F431516

General Info

Members Datasets Scaffolds Average Seq Length
389 215 778 166

Family's Representative Sequence

Representative Sequence 3300042436|Ga0439435_0024804|Ga0439435_0024804_393_944
Length 183
Sequence MRPSLLTLRVGFALPALACAALLGFGYYLQYVEGLNPCPLCLVQRGFFYAVAGTCVIASIHAPRGWGRTAYGLVAALFAAGGFATAARQVWLQHLPPDKVPQCGPDLYFMFENFPLSRVLKTLITGTGECAVVDWTFLGLSIAEWSLGCFAALFVYALWLALRRPKAGAATDVSFAEVEGKFR

Samples

Sample ID Description Type Environment
1 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
123 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
124 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
125 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
126 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
127 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
128 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
129 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
130 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
149 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
150 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
151 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.26
Rhizosphere 99.74
Stem 0
Stem Tuber 0
Unclassified 5.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439435_0024804 3300042436 Bacteria 1585
2 Ga0065707_10017228 3300005295 Bacteria 2149
3 Ga0065707_10273938 3300005295 Bacteria 1064
4 Ga0070690_100002307 3300005330 Bacteria 10235
5 Ga0070690_100205564 3300005330 Bacteria 1372
6 Ga0070690_100405553 3300005330 Bacteria 1002
7 Ga0068869_100000375 3300005334 Bacteria 24179
8 Ga0068869_100283872 3300005334 Bacteria 1332
9 Ga0068869_100411716 3300005334 Bacteria 1114
10 Ga0070666_10100909 3300005335 Bacteria 1989
11 Ga0070680_100014484 3300005336 Bacteria 6168
12 Ga0070680_100041388 3300005336 Bacteria 3736
13 Ga0070680_100093135 3300005336 Bacteria 2496
14 Ga0068868_100002270 3300005338 Bacteria 13291
15 Ga0070689_100000515 3300005340 Bacteria 22798
16 Ga0070689_100040033 3300005340 Bacteria 3591
17 Ga0070689_100064659 3300005340 Bacteria 2848
18 Ga0070691_10000659 3300005341 Bacteria 13388
19 Ga0070691_10271451 3300005341 Bacteria 917
20 Ga0070687_100000478 3300005343 Bacteria 13360
21 Ga0070687_100698547 3300005343 Bacteria 708
22 Ga0070692_10011402 3300005345 Bacteria 4079
23 Ga0070692_10377576 3300005345 Bacteria 888
24 Ga0070669_100032363 3300005353 Bacteria 3777
25 Ga0070675_100413456 3300005354 Bacteria 1205
26 Ga0070675_100977084 3300005354 Unclassified 777
27 Ga0070671_100531591 3300005355 Bacteria 1013
28 Ga0070673_100085478 3300005364 Bacteria 2568
29 Ga0070688_100063879 3300005365 Bacteria 2335
30 Ga0070703_10004268 3300005406 Bacteria 4025
31 Ga0070701_10005756 3300005438 Bacteria 5155
32 Ga0070701_10024194 3300005438 Bacteria 2936
33 Ga0070701_10602025 3300005438 Bacteria 728
34 Ga0070705_100000550 3300005440 Bacteria 21825
35 Ga0070705_100296087 3300005440 Bacteria 1157
36 Ga0070700_100000655 3300005441 Bacteria 17084
37 Ga0070700_100387650 3300005441 Bacteria 1047
38 Ga0070700_100563175 3300005441 Bacteria 887
39 Ga0070694_100000619 3300005444 Bacteria 19541
40 Ga0070694_100007617 3300005444 Bacteria 6610
41 Ga0070708_100581364 3300005445 Bacteria 1056
42 Ga0070681_10000081 3300005458 Bacteria 71809
43 Ga0068867_100000084 3300005459 Bacteria 58558
44 Ga0068867_100346715 3300005459 Bacteria 1238
45 Ga0070685_10150325 3300005466 Bacteria 1475
46 Ga0070685_10387770 3300005466 Bacteria 964
47 Ga0070706_100506462 3300005467 Bacteria 1123
48 Ga0070707_100961655 3300005468 Bacteria 819
49 Ga0070698_100396051 3300005471 Bacteria 1314
50 Ga0070698_101244617 3300005471 Bacteria 694
51 Ga0070679_100003371 3300005530 Bacteria 14644
52 Ga0070679_100505825 3300005530 Bacteria 1152
53 Ga0070697_100061939 3300005536 Bacteria 3052
54 Ga0070697_100271249 3300005536 Bacteria 1454
