F431493

General Info

Members Datasets Scaffolds Average Seq Length
389 132 778 133

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0041397|Ga0395900_0041397_4266_4679
Length 137
Sequence MSSPDSSTDHPASAAGLTGRRVLLVEDSPVVGPFTADLLAELGCEVAGPAPNMASARQLLEQGGLDAALIDVHIRGERAFALCELLEAKCVPFILTSGYADWQQMADKWRDRPRLQKPYTLDQVREALKSVLANPTE

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
114 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
132 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.2
Metatranscriptomes 1.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.88
Rhizosphere 95.12
Stem 0
Stem Tuber 0
Unclassified 6.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0041397 3300037418 Bacteria 4749
2 JGI24740J21852_10000395 3300001979 Bacteria 18718
3 JGI24740J21852_10020588 3300001979 Bacteria 2299
4 JGI24737J22298_10097553 3300001990 Bacteria 871
5 JGI24735J21928_10009401 3300002067 Bacteria 3139
6 JGI24735J21928_10081154 3300002067 Bacteria 929
7 Ga0058862_12571477 3300004803 Bacteria 1424
8 Ga0070658_10009323 3300005327 Bacteria 7891
9 Ga0070658_10014048 3300005327 Bacteria 6430
10 Ga0070658_10031261 3300005327 Bacteria 4275
11 Ga0070658_10181633 3300005327 Bacteria 1770
12 Ga0070658_10189768 3300005327 Unclassified 1732
13 Ga0070658_10784051 3300005327 Bacteria 828
14 Ga0070658_10973615 3300005327 Bacteria 738
15 Ga0070683_100007368 3300005329 Bacteria 9296
16 Ga0070683_100173904 3300005329 Bacteria 2044
17 Ga0070683_100264727 3300005329 Bacteria 1635
18 Ga0070670_100648316 3300005331 Bacteria 947
19 Ga0070680_100001266 3300005336 Bacteria 18260
20 Ga0070680_100001515 3300005336 Bacteria 16912
21 Ga0070680_100022870 3300005336 Bacteria 4981
22 Ga0070680_100038077 3300005336 Bacteria 3888
23 Ga0070680_100446446 3300005336 Bacteria 1104
24 Ga0070682_100090348 3300005337 Bacteria 2002
25 Ga0070682_100887591 3300005337 Bacteria 731
26 Ga0070660_100047650 3300005339 Bacteria 3290
27 Ga0070660_100093569 3300005339 Bacteria 2374
28 Ga0070660_100266888 3300005339 Bacteria 1398
29 Ga0070660_100308426 3300005339 Bacteria 1298
30 Ga0070691_10002404 3300005341 Bacteria 8304
31 Ga0070661_100000751 3300005344 Bacteria 23427
32 Ga0070661_100073520 3300005344 Bacteria 2517
33 Ga0070661_100118344 3300005344 Bacteria 1982
34 Ga0070661_100297503 3300005344 Bacteria 1255
35 Ga0070692_10172216 3300005345 Bacteria 1249
36 Ga0070671_100002812 3300005355 Bacteria 13522
37 Ga0070659_100020365 3300005366 Bacteria 5036
38 Ga0070659_100076535 3300005366 Bacteria 2668
39 Ga0070659_100097765 3300005366 Bacteria 2360
40 Ga0070659_100283053 3300005366 Bacteria 1379
41 Ga0070659_100525669 3300005366 Bacteria 1010
42 Ga0070659_101107615 3300005366 Bacteria 698
43 Ga0070714_100013667 3300005435 Bacteria 6511
44 Ga0070714_100927938 3300005435 Bacteria 846
45 Ga0070663_100161137 3300005455 Bacteria 1727
46 Ga0070663_100307023 3300005455 Bacteria 1272
47 Ga0070663_100558705 3300005455 Bacteria 957
48 Ga0070681_10046599 3300005458 Bacteria 4334
