ga0501076_0003894 3300049592 Bacteria 10520
372 Ga0501077_0000858 3300049593 Bacteria 18391
373 Ga0501077_0128373 3300049593 Bacteria 1607
374 Ga0501079_0000425 3300049741 Bacteria 27502
375 Ga0501080_0010245 3300049742 Bacteria 8574
376 Ga0501081_0004637 3300049743 Bacteria 8832
377 Ga0501083_0000378 3300049744 Bacteria 28107
378 Ga0501035_0011243 3300049822 Bacteria 8292
379 Ga0501044_0020358 3300049823 Bacteria 7083
380 Ga0501045_0001279 3300049824 Bacteria 16707
381 nmdc:mga05p37_548893_c1 3300050507 Bacteria 1316
382 nmdc:mga0qj67_8424_c1 3300050509 Bacteria 7649
383 nmdc:mga08y16_44986_c1 3300050511 Bacteria 4625
384 Ga0495612_0000197 3300053078 Bacteria 25625
385 Ga0501084_0008282 3300054114 Bacteria 8577
386 Ga0501084_0322145 3300054114 Bacteria 1306
387 Ga0501082_0001562 3300060353 Bacteria 20162
388 Ga0466962_0004496 3300061719 Bacteria 6683
389 Ga0530510_0002556 3300061734 Bacteria 12502
390 Ga0466967_0473375
391 JGI24744J21845_10002270
392 Ga0070658_10006818
393 Ga0070683_100009775
394 Ga0070683_100019026
395 Ga0070683_100037964
396 Ga0070690_100094275
397 Ga0068869_100027747
398 Ga0070680_100013510
399 Ga0070680_100133879
400 Ga0070680_100320339
401 Ga0070682_100099629
402 Ga0068868_100048332
403 Ga0070660_100004569
404 Ga0070660_100012001
405 Ga0070660_100036637
406 Ga0070660_100257865
407 Ga0070660_100324006
408 Ga0070689_100015121
409 Ga0070691_10044149
410 Ga0070661_100043837
411 Ga0070692_10024357
412 Ga0070692_10050254
413 Ga0070669_100110571
414 Ga0070675_100141057
415 Ga0070671_100080016
416 Ga0070673_100039964
417 Ga0070673_100072484
418 Ga0070688_100027594
419 Ga0070688_100054651
420 Ga0070659_100002649
421 Ga0070659_100101773
422 Ga0070714_100028524
423 Ga0070714_100046646
424 Ga0070713_100056762
425 Ga0070710_10016357
426 Ga0070701_10058449
427 Ga0070700_100002179
428 Ga0070708_100218229
429 Ga0070663_100104064
430 Ga0070678_100030587
431 Ga0070662_100076450
432 Ga0070662_100200801
433 Ga0070681_10002734
434 Ga0070681_10010056
435 Ga0070681_10021274
436 Ga0070685_10014491
437 Ga0070685_10046199
438 Ga0070699_100100226
439 Ga0070699_100172309
440 Ga0070679_100002512
441 Ga0070679_100006326
442 Ga0070679_100007873
443 Ga0070679_100027098
444 Ga0070684_100006490
445 Ga0070684_100007246
446 Ga0070684_100016668
447 Ga0070684_100037722
448 Ga0070684_100053497
449 Ga0070684_100163369
450 Ga0068853_100155650
451 Ga0068853_100178868
452 Ga0070672_100006772
453 Ga0070672_100038256
454 Ga0070686_100001896
455 Ga0070686_100070337
456 Ga0070665_100068438
457 Ga0070665_100305813
458 Ga0070704_100025659
459 Ga0068855_100014252
460 Ga0070664_100034535
461 Ga0070664_100208302
462 Ga0070664_100223448
463 Ga0068857_100168536
464 Ga0068854_100034691
465 Ga0068856_100012743
466 Ga0068856_100041899
467 Ga0068856_100098234
468 Ga0068856_100215660
469 Ga0070702_100020638
470 Ga0068852_100018753
471 Ga0068852_100020348
472 Ga0068859_100153000
473 Ga0068864_100080918
474 Ga0068866_10003566
475 Ga0068870_10003958
476 Ga0068858_100013515
477 Ga0068860_100064332
478 Ga0081455_10007776
479 Ga0081455_10010645
480 Ga0081455_10017408
481 Ga0081455_10059351
482 Ga0081455_10116405
483 Ga0081455_10118665
484 Ga0081538_10000183
485 Ga0081539_10034274
486 Ga0070717_10037979
487 Ga0070717_10100278
488 Ga0070712_100007999
489 Ga0070712_100404044
490 Ga0068871_100165137
491 Ga0075430_100008993
492 Ga0068865_100001978
493 Ga0068865_100003700
494 Ga0068865_100044981
495 Ga0097620_100153007
496 Ga0105240_10050991
497 Ga0105240_10268201
498 Ga0105240_10704522
499 Ga0111539_10031307
500 Ga0111539_10056129
501 Ga0111539_10065226
502 Ga0111539_10679713
503 Ga0105245_10002933
504 Ga0105245_10054698
505 Ga0105245_10056753
506 Ga0105245_10065221
507 Ga0105245_10292604
508 Ga0105245_10296855
509 Ga0105247_10027942