55 Ga0068853_100056580 3300005539 Bacteria 3383
56 Ga0070686_100001812 3300005544 Bacteria 11919
57 Ga0070686_100074101 3300005544 Bacteria 2236
58 Ga0070686_100279764 3300005544 Bacteria 1230
59 Ga0070695_100000303 3300005545 Bacteria 24889
60 Ga0070695_100020629 3300005545 Bacteria 4024
61 Ga0070696_100000284 3300005546 Bacteria 30526
62 Ga0070696_100005905 3300005546 Bacteria 8174
63 Ga0070696_100222525 3300005546 Bacteria 1417
64 Ga0070696_100292508 3300005546 Bacteria 1245
65 Ga0070693_100000158 3300005547 Bacteria 30990
66 Ga0070693_100140122 3300005547 Bacteria 1521
67 Ga0070704_100002568 3300005549 Bacteria 10235
68 Ga0070704_101109973 3300005549 Bacteria 719
69 Ga0068855_100000242 3300005563 Bacteria 68674
70 Ga0068857_101356967 3300005577 Bacteria 691
71 Ga0068854_100002193 3300005578 Bacteria 12002
72 Ga0068856_100004536 3300005614 Bacteria 13807
73 Ga0070702_100000091 3300005615 Bacteria 26542
74 Ga0070702_100351948 3300005615 Bacteria 1038
75 Ga0068852_100224182 3300005616 Bacteria 1789
76 Ga0068859_100003784 3300005617 Bacteria 15435
77 Ga0068859_101650146 3300005617 Bacteria 708
78 Ga0068864_100040161 3300005618 Bacteria 4003
79 Ga0068864_101306910 3300005618 Bacteria 726
80 Ga0068866_10001238 3300005718 Bacteria 11077
81 Ga0068861_100002493 3300005719 Bacteria 12007
82 Ga0068861_100183063 3300005719 Bacteria 1745
83 Ga0068870_10162612 3300005840 Bacteria 1325
84 Ga0068863_100231460 3300005841 Bacteria 1782
85 Ga0068858_100000844 3300005842 Bacteria 31724
86 Ga0068858_100179636 3300005842 Bacteria 1998
87 Ga0068860_100000973 3300005843 Bacteria 31743
88 Ga0068860_100709309 3300005843 Bacteria 1016
89 Ga0068862_100000899 3300005844 Bacteria 28835
90 Ga0068862_100463989 3300005844 Bacteria 1196
91 Ga0070715_10249181 3300006163 Bacteria 927
92 Ga0097621_100003574 3300006237 Bacteria 10747
93 Ga0068871_100001933 3300006358 Bacteria 14021
94 Ga0075428_100000183 3300006844 Bacteria 58831
95 Ga0075428_100076502 3300006844 Bacteria 3654
96 Ga0075428_101083412 3300006844 Unclassified 846
97 Ga0075430_100040423 3300006846 Bacteria 3947
98 Ga0075430_100108761 3300006846 Bacteria 2313
99 Ga0075430_100188925 3300006846 Unclassified 1712
100 Ga0075430_101230630 3300006846 Bacteria 616
101 Ga0075431_100509015 3300006847 Bacteria 1194
102 Ga0075431_101516995 3300006847 Unclassified 629
103 Ga0075433_10000608 3300006852 Bacteria 23843
104 Ga0075433_10156643 3300006852 Bacteria 2027
105 Ga0075433_10703760 3300006852 Bacteria 885
106 Ga0075434_100000079 3300006871 Bacteria 52051
107 Ga0075434_100002189 3300006871 Bacteria 17038
108 Ga0075434_101314941 3300006871 Bacteria 734
109 Ga0075429_100002573 3300006880 Bacteria 15293
110 Ga0075429_100139714 3300006880 Bacteria 2120
111 Ga0068865_100000397 3300006881 Bacteria 24266
112 Ga0075436_100000521 3300006914 Bacteria 25029
113 Ga0097620_100003784 3300006931 Bacteria 15435
114 Ga0097620_101650740 3300006931 Bacteria 708
115 Ga0075435_100002594 3300007076 Bacteria 12053
116 Ga0075435_100003721 3300007076 Bacteria 10387
117 Ga0075435_100518508 3300007076 Bacteria 1031
118 Ga0075435_101090107 3300007076 Bacteria 698
119 Ga0099794_10050996 3300007265 Bacteria 1992
120 Ga0105250_10043814 3300009092 Bacteria 1794
121 Ga0111539_10017078 3300009094 Bacteria 8984
122 Ga0111539_10121185 3300009094 Bacteria 3065
123 Ga0111539_10159228 3300009094 Bacteria 2641
124 Ga0111539_10337703 3300009094 Bacteria 1754
125 Ga0105245_10000245 3300009098 Bacteria 51952
126 Ga0114129_10000219 3300009147 Bacteria 63579
127 Ga0105243_10003678 3300009148 Bacteria 12325
128 Ga0105241_10006116 3300009174 Bacteria 8871
129 Ga0105242_10018777 3300009176 Bacteria 5410
130 Ga0105239_10102594 3300010375 Bacteria 3166
131 Ga0157378_10000294 3300013297 Bacteria 48405
132 Ga0163162_10284200 3300013306 Bacteria 1786
133 Ga0157372_10444027 3300013307 Bacteria 1512