49 Ga0070681_10897617 3300005458 Bacteria 805
50 Ga0070679_100034003 3300005530 Bacteria 5050
51 Ga0070679_100096515 3300005530 Bacteria 2943
52 Ga0070679_100348148 3300005530 Bacteria 1429
53 Ga0070679_100411502 3300005530 Bacteria 1298
54 Ga0070679_101110218 3300005530 Bacteria 735
55 Ga0070684_100013978 3300005535 Bacteria 6489
56 Ga0070684_100018762 3300005535 Bacteria 5706
57 Ga0070684_100095540 3300005535 Bacteria 2648
58 Ga0070684_101521791 3300005535 Bacteria 631
59 Ga0068853_100023429 3300005539 Bacteria 5168
60 Ga0068853_100344232 3300005539 Bacteria 1386
61 Ga0068853_100644623 3300005539 Bacteria 1008
62 Ga0068853_100663064 3300005539 Bacteria 993
63 Ga0070672_100226914 3300005543 Bacteria 1568
64 Ga0070693_100007893 3300005547 Bacteria 5221
65 Ga0070693_100716675 3300005547 Bacteria 734
66 Ga0068855_100017478 3300005563 Bacteria 8625
67 Ga0068855_100159926 3300005563 Bacteria 2557
68 Ga0068855_100210107 3300005563 Bacteria 2187
69 Ga0068855_100233415 3300005563 Bacteria 2058
70 Ga0068855_100923829 3300005563 Bacteria 921
71 Ga0068855_101175996 3300005563 Unclassified 798
72 Ga0068855_102413001 3300005563 Unclassified 525
73 Ga0070664_100091223 3300005564 Bacteria 2637
74 Ga0070664_100136972 3300005564 Bacteria 2153
75 Ga0070664_101367616 3300005564 Bacteria 669
76 Ga0070664_102309911 3300005564 Bacteria 510
77 Ga0068857_100048485 3300005577 Bacteria 3771
78 Ga0068857_100072384 3300005577 Bacteria 3071
79 Ga0068857_101557466 3300005577 Bacteria 645
80 Ga0068854_100164659 3300005578 Bacteria 1720
81 Ga0068854_100528151 3300005578 Bacteria 998
82 Ga0068856_100002283 3300005614 Bacteria 19786
83 Ga0068856_100008535 3300005614 Bacteria 9959
84 Ga0068856_100267475 3300005614 Bacteria 1725
85 Ga0068852_100001393 3300005616 Bacteria 16266
86 Ga0068852_100046516 3300005616 Bacteria 3698
87 Ga0068852_100248118 3300005616 Bacteria 1704
88 Ga0068852_100301931 3300005616 Bacteria 1550
89 Ga0068852_100702425 3300005616 Bacteria 1021
90 Ga0068852_100908772 3300005616 Bacteria 897
91 Ga0068852_102135988 3300005616 Unclassified 582
92 Ga0068859_100055175 3300005617 Bacteria 3998
93 Ga0068864_100008522 3300005618 Bacteria 8460
94 Ga0068851_10164192 3300005834 Unclassified 1222
95 Ga0068863_100089558 3300005841 Bacteria 2918
96 Ga0068863_100333296 3300005841 Unclassified 1475
97 Ga0068858_100329850 3300005842 Bacteria 1459
98 Ga0068860_100302956 3300005843 Bacteria 1566
99 Ga0075428_100287974 3300006844 Bacteria 1767
100 Ga0075431_101983743 3300006847 Unclassified 537
101 Ga0075433_11181052 3300006852 Unclassified 664
102 Ga0097620_100036195 3300006931 Bacteria 4955
103 Ga0097620_100055175 3300006931 Bacteria 3998
104 Ga0105240_10016800 3300009093 Bacteria 9898
105 Ga0105240_10186903 3300009093 Bacteria 2439
106 Ga0111539_10007458 3300009094 Bacteria 14013
107 Ga0105247_10202027 3300009101 Bacteria 1336
108 Ga0105241_10252872 3300009174 Bacteria 1495
109 Ga0105241_10309507 3300009174 Bacteria 1358