510 Ga0114129_10125110
511 Ga0105243_10002113
512 Ga0105243_10008842
513 Ga0105241_10112527
514 Ga0105242_10001082
515 Ga0105242_10089846
516 Ga0105242_10243561
517 Ga0105248_10025781
518 Ga0105248_10096253
519 Ga0105237_10014291
520 Ga0105238_10048647
521 Ga0105238_10470401
522 Ga0105249_10032568
523 Ga0105249_10053207
524 Ga0105249_10325140
525 Ga0105239_10001972
526 Ga0105239_10010144
527 Ga0105239_10063389
528 Ga0105239_10085188
529 Ga0105246_10016047
530 Ga0105246_10183438
531 Ga0157370_10002521
532 Ga0157370_10018143
533 Ga0157369_10009648
534 Ga0157374_10297537
535 Ga0157378_10002101
536 Ga0163162_10046833
537 Ga0163162_10090455
538 Ga0163162_10131552
539 Ga0157372_10004073
540 Ga0157372_10013036
541 Ga0157372_10099041
542 Ga0157372_10258745
543 Ga0157372_10552983
544 Ga0157375_10020636
545 Ga0157375_10025145
546 Ga0157375_10030516
547 Ga0157375_10039958
548 Ga0163163_10012985
549 Ga0157380_10014257
550 Ga0157380_10016587
551 Ga0157377_10011919
552 Ga0157376_10047519
553 Ga0206351_10260040
554 Ga0206352_10846540
555 Ga0206350_10814570
556 Ga0206354_10770103
557 Ga0206353_10372580
558 Ga0206353_10797805
559 Ga0213874_10068425
560 Ga0224712_10001563
561 Ga0224712_10021986
562 Ga0207692_10020885
563 Ga0207642_10004149
564 Ga0207688_10024102
565 Ga0207643_10003937
566 Ga0207643_10083727
567 Ga0207705_10026782
568 Ga0207705_10144011
569 Ga0207707_10003341
570 Ga0207707_10017585
571 Ga0207707_10029284
572 Ga0207695_10008069
573 Ga0207695_10351619
574 Ga0207671_10032852
575 Ga0207693_10015184
576 Ga0207660_10027289
577 Ga0207660_10049331
578 Ga0207660_10168902
579 Ga0207660_10175865
580 Ga0207657_10000073
581 Ga0207657_10013936
582 Ga0207657_10111008
583 Ga0207657_10266048
584 Ga0207649_10005721
585 Ga0207652_10006646
586 Ga0207652_10007340
587 Ga0207652_10040449
588 Ga0207652_10041252
589 Ga0207694_10008546
590 Ga0207694_10417110
591 Ga0207659_10104697
592 Ga0207659_10132740
593 Ga0207687_10021763
594 Ga0207687_10069584
595 Ga0207687_10083297
596 Ga0207687_10126381
597 Ga0207687_10200745
598 Ga0207700_10048805
599 Ga0207664_10008189
600 Ga0207664_10121379
601 Ga0207664_10420991
602 Ga0207644_10030067
603 Ga0207690_10087264
604 Ga0207690_10188450
605 Ga0207706_10052812
606 Ga0207686_10017893
607 Ga0207709_10001307
608 Ga0207709_10021494
609 Ga0207670_10060789
610 Ga0207669_10045580
611 Ga0207704_10001093
612 Ga0207704_10015675
613 Ga0207665_10056841
614 Ga0207691_10040079
615 Ga0207691_10151978
616 Ga0207711_10108588
617 Ga0207661_10001962
618 Ga0207661_10004961
619 Ga0207661_10025588
620 Ga0207661_10138423
621 Ga0207679_10046031
622 Ga0207679_10049794
623 Ga0207679_10115729
624 Ga0207667_10430045
625 Ga0207712_10021058
626 Ga0207668_10092328
627 Ga0207668_10150280
628 Ga0207640_10012160
629 Ga0207640_10119491
630 Ga0207677_10017211
631 Ga0207703_10018682
632 Ga0207639_10181669
633 Ga0207678_10010414
634 Ga0207678_10481364
635 Ga0207708_10006452
636 Ga0207708_10016362
637 Ga0207702_10061335
638 Ga0207702_10092059
639 Ga0207702_10408520
640 Ga0207702_10410526
641 Ga0207648_10073405
642 Ga0207674_10271807
643 Ga0207675_100009858
644 Ga0207675_100106285
645 Ga0207683_10049062
646 Ga0207683_10101142
647 Ga0207698_10024871
648 Ga0207698_10062773
649 Ga0207428_10037971
650 Ga0268266_10246038
651 Ga0268265_10252430
652 Ga0268264_10043799
653 Ga0395899_0034987
654 Ga0395900_0002360
655 Ga0395900_0003447
656 Ga0395900_0004713
657 Ga0395900_0084788
658 Ga0395900_0202131
659 Ga0395900_0249997
660 Ga0395898_0005123
661 Ga0395898_0008791
662 Ga0395898_0033952
663 Ga0395898_0052558
664 Ga0395898_0176584
665 Ga0395898_0184661
666 Ga0395898_0237313
667 Ga0395898_0346630
668 Ga0395905_0003868
669 Ga0395905_0006654
670 Ga0395901_0003723
671 Ga0395901_0005777
672 Ga0395901_0008632
673 Ga0395901_0038834