134 Ga0157380_10163132 3300014326 Bacteria 1939
135 Ga0157377_10124312 3300014745 Bacteria 1568
136 Ga0157376_10001613 3300014969 Bacteria 14923
137 Ga0163161_10245257 3300017792 Bacteria 1395
138 Ga0207642_10000931 3300025899 Bacteria 9163
139 Ga0207688_10250120 3300025901 Bacteria 1074
140 Ga0207647_10105446 3300025904 Bacteria 1670
141 Ga0207685_10181289 3300025905 Bacteria 976
142 Ga0207643_10109186 3300025908 Bacteria 1628
143 Ga0207654_10017309 3300025911 Bacteria 3764
144 Ga0207707_10008241 3300025912 Bacteria 9046
145 Ga0207660_10028924 3300025917 Bacteria 3797
146 Ga0207660_10033866 3300025917 Bacteria 3537
147 Ga0207660_10939717 3300025917 Unclassified 705
148 Ga0207662_10001141 3300025918 Bacteria 12542
149 Ga0207662_10226679 3300025918 Bacteria 1219
150 Ga0207652_10125444 3300025921 Bacteria 2286
151 Ga0207652_10393934 3300025921 Bacteria 1250
152 Ga0207659_10805809 3300025926 Bacteria 807
153 Ga0207659_10832900 3300025926 Unclassified 793
154 Ga0207687_10000506 3300025927 Bacteria 26240
155 Ga0207686_10002377 3300025934 Bacteria 10265
156 Ga0207709_10001717 3300025935 Bacteria 14764
157 Ga0207670_10002127 3300025936 Bacteria 10358
158 Ga0207670_10016219 3300025936 Bacteria 4471
159 Ga0207670_10346552 3300025936 Bacteria 1175
160 Ga0207670_10529598 3300025936 Bacteria 960
161 Ga0207704_10000218 3300025938 Bacteria 28751
162 Ga0207665_10490370 3300025939 Bacteria 948
163 Ga0207711_10104764 3300025941 Bacteria 2507
164 Ga0207689_10000293 3300025942 Bacteria 45522
165 Ga0207689_10106795 3300025942 Bacteria 2300
166 Ga0207689_10500807 3300025942 Bacteria 1018
167 Ga0207667_10009572 3300025949 Bacteria 11402
168 Ga0207651_10091882 3300025960 Bacteria 2224
169 Ga0207640_10001384 3300025981 Bacteria 13125
170 Ga0207677_10001676 3300026023 Bacteria 11735
171 Ga0207703_10004550 3300026035 Bacteria 11368
172 Ga0207708_10001685 3300026075 Bacteria 16375
173 Ga0207708_10125402 3300026075 Bacteria 2004
174 Ga0207702_10014595 3300026078 Bacteria 6520
175 Ga0207641_10363061 3300026088 Bacteria 1383
176 Ga0207648_10000185 3300026089 Bacteria 65925
177 Ga0207648_10236668 3300026089 Unclassified 1625
178 Ga0207676_10098784 3300026095 Bacteria 2414
179 Ga0207675_100000150 3300026118 Bacteria 61064
180 Ga0207675_100414586 3300026118 Bacteria 1329
181 Ga0210000_1023097 3300027462 Bacteria 957
182 Ga0209995_1016615 3300027471 Bacteria 1209
183 Ga0209968_1045321 3300027526 Bacteria 756
184 Ga0209588_1068719 3300027671 Bacteria 1144
185 Ga0207428_10000290 3300027907 Bacteria 67367
186 Ga0207428_10057114 3300027907 Bacteria 3099
187 Ga0207428_10311008 3300027907 Bacteria 1165
188 Ga0268265_10001178 3300028380 Bacteria 22895
189 Ga0268265_10410653 3300028380 Bacteria 1254
190 Ga0268264_10000580 3300028381 Bacteria 44357
191 Ga0307408_100088467 3300031548 Bacteria 2333
192 Ga0307408_101111222 3300031548 Bacteria 734
193 Ga0316575_10227558 3300031665 Unclassified 779
194 Ga0307405_10559737 3300031731 Bacteria 927
195 Ga0307416_100081401 3300032002 Bacteria 2738
196 Ga0373948_0084909 3300034817 Unclassified 727
197 Ga0373950_0027395 3300034818 Bacteria 1039
198 Ga0373958_0005835 3300034819 Bacteria 1891
199 Ga0373959_0011593 3300034820 Bacteria 1560
200 Ga0373926_0027412 3300035083 Bacteria 1996
201 Ga0373928_0004177 3300035084 Bacteria 2752
202 Ga0373940_0000428 3300035088 Bacteria 6415
203 Ga0373944_0178484 3300035089 Unclassified 760
204 Ga0373951_0014069 3300035091 Bacteria 1799
205 Ga0373923_0032609 3300035111 Bacteria 2105
206 Ga0373932_0002047 3300035112 Bacteria 5268
207 Ga0373932_0132124 3300035112 Bacteria 842
208 Ga0373936_0037733 3300035113 Bacteria 1930
209 Ga0373939_0002333 3300035114 Bacteria 4487
210 Ga0373941_0020609 3300035115 Bacteria 1850
211 Ga0373941_0276380 3300035115 Bacteria 663
212 Ga0373945_0026731 3300035116 Bacteria 2011