110 Ga0105241_11787739 3300009174 Unclassified 599
111 Ga0105248_10002411 3300009177 Bacteria 20751
112 Ga0105248_10024475 3300009177 Bacteria 6713
113 Ga0105237_10034200 3300009545 Bacteria 5147
114 Ga0105237_12532380 3300009545 Unclassified 524
115 Ga0105238_10087416 3300009551 Bacteria 3104
116 Ga0105238_10191603 3300009551 Bacteria 2021
117 Ga0105238_10292240 3300009551 Bacteria 1612
118 Ga0105238_10359999 3300009551 Bacteria 1444
119 Ga0105239_11525815 3300010375 Unclassified 772
120 Ga0157373_10019335 3300013100 Bacteria 4960
121 Ga0157373_10024721 3300013100 Bacteria 4349
122 Ga0157373_10331213 3300013100 Bacteria 1084
123 Ga0157373_10390682 3300013100 Bacteria 996
124 Ga0157371_10007970 3300013102 Bacteria 8500
125 Ga0157371_10029261 3300013102 Bacteria 3986
126 Ga0157371_10052572 3300013102 Bacteria 2893
127 Ga0157371_10071577 3300013102 Bacteria 2454
128 Ga0157371_10196197 3300013102 Unclassified 1446
129 Ga0157371_10822390 3300013102 Bacteria 701
130 Ga0157370_10014992 3300013104 Bacteria 7902
131 Ga0157370_10033904 3300013104 Bacteria 4975
132 Ga0157370_10113000 3300013104 Bacteria 2538
133 Ga0157370_10260062 3300013104 Bacteria 1604
134 Ga0157370_10615138 3300013104 Bacteria 994
135 Ga0157370_10721090 3300013104 Bacteria 909
136 Ga0157370_10805765 3300013104 Bacteria 854
137 Ga0157369_10019164 3300013105 Bacteria 7656
138 Ga0157369_10029087 3300013105 Bacteria 6109
139 Ga0157369_10030651 3300013105 Bacteria 5930
140 Ga0157369_10033384 3300013105 Bacteria 5656
141 Ga0157369_10076543 3300013105 Bacteria 3587
142 Ga0157369_10236494 3300013105 Bacteria 1909
143 Ga0157369_10264362 3300013105 Bacteria 1794
144 Ga0157369_10358344 3300013105 Bacteria 1514
145 Ga0157369_10481911 3300013105 Bacteria 1284
146 Ga0157369_10928043 3300013105 Bacteria 892
147 Ga0157372_10092088 3300013307 Bacteria 3448
148 Ga0157372_10892055 3300013307 Bacteria 1032
149 Ga0157372_11187326 3300013307 Bacteria 882
150 Ga0157372_11343893 3300013307 Bacteria 824
151 Ga0197907_10183265 3300020069 Bacteria 1109
152 Ga0206354_10090054 3300020081 Bacteria 716
153 Ga0206354_10397790 3300020081 Bacteria 1774
154 Ga0206353_10486291 3300020082 Bacteria 640
155 Ga0206353_12029464 3300020082 Bacteria 2159
156 Ga0224712_10013205 3300022467 Bacteria 2622
157 Ga0207656_10465930 3300025321 Bacteria 639
158 Ga0207647_10001244 3300025904 Bacteria 19604
159 Ga0207705_10003328 3300025909 Bacteria 12219
160 Ga0207705_10016769 3300025909 Bacteria 5246
161 Ga0207705_10055665 3300025909 Bacteria 2852
162 Ga0207705_10093338 3300025909 Bacteria 2206
163 Ga0207705_10135717 3300025909 Bacteria 1834
164 Ga0207705_10148252 3300025909 Bacteria 1756
165 Ga0207654_11135421 3300025911 Bacteria 569
166 Ga0207707_11302482 3300025912 Bacteria 584
167 Ga0207695_10127540 3300025913 Bacteria 2505
168 Ga0207695_10395018 3300025913 Bacteria 1268
169 Ga0207671_10102236 3300025914 Bacteria 2172
170 Ga0207660_10000428 3300025917 Bacteria 27695
171 Ga0207660_10001990 3300025917 Bacteria 13616