674 Ga0395901_0368319
675 Ga0395901_0438510
676 Ga0395901_0483084
677 Ga0436365_1558660
678 Ga0436365_1910453
679 Ga0436363_0252198
680 Ga0436363_0265404
681 Ga0436363_0855321
682 Ga0436363_0919101
683 Ga0436362_0147193
684 Ga0466961_0008029
685 Ga0466963_0080998
686 Ga0466964_0111734
687 Ga0466968_0079604
688 Ga0466957_0118443
689 Ga0466960_0034231
690 Ga0466958_0008370
691 Ga0466967_0012848
692 Ga0466967_0055886
693 Ga0466967_0128141
694 Ga0466967_0135927
695 Ga0466967_0182804
696 Ga0466967_0224534
697 Ga0466967_0239008
698 Ga0466967_0267352
699 Ga0466967_0362030
700 Ga0495603_0020137
701 Ga0495652_0293132
702 Ga0495645_0000027
703 Ga0495599_0093226
704 Ga0495658_0209629
705 Ga0495658_0223838
706 Ga0495613_0172071
707 Ga0495600_0171961
708 Ga0495672_0026614
709 Ga0495680_0349244
710 Ga0496100_0006245
711 Ga0496101_0001199
712 Ga0496102_0001299
713 Ga0496103_0021695
714 Ga0496104_0056045
715 Ga0496105_0063730
716 Ga0496105_0066410
717 Ga0496106_0003702
718 Ga0496107_0000485
719 Ga0496108_0050126
720 Ga0496108_0195985
721 Ga0496109_0001423
722 Ga0496109_0010355
723 Ga0496109_0067583
724 Ga0496109_0374621
725 Ga0496110_0008768
726 Ga0496110_0121640
727 Ga0496111_0003942
728 Ga0496112_0000621
729 Ga0496112_0078665
730 Ga0496113_0113367
731 Ga0496113_0166915
732 Ga0496114_0005586
733 Ga0496115_0003289
734 Ga0496115_0033267
735 Ga0496121_0001205
736 Ga0501031_0000143
737 Ga0501032_0011519
738 Ga0501033_0002255
739 Ga0501036_0000767
740 Ga0501037_0010577
741 Ga0501038_0016888
742 Ga0501039_0000879
743 Ga0501040_0005998
744 Ga0501041_0000457
745 Ga0501042_0000198
746 Ga0501043_0000774
747 Ga0501046_0003551
748 Ga0501047_0001878
749 Ga0501048_0000104
750 Ga0501067_0019740
751 Ga0501068_0000186
752 Ga0501068_0198616
753 Ga0501069_0000164
754 Ga0501070_0001813
755 Ga0501071_0000448
756 Ga0501072_0019028
757 Ga0501073_0001629
758 Ga0501074_0000321
759 Ga0501075_0008775
760 Ga0501076_0003894
761 Ga0501077_0000858
762 Ga0501077_0128373
763 Ga0501079_0000425
764 Ga0501080_0010245
765 Ga0501081_0004637
766 Ga0501083_0000378
767 Ga0501035_0011243
768 Ga0501044_0020358
769 Ga0501045_0001279
770 nmdc:mga05p37_548893_c1
771 nmdc:mga0qj67_8424_c1
772 nmdc:mga08y16_44986_c1
773 Ga0495612_0000197
774 Ga0501084_0008282
775 Ga0501084_0322145
776 Ga0501082_0001562
777 Ga0466962_0004496
778 Ga0530510_0002556

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

108

312

0.99

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

1

104

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8094 92 314
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.7909 90 314
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7804 93 314
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7792 92 314
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.7484 90 314
ID Description Score Start End Superfamily
af_P75798_87_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9276 90 314 1.10.3720.10
af_P75798_87_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9194 90 314 1.10.3720.10
af_Q2G1F7_265_478_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9187 89 311 1.10.3720.10
af_Q2FZR7_83_297_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9108 89 311 1.10.3720.10
af_Q2G1F7_265_478_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9066 89 311 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A6N7ZBD9-F1-model_v4 ABC transporter permease subunit 0.9455 1 319 GO:0005886
GO:0055085
AF-A0A1H2LBJ2-F1-model_v4 Peptide/nickel transport system permease protein 0.9377 1 318 GO:0005886
GO:0055085
AF-A0A7K3VNR4-F1-model_v4 ABC transporter permease subunit 0.9333 1 318 GO:0005886
GO:0071916
AF-A0A2V6SZQ2-F1-model_v4 ABC transporter permease 0.933 1 319 GO:0005886
GO:0055085
AF-A0A233V6B2-F1-model_v4 deleted 0.9313 1 318

Map