213 Ga0373960_0044460 3300035121 Bacteria 1297
214 Ga0373960_0120596 3300035121 Unclassified 870
215 Ga0373943_0003480 3300035170 Bacteria 7164
216 Ga0373943_0066653 3300035170 Bacteria 1813
217 Ga0373946_0017792 3300035171 Bacteria 2722
218 Ga0373942_0020276 3300035207 Bacteria 1668
219 Ga0373942_0033650 3300035207 Bacteria 1367
220 Ga0373942_0050337 3300035207 Bacteria 1166
221 Ga0373961_0025688 3300035241 Bacteria 1603
222 Ga0373962_0021900 3300035242 Bacteria 1690
223 Ga0373931_0009099 3300035691 Bacteria 4738
224 Ga0373931_0019387 3300035691 Bacteria 3394
225 Ga0373931_0111052 3300035691 Bacteria 1555
226 Ga0373931_0261220 3300035691 Bacteria 1056
227 Ga0373931_0844428 3300035691 Bacteria 613
228 Ga0373935_0093732 3300035692 Bacteria 1969
229 Ga0373927_0040340 3300035695 Bacteria 3028
230 Ga0373927_0933755 3300035695 Unclassified 572
231 Ga0373947_0022716 3300035725 Bacteria 3640
232 Ga0373947_0295259 3300035725 Unclassified 1079
233 Ga0373925_0037800 3300037068 Bacteria 3565
234 Ga0373925_0694991 3300037068 Unclassified 838
235 Ga0439441_019261 3300042001 Bacteria 1240
236 Ga0439441_069412 3300042001 Bacteria 754
237 Ga0439443_014720 3300042003 Bacteria 1181
238 Ga0439451_069506 3300042009 Bacteria 705
239 Ga0439460_0017246 3300042461 Bacteria 1933
240 Ga0439460_0019745 3300042461 Bacteria 1828
241 Ga0451576_0001107 3300045051 Bacteria 49185
242 Ga0451576_0027139 3300045051 Bacteria 6153
243 Ga0451576_0029323 3300045051 Bacteria 5888
244 Ga0451576_0186796 3300045051 Bacteria 2164
245 Ga0451576_0321307 3300045051 Bacteria 1620
246 Ga0451576_0800440 3300045051 Bacteria 990
247 Ga0451576_0960176 3300045051 Bacteria 896
248 Ga0495603_0051351 3300046455 Bacteria 2451
249 Ga0495580_0009813 3300046472 Bacteria 7509
250 Ga0495582_0021035 3300046473 Bacteria 3573
251 Ga0495639_0016260 3300046475 Bacteria 3229
252 Ga0495594_0224386 3300046499 Bacteria 1071
253 Ga0495630_0079566 3300046517 Bacteria 2472
254 Ga0495640_0138770 3300046533 Bacteria 1568
255 Ga0495586_0029219 3300046535 Bacteria 2950
256 Ga0495586_0079922 3300046535 Bacteria 1796
257 Ga0495656_0003346 3300046615 Bacteria 5417
258 Ga0495634_0184233 3300046642 Bacteria 1306
259 Ga0495635_0128074 3300046663 Bacteria 1731
260 Ga0495647_0033446 3300046681 Bacteria 1921
261 Ga0495658_0006294 3300046683 Bacteria 5834
262 Ga0495669_0001965 3300046684 Bacteria 8447
263 Ga0495669_0195507 3300046684 Bacteria 966
264 Ga0495624_0076806 3300046690 Bacteria 2072
265 Ga0495581_0210287 3300047315 Bacteria 1138
266 Ga0495636_0013331 3300047318 Bacteria 3262
267 Ga0495676_0152572 3300047321 Bacteria 1642
268 Ga0495593_0444389 3300047673 Bacteria 649
269 Ga0496106_0173924 3300048909 Bacteria 1708
270 Ga0501031_0292091 3300049568 Bacteria 1057
271 Ga0501031_0640097 3300049568 Bacteria 683
272 Ga0501032_0250612 3300049569 Bacteria 1149
273 Ga0501033_0049913 3300049570 Bacteria 3105
274 Ga0501033_1043606 3300049570 Bacteria 545
275 Ga0501034_0124641 3300049571 Bacteria 2562
276 Ga0501036_0018495 3300049572 Bacteria 5840
277 Ga0501036_0038474 3300049572 Bacteria 4049
278 Ga0501036_0335535 3300049572 Bacteria 1263
279 Ga0501037_0045429 3300049573 Bacteria 3225
280 Ga0501037_0475638 3300049573 Unclassified 850
281 Ga0501038_0012223 3300049574 Bacteria 7839
282 Ga0501039_0005572 3300049575 Bacteria 9529
283 Ga0501039_0154790 3300049575 Bacteria 1801
284 Ga0501039_0193896 3300049575 Bacteria 1597
285 Ga0501039_0235421 3300049575 Bacteria 1440
286 Ga0501040_0000649 3300049576 Bacteria 21357
287 Ga0501040_0043609 3300049576 Bacteria 3058
288 Ga0501040_0101583 3300049576 Bacteria 2006
289 Ga0501040_0392960 3300049576 Unclassified 996
290 Ga0501041_0001112 3300049577 Bacteria 14741
291 Ga0501041_0056016 3300049577 Bacteria 2408
292 Ga0501041_0301111 3300049577 Bacteria 1010
293 Ga0501041_0622254 3300049577 Unclassified 689