172 Ga0207660_10004722 3300025917 Bacteria 8872
173 Ga0207660_10010029 3300025917 Bacteria 6137
174 Ga0207660_10616357 3300025917 Bacteria 884
175 Ga0207657_10006517 3300025919 Bacteria 12093
176 Ga0207657_10007289 3300025919 Bacteria 11347
177 Ga0207657_10103159 3300025919 Bacteria 2364
178 Ga0207657_10244292 3300025919 Unclassified 1432
179 Ga0207657_11495857 3300025919 Bacteria 505
180 Ga0207649_10034521 3300025920 Bacteria 3031
181 Ga0207649_10266186 3300025920 Bacteria 1241
182 Ga0207652_10023716 3300025921 Bacteria 5085
183 Ga0207652_10691256 3300025921 Bacteria 911
184 Ga0207694_10285693 3300025924 Bacteria 1356
185 Ga0207694_10506151 3300025924 Bacteria 1011
186 Ga0207694_10525896 3300025924 Bacteria 991
187 Ga0207694_10796510 3300025924 Bacteria 798
188 Ga0207664_10102392 3300025929 Bacteria 2368
189 Ga0207664_10791370 3300025929 Bacteria 853
190 Ga0207644_10038007 3300025931 Bacteria 3388
191 Ga0207690_10007818 3300025932 Bacteria 6349
192 Ga0207690_10086869 3300025932 Bacteria 2199
193 Ga0207690_10247883 3300025932 Bacteria 1375
194 Ga0207690_10785668 3300025932 Unclassified 786
195 Ga0207706_10657002 3300025933 Bacteria 898
196 Ga0207706_11141232 3300025933 Bacteria 650
197 Ga0207706_11476227 3300025933 Bacteria 555
198 Ga0207691_10235970 3300025940 Bacteria 1582
199 Ga0207711_10000371 3300025941 Bacteria 47663
200 Ga0207711_10047285 3300025941 Bacteria 3678
201 Ga0207661_10011354 3300025944 Bacteria 6449
202 Ga0207661_10038977 3300025944 Bacteria 3727
203 Ga0207661_10094715 3300025944 Bacteria 2495
204 Ga0207661_10585828 3300025944 Bacteria 1023
205 Ga0207661_11129081 3300025944 Unclassified 721
206 Ga0207679_10130446 3300025945 Bacteria 2015
207 Ga0207679_10185281 3300025945 Bacteria 1725
208 Ga0207679_10594578 3300025945 Bacteria 996
209 Ga0207667_10025075 3300025949 Bacteria 6536
210 Ga0207667_10467183 3300025949 Bacteria 1281
211 Ga0207651_10517365 3300025960 Bacteria 1034
212 Ga0207640_10081829 3300025981 Bacteria 2209
213 Ga0207640_10153510 3300025981 Bacteria 1695
214 Ga0207640_10226552 3300025981 Bacteria 1435
215 Ga0207640_10356333 3300025981 Bacteria 1177
216 Ga0207640_10937498 3300025981 Bacteria 758
217 Ga0207703_10128977 3300026035 Bacteria 2181
218 Ga0207639_10077583 3300026041 Bacteria 2619
219 Ga0207639_10299987 3300026041 Bacteria 1420
220 Ga0207678_10101657 3300026067 Bacteria 2455
221 Ga0207678_10189845 3300026067 Bacteria 1755
222 Ga0207678_10838889 3300026067 Bacteria 812
223 Ga0207702_10017241 3300026078 Bacteria 5976
224 Ga0207702_10018243 3300026078 Bacteria 5805
225 Ga0207702_10176674 3300026078 Bacteria 1963
226 Ga0207702_10547852 3300026078 Bacteria 1131
227 Ga0207702_10661996 3300026078 Bacteria 1027
228 Ga0207702_10723154 3300026078 Bacteria 982
229 Ga0207702_10813902 3300026078 Bacteria 924
230 Ga0207641_10075046 3300026088 Bacteria 2919
231 Ga0207641_10365112 3300026088 Unclassified 1379
232 Ga0207676_10003000 3300026095 Bacteria 12034
233 Ga0207674_10005756 3300026116 Bacteria 14709