294 Ga0501042_0051633 3300049578 Bacteria 2933
295 Ga0501042_0052738 3300049578 Bacteria 2901
296 Ga0501042_0234162 3300049578 Bacteria 1325
297 Ga0501042_0371556 3300049578 Bacteria 1035
298 Ga0501042_0829672 3300049578 Bacteria 673
299 Ga0501043_0229416 3300049579 Bacteria 1434
300 Ga0501046_0005433 3300049580 Bacteria 11388
301 Ga0501046_0548788 3300049580 Bacteria 824
302 Ga0501047_0229548 3300049581 Bacteria 1710
303 Ga0501048_0027723 3300049582 Bacteria 4113
304 Ga0501048_0073809 3300049582 Bacteria 2407
305 Ga0501048_0226986 3300049582 Bacteria 1325
306 Ga0501067_0414655 3300049583 Bacteria 751
307 Ga0501068_0027091 3300049584 Bacteria 3382
308 Ga0501068_0153174 3300049584 Bacteria 1450
309 Ga0501068_0190380 3300049584 Unclassified 1299
310 Ga0501070_0108123 3300049586 Bacteria 2298
311 Ga0501071_0019055 3300049587 Bacteria 4761
312 Ga0501071_0048910 3300049587 Bacteria 3042
313 Ga0501071_0216702 3300049587 Bacteria 1440
314 Ga0501071_0502906 3300049587 Bacteria 930
315 Ga0501071_0840439 3300049587 Bacteria 708
316 Ga0501072_0000808 3300049588 Bacteria 23019
317 Ga0501072_0010728 3300049588 Bacteria 6981
318 Ga0501072_0029167 3300049588 Bacteria 4308
319 Ga0501072_0492747 3300049588 Bacteria 969
320 Ga0501072_0643876 3300049588 Bacteria 834
321 Ga0501073_0046921 3300049589 Bacteria 3037
322 Ga0501074_0004699 3300049590 Bacteria 9780
323 Ga0501074_0118496 3300049590 Unclassified 1893
324 Ga0501074_0240636 3300049590 Bacteria 1287
325 Ga0501075_0007615 3300049591 Bacteria 7511
326 Ga0501075_0019395 3300049591 Bacteria 4933
327 Ga0501075_0235639 3300049591 Bacteria 1395
328 Ga0501075_0398731 3300049591 Bacteria 1049
329 Ga0501075_0426410 3300049591 Bacteria 1011
330 Ga0501075_0763933 3300049591 Bacteria 736
331 Ga0501076_0004869 3300049592 Bacteria 9596
332 Ga0501076_0045972 3300049592 Bacteria 3448
333 Ga0501076_0617454 3300049592 Bacteria 894
334 Ga0501077_0001285 3300049593 Bacteria 15168
335 Ga0501077_0025307 3300049593 Bacteria 3770
336 Ga0501209_305920 3300049656 Bacteria 501
337 Ga0501079_0026207 3300049741 Bacteria 4469
338 Ga0501079_0168403 3300049741 Bacteria 1708
339 Ga0501079_0176955 3300049741 Bacteria 1664
340 Ga0501080_0006262 3300049742 Bacteria 10677
341 Ga0501080_0695442 3300049742 Bacteria 897
342 Ga0501081_0000941 3300049743 Bacteria 17281
343 Ga0501081_0003390 3300049743 Bacteria 10147
344 Ga0501081_0372900 3300049743 Bacteria 1054
345 Ga0501035_0143803 3300049822 Bacteria 2072
346 Ga0501035_0295205 3300049822 Bacteria 1367
347 Ga0501035_0364731 3300049822 Bacteria 1207
348 Ga0501035_0483371 3300049822 Bacteria 1021
349 Ga0501035_0914173 3300049822 Bacteria 694
350 Ga0501045_0060319 3300049824 Bacteria 2780
351 Ga0501045_0087263 3300049824 Bacteria 2303
352 Ga0501045_0491528 3300049824 Bacteria 911
353 Ga0501045_0873085 3300049824 Bacteria 661
354 nmdc:mga05p37_154554_c1 3300050507 Bacteria 2804
355 nmdc:mga05p37_4185_c1 3300050507 Bacteria 16863
356 nmdc:mga09592_3155_c1 3300050508 Bacteria 13389
357 nmdc:mga09592_638777_c1 3300050508 Bacteria 910
358 nmdc:mga0qj67_15634_c1 3300050509 Bacteria 5748
359 nmdc:mga0qj67_565449_c1 3300050509 Unclassified 911
360 nmdc:mga0qj67_67808_c1 3300050509 Bacteria 2843
361 nmdc:mga0qj67_88444_c1 3300050509 Bacteria 2487
362 nmdc:mga06r32_126854_c1 3300050510 Bacteria 2521
363 nmdc:mga06r32_191203_c1 3300050510 Unclassified 2034
364 nmdc:mga06r32_428799_c1 3300050510 Bacteria 1303
365 nmdc:mga06r32_613213_c1 3300050510 Bacteria 1058
366 nmdc:mga08y16_10347_c1 3300050511 Bacteria 9792
367 nmdc:mga08y16_1093497_c1 3300050511 Unclassified 773
368 nmdc:mga08y16_162549_c1 3300050511 Bacteria 2320
369 nmdc:mga08y16_27324_c1 3300050511 Bacteria 6011
370 nmdc:mga0n895_186762_c1 3300050512 Bacteria 2104
371 nmdc:mga0n895_3901_c1 3300050512 Bacteria 12122
372 nmdc:mga0n895_460707_c1 3300050512 Bacteria 1283
373 nmdc:mga0n895_6991_c1 3300050512 Bacteria 9638
374 nmdc:mga0n895_788_c1 3300050512 Bacteria 22602
375 nmdc:mga0rr50_2233_c1 3300050513 Bacteria 10866
376 nmdc:mga0rr50_417777_c1 3300050513 Bacteria 1134
377 nmdc:mga0rr50_5282_c1 3300050513 Bacteria 7682
378 nmdc:mga08x19_142377_c1 3300050514 Bacteria 1620
379 nmdc:mga08x19_2313_c1 3300050514 Bacteria 11553
380 nmdc:mga08x19_355069_c1 3300050514 Bacteria 1024
381 nmdc:mga0a205_137_c1 3300050515 Bacteria 46112
382 nmdc:mga0a205_146632_c1 3300050515 Bacteria 2260
383 Ga0501084_0060724 3300054114 Bacteria 3164
384 Ga0501084_0074311 3300054114 Bacteria 2846
385 Ga0501082_0035599 3300060353 Bacteria 4291
386 Ga0501082_0037795 3300060353 Bacteria 4163
387 Ga0501082_1596372 3300060353 Bacteria 570
388 Ga0530510_0012436 3300061734 Bacteria 5979
389 Ga0530510_0019798 3300061734 Bacteria 4782
390 Ga0439435_0024804
391 Ga0065707_10017228
392 Ga0065707_10273938
393 Ga0070690_100002307
394 Ga0070690_100205564
395 Ga0070690_100405553
396 Ga0068869_100000375
397 Ga0068869_100283872
398 Ga0068869_100411716
399 Ga0070666_10100909
400 Ga0070680_100014484
401 Ga0070680_100041388
402 Ga0070680_100093135
403 Ga0068868_100002270
404 Ga0070689_100000515
405 Ga0070689_100040033
406 Ga0070689_100064659
407 Ga0070691_10000659
408 Ga0070691_10271451
409 Ga0070687_100000478
410 Ga0070687_100698547
411 Ga0070692_10011402
412 Ga0070692_10377576
413 Ga0070669_100032363
414 Ga0070675_100413456
415 Ga0070675_100977084
416 Ga0070671_100531591
417 Ga0070673_100085478
418 Ga0070688_100063879
419 Ga0070703_10004268
420 Ga0070701_10005756
421 Ga0070701_10024194
422 Ga0070701_10602025
423 Ga0070705_100000550
424 Ga0070705_100296087
425 Ga0070700_100000655
426 Ga0070700_100387650
427 Ga0070700_100563175
428 Ga0070694_100000619
429 Ga0070694_100007617
430 Ga0070708_100581364
431 Ga0070681_10000081
432 Ga0068867_100000084
433 Ga0068867_100346715
434 Ga0070685_10150325
435 Ga0070685_10387770
436 Ga0070706_100506462
437 Ga0070707_100961655
438 Ga0070698_100396051
439 Ga0070698_101244617
440 Ga0070679_100003371
441 Ga0070679_100505825
442 Ga0070697_100061939
443 Ga0070697_100271249
444 Ga0068853_100056580
445 Ga0070686_100001812
446 Ga0070686_100074101
447 Ga0070686_100279764
448 Ga0070695_100000303
449 Ga0070695_100020629
450 Ga0070696_100000284
451 Ga0070696_100005905
452 Ga0070696_100222525
453 Ga0070696_100292508
454 Ga0070693_100000158
455 Ga0070693_100140122
456 Ga0070704_100002568
457 Ga0070704_101109973
458 Ga0068855_100000242
459 Ga0068857_101356967
460 Ga0068854_100002193
461 Ga0068856_100004536
462 Ga0070702_100000091
463 Ga0070702_100351948
464 Ga0068852_100224182
465 Ga0068859_100003784
466 Ga0068859_101650146
467 Ga0068864_100040161
468 Ga0068864_101306910
469 Ga0068866_10001238
470 Ga0068861_100002493
471 Ga0068861_100183063
472 Ga0068870_10162612
473 Ga0068863_100231460
474 Ga0068858_100000844
475 Ga0068858_100179636
476 Ga0068860_100000973
477 Ga0068860_100709309
478 Ga0068862_100000899
479 Ga0068862_100463989
480 Ga0070715_10249181
481 Ga0097621_100003574
482 Ga0068871_100001933
483 Ga0075428_100000183
484 Ga0075428_100076502
485 Ga0075428_101083412
486 Ga0075430_100040423
487 Ga0075430_100108761
488 Ga0075430_100188925
489 Ga0075430_101230630
490 Ga0075431_100509015
491 Ga0075431_101516995
492 Ga0075433_10000608
493 Ga0075433_10156643
494 Ga0075433_10703760
495 Ga0075434_100000079
496 Ga0075434_100002189
497 Ga0075434_101314941
498 Ga0075429_100002573
499 Ga0075429_100139714
500 Ga0068865_100000397
501 Ga0075436_100000521
502 Ga0097620_100003784
503 Ga0097620_101650740
504 Ga0075435_100002594
505 Ga0075435_100003721
506 Ga0075435_100518508
507 Ga0075435_101090107
508 Ga0099794_10050996
509 Ga0105250_10043814
510 Ga0111539_10017078
511 Ga0111539_10121185
512 Ga0111539_10159228
513 Ga0111539_10337703