234 Ga0207674_10017200 3300026116 Bacteria 7890
235 Ga0207674_10186499 3300026116 Bacteria 2025
236 Ga0207674_11883124 3300026116 Bacteria 564
237 Ga0207698_10000125 3300026142 Bacteria 48032
238 Ga0207698_10003409 3300026142 Bacteria 9567
239 Ga0207698_10026493 3300026142 Bacteria 4102
240 Ga0207698_10256770 3300026142 Bacteria 1603
241 Ga0207698_11145364 3300026142 Bacteria 791
242 Ga0207698_11890688 3300026142 Bacteria 612
243 Ga0207428_10000107 3300027907 Bacteria 115442
244 Ga0268264_10166734 3300028381 Bacteria 1989
245 Ga0307413_10023026 3300031824 Bacteria 3369
246 Ga0307410_10017052 3300031852 Bacteria 4349
247 Ga0307410_10198290 3300031852 Bacteria 1531
248 Ga0307410_11368834 3300031852 Bacteria 620
249 Ga0307406_10362073 3300031901 Bacteria 1137
250 Ga0307407_10141919 3300031903 Bacteria 1550
251 Ga0307409_100090400 3300031995 Bacteria 2506
252 Ga0307409_100527804 3300031995 Bacteria 1154
253 Ga0307409_100716241 3300031995 Bacteria 1001
254 Ga0307416_100581702 3300032002 Bacteria 1197
255 Ga0307414_10007118 3300032004 Bacteria 6278
256 Ga0307411_10051098 3300032005 Bacteria 2695
257 Ga0307415_100218240 3300032126 Bacteria 1527
258 Ga0395899_0010064 3300037312 Bacteria 7250
259 Ga0395899_0010148 3300037312 Bacteria 7221
260 Ga0395899_0021577 3300037312 Bacteria 4883
261 Ga0395899_0054972 3300037312 Bacteria 2945
262 Ga0395899_0062262 3300037312 Bacteria 2748
263 Ga0395899_0088166 3300037312 Bacteria 2251
264 Ga0395899_0175428 3300037312 Bacteria 1507
265 Ga0395899_0189386 3300037312 Bacteria 1440
266 Ga0395899_0193154 3300037312 Bacteria 1424
267 Ga0395899_0368587 3300037312 Bacteria 957
268 Ga0395899_0406156 3300037312 Bacteria 900
269 Ga0395899_0685583 3300037312 Bacteria 644
270 Ga0395900_0003817 3300037418 Bacteria 16107
271 Ga0395900_0004938 3300037418 Bacteria 14041
272 Ga0395900_0026826 3300037418 Bacteria 5895
273 Ga0395900_0056442 3300037418 Bacteria 4042
274 Ga0395900_0086051 3300037418 Bacteria 3230
275 Ga0395900_0094367 3300037418 Bacteria 3073
276 Ga0395900_0125501 3300037418 Bacteria 2632
277 Ga0395900_0188028 3300037418 Bacteria 2096
278 Ga0395900_0209758 3300037418 Bacteria 1967
279 Ga0395900_0327201 3300037418 Bacteria 1511
280 Ga0395900_0580154 3300037418 Bacteria 1063
281 Ga0395900_0781807 3300037418 Bacteria 883
282 Ga0395900_0789870 3300037418 Bacteria 878
283 Ga0395900_0855217 3300037418 Bacteria 835
284 Ga0395900_1256040 3300037418 Bacteria 655
285 Ga0395898_0016370 3300037466 Bacteria 7588
286 Ga0395898_0031279 3300037466 Bacteria 5319
287 Ga0395898_0033182 3300037466 Bacteria 5152
288 Ga0395898_0070893 3300037466 Bacteria 3368
289 Ga0395898_0077904 3300037466 Bacteria 3199
290 Ga0395898_0108721 3300037466 Bacteria 2659
291 Ga0395898_0170757 3300037466 Bacteria 2079
292 Ga0395898_0655169 3300037466 Unclassified 992
293 Ga0395898_0721804 3300037466 Bacteria 938
294 Ga0395898_0776886 3300037466 Bacteria 899
295 Ga0395905_0028270 3300037471 Bacteria 5286