514 Ga0105245_10000245
515 Ga0114129_10000219
516 Ga0105243_10003678
517 Ga0105241_10006116
518 Ga0105242_10018777
519 Ga0105239_10102594
520 Ga0157378_10000294
521 Ga0163162_10284200
522 Ga0157372_10444027
523 Ga0157380_10163132
524 Ga0157377_10124312
525 Ga0157376_10001613
526 Ga0163161_10245257
527 Ga0207642_10000931
528 Ga0207688_10250120
529 Ga0207647_10105446
530 Ga0207685_10181289
531 Ga0207643_10109186
532 Ga0207654_10017309
533 Ga0207707_10008241
534 Ga0207660_10028924
535 Ga0207660_10033866
536 Ga0207660_10939717
537 Ga0207662_10001141
538 Ga0207662_10226679
539 Ga0207652_10125444
540 Ga0207652_10393934
541 Ga0207659_10805809
542 Ga0207659_10832900
543 Ga0207687_10000506
544 Ga0207686_10002377
545 Ga0207709_10001717
546 Ga0207670_10002127
547 Ga0207670_10016219
548 Ga0207670_10346552
549 Ga0207670_10529598
550 Ga0207704_10000218
551 Ga0207665_10490370
552 Ga0207711_10104764
553 Ga0207689_10000293
554 Ga0207689_10106795
555 Ga0207689_10500807
556 Ga0207667_10009572
557 Ga0207651_10091882
558 Ga0207640_10001384
559 Ga0207677_10001676
560 Ga0207703_10004550
561 Ga0207708_10001685
562 Ga0207708_10125402
563 Ga0207702_10014595
564 Ga0207641_10363061
565 Ga0207648_10000185
566 Ga0207648_10236668
567 Ga0207676_10098784
568 Ga0207675_100000150
569 Ga0207675_100414586
570 Ga0210000_1023097
571 Ga0209995_1016615
572 Ga0209968_1045321
573 Ga0209588_1068719
574 Ga0207428_10000290
575 Ga0207428_10057114
576 Ga0207428_10311008
577 Ga0268265_10001178
578 Ga0268265_10410653
579 Ga0268264_10000580
580 Ga0307408_100088467
581 Ga0307408_101111222
582 Ga0316575_10227558
583 Ga0307405_10559737
584 Ga0307416_100081401
585 Ga0373948_0084909
586 Ga0373950_0027395
587 Ga0373958_0005835
588 Ga0373959_0011593
589 Ga0373926_0027412
590 Ga0373928_0004177
591 Ga0373940_0000428
592 Ga0373944_0178484
593 Ga0373951_0014069
594 Ga0373923_0032609
595 Ga0373932_0002047
596 Ga0373932_0132124
597 Ga0373936_0037733
598 Ga0373939_0002333
599 Ga0373941_0020609
600 Ga0373941_0276380
601 Ga0373945_0026731
602 Ga0373960_0044460
603 Ga0373960_0120596
604 Ga0373943_0003480
605 Ga0373943_0066653
606 Ga0373946_0017792
607 Ga0373942_0020276
608 Ga0373942_0033650
609 Ga0373942_0050337
610 Ga0373961_0025688
611 Ga0373962_0021900
612 Ga0373931_0009099
613 Ga0373931_0019387
614 Ga0373931_0111052
615 Ga0373931_0261220
616 Ga0373931_0844428
617 Ga0373935_0093732
618 Ga0373927_0040340
619 Ga0373927_0933755
620 Ga0373947_0022716
621 Ga0373947_0295259
622 Ga0373925_0037800
623 Ga0373925_0694991
624 Ga0439441_019261
625 Ga0439441_069412
626 Ga0439443_014720
627 Ga0439451_069506
628 Ga0439460_0017246
629 Ga0439460_0019745
630 Ga0451576_0001107
631 Ga0451576_0027139
632 Ga0451576_0029323
633 Ga0451576_0186796
634 Ga0451576_0321307
635 Ga0451576_0800440
636 Ga0451576_0960176
637 Ga0495603_0051351
638 Ga0495580_0009813
639 Ga0495582_0021035
640 Ga0495639_0016260
641 Ga0495594_0224386
642 Ga0495630_0079566
643 Ga0495640_0138770
644 Ga0495586_0029219
645 Ga0495586_0079922
646 Ga0495656_0003346
647 Ga0495634_0184233
648 Ga0495635_0128074
649 Ga0495647_0033446
650 Ga0495658_0006294
651 Ga0495669_0001965
652 Ga0495669_0195507
653 Ga0495624_0076806
654 Ga0495581_0210287
655 Ga0495636_0013331
656 Ga0495676_0152572
657 Ga0495593_0444389
658 Ga0496106_0173924
659 Ga0501031_0292091
660 Ga0501031_0640097
661 Ga0501032_0250612
662 Ga0501033_0049913
663 Ga0501033_1043606
664 Ga0501034_0124641
665 Ga0501036_0018495
666 Ga0501036_0038474
667 Ga0501036_0335535
668 Ga0501037_0045429
669 Ga0501037_0475638
670 Ga0501038_0012223
671 Ga0501039_0005572
672 Ga0501039_0154790
673 Ga0501039_0193896
674 Ga0501039_0235421
675 Ga0501040_0000649
676 Ga0501040_0043609
677 Ga0501040_0101583
678 Ga0501040_0392960
679 Ga0501041_0001112
680 Ga0501041_0056016
681 Ga0501041_0301111
682 Ga0501041_0622254
683 Ga0501042_0051633
684 Ga0501042_0052738
685 Ga0501042_0234162
686 Ga0501042_0371556
687 Ga0501042_0829672
688 Ga0501043_0229416
689 Ga0501046_0005433
690 Ga0501046_0548788
691 Ga0501047_0229548
692 Ga0501048_0027723
693 Ga0501048_0073809
694 Ga0501048_0226986
695 Ga0501067_0414655
696 Ga0501068_0027091
697 Ga0501068_0153174
698 Ga0501068_0190380
699 Ga0501070_0108123
700 Ga0501071_0019055
701 Ga0501071_0048910
702 Ga0501071_0216702
703 Ga0501071_0502906
704 Ga0501071_0840439
705 Ga0501072_0000808
706 Ga0501072_0010728
707 Ga0501072_0029167
708 Ga0501072_0492747
709 Ga0501072_0643876
710 Ga0501073_0046921
711 Ga0501074_0004699
712 Ga0501074_0118496
713 Ga0501074_0240636
714 Ga0501075_0007615
715 Ga0501075_0019395
716 Ga0501075_0235639
717 Ga0501075_0398731
718 Ga0501075_0426410
719 Ga0501075_0763933
720 Ga0501076_0004869
721 Ga0501076_0045972
722 Ga0501076_0617454
723 Ga0501077_0001285
724 Ga0501077_0025307
725 Ga0501209_305920
726 Ga0501079_0026207
727 Ga0501079_0168403
728 Ga0501079_0176955
729 Ga0501080_0006262
730 Ga0501080_0695442
731 Ga0501081_0000941
732 Ga0501081_0003390
733 Ga0501081_0372900
734 Ga0501035_0143803
735 Ga0501035_0295205
736 Ga0501035_0364731
737 Ga0501035_0483371
738 Ga0501035_0914173
739 Ga0501045_0060319
740 Ga0501045_0087263
741 Ga0501045_0491528
742 Ga0501045_0873085
743 nmdc:mga05p37_154554_c1
744 nmdc:mga05p37_4185_c1
745 nmdc:mga09592_3155_c1
746 nmdc:mga09592_638777_c1
747 nmdc:mga0qj67_15634_c1
748 nmdc:mga0qj67_565449_c1
749 nmdc:mga0qj67_67808_c1
750 nmdc:mga0qj67_88444_c1
751 nmdc:mga06r32_126854_c1
752 nmdc:mga06r32_191203_c1
753 nmdc:mga06r32_428799_c1
754 nmdc:mga06r32_613213_c1
755 nmdc:mga08y16_10347_c1
756 nmdc:mga08y16_1093497_c1
757 nmdc:mga08y16_162549_c1
758 nmdc:mga08y16_27324_c1
759 nmdc:mga0n895_186762_c1
760 nmdc:mga0n895_3901_c1
761 nmdc:mga0n895_460707_c1
762 nmdc:mga0n895_6991_c1
763 nmdc:mga0n895_788_c1
764 nmdc:mga0rr50_2233_c1
765 nmdc:mga0rr50_417777_c1
766 nmdc:mga0rr50_5282_c1
767 nmdc:mga08x19_142377_c1
768 nmdc:mga08x19_2313_c1
769 nmdc:mga08x19_355069_c1
770 nmdc:mga0a205_137_c1
771 nmdc:mga0a205_146632_c1
772 Ga0501084_0060724
773 Ga0501084_0074311
774 Ga0501082_0035599
775 Ga0501082_0037795
776 Ga0501082_1596372
777 Ga0530510_0012436
778 Ga0530510_0019798

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02600

DsbB

Disulfide bond formation protein DsbB

8

160

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wvf-assembly1.cif.gz_A e.coli dsbb c104s with ubiquinone 0.7841 8 161
2ltq-assembly1.cif.gz_A high resolution structure of dsbb c41s by joint calculation with solid-state nmr and x-ray data 0.7423 8 157
6wvf-assembly1.cif.gz_A e.coli dsbb c104s with ubiquinone 0.7182 8 161
2ltq-assembly1.cif.gz_A high resolution structure of dsbb c41s by joint calculation with solid-state nmr and x-ray data 0.7123 8 157
2rld-assembly1.cif.gz_A crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.6719 7 157
ID Description Score Start End Superfamily
2zuqD00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.8043 8 155 1.20.1550.10
2zuqA00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.7872 8 157 1.20.1550.10
2zuqD00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.7592 8 155 1.20.1550.10
2zuqA00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.754 8 157 1.20.1550.10
af_A0A0N7KP95_36_181_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.6961 7 84 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A355SMU6-F1-model_v4 deleted 0.9962 8 96
AF-A0A2N6CI90-F1-model_v4 Disulfide bond formation protein B 0.987 6 97 GO:0005886
GO:0006457
GO:0015035
AF-A0A7C7WCB3-F1-model_v4 deleted 0.9846 8 97
AF-A0A536SLN7-F1-model_v4 Disulfide bond formation protein B 0.9784 8 97 GO:0005886
GO:0006457
GO:0015035
AF-A0A5S3VSY9-F1-model_v4 Disulfide bond formation protein B 0.928 8 93 GO:0005886
GO:0006457
GO:0015035

Map