296 Ga0395905_0041519 3300037471 Bacteria 4316
297 Ga0395905_0045307 3300037471 Bacteria 4125
298 Ga0395905_0325416 3300037471 Bacteria 1427
299 Ga0395905_0331300 3300037471 Bacteria 1413
300 Ga0395905_0335568 3300037471 Bacteria 1402
301 Ga0395905_0366623 3300037471 Bacteria 1333
302 Ga0395905_0606759 3300037471 Bacteria 996
303 Ga0395905_0850038 3300037471 Bacteria 815
304 Ga0395905_0894947 3300037471 Bacteria 791
305 Ga0395905_0948153 3300037471 Bacteria 763
306 Ga0395901_0000276 3300038443 Bacteria 63580
307 Ga0395901_0002407 3300038443 Bacteria 18999
308 Ga0395901_0007202 3300038443 Bacteria 11220
309 Ga0395901_0021478 3300038443 Bacteria 6614
310 Ga0395901_0034786 3300038443 Bacteria 5204
311 Ga0395901_0136123 3300038443 Bacteria 2582
312 Ga0395901_0280046 3300038443 Bacteria 1733
313 Ga0395901_0305496 3300038443 Bacteria 1649
314 Ga0395901_0430966 3300038443 Bacteria 1351
315 Ga0395901_0454002 3300038443 Bacteria 1310
316 Ga0395901_0683490 3300038443 Bacteria 1026
317 Ga0395901_1649602 3300038443 Bacteria 593
318 Ga0466966_0187330 3300044684 Bacteria 1254
319 Ga0466961_0286037 3300044693 Bacteria 1008
320 Ga0466961_0511274 3300044693 Unclassified 725
321 Ga0466961_0582450 3300044693 Bacteria 673
322 Ga0466963_0009183 3300044694 Bacteria 5948
323 Ga0466963_0013494 3300044694 Bacteria 5017
324 Ga0466963_0032786 3300044694 Bacteria 3366
325 Ga0466963_0040755 3300044694 Bacteria 3044
326 Ga0466963_0063039 3300044694 Bacteria 2480
327 Ga0466963_0432220 3300044694 Bacteria 928
328 Ga0466963_0483634 3300044694 Bacteria 874
329 Ga0466963_1344121 3300044694 Bacteria 501
330 Ga0466971_0001327 3300044719 Bacteria 10342
331 Ga0466971_0014589 3300044719 Bacteria 3459
332 Ga0466971_0441756 3300044719 Bacteria 637
333 Ga0466971_0451012 3300044719 Bacteria 631
334 Ga0466957_0015723 3300044842 Bacteria 4421
335 Ga0466957_0036328 3300044842 Bacteria 2961
336 Ga0466957_0235846 3300044842 Bacteria 1212
337 Ga0466957_0422916 3300044842 Bacteria 914
338 Ga0466957_0432827 3300044842 Bacteria 904
339 Ga0466960_0071438 3300044901 Bacteria 1729
340 Ga0466959_0052320 3300045049 Bacteria 2991
341 Ga0466958_0006764 3300045836 Bacteria 6262
342 Ga0466958_0031933 3300045836 Bacteria 3130
343 Ga0466958_0081566 3300045836 Bacteria 1991
344 Ga0466958_0128614 3300045836 Bacteria 1589
345 Ga0466958_0141761 3300045836 Bacteria 1513
346 Ga0466958_0290222 3300045836 Bacteria 1049
347 Ga0466967_0006215 3300045976 Bacteria 8417
348 Ga0466967_0011679 3300045976 Bacteria 6673
349 Ga0466967_0018975 3300045976 Bacteria 5517
350 Ga0466967_0023042 3300045976 Bacteria 5096
351 Ga0466967_0024138 3300045976 Bacteria 4994
352 Ga0466967_0025854 3300045976 Bacteria 4848
353 Ga0466967_0100832 3300045976 Bacteria 2638
354 Ga0466967_0101824 3300045976 Bacteria 2626
355 Ga0466967_0141523 3300045976 Bacteria 2241
356 Ga0466967_0422316 3300045976 Bacteria 1300
357 Ga0466967_0781611 3300045976 Bacteria 948
358 Ga0466967_0809862 3300045976 Bacteria 930
359 Ga0466967_0911000 3300045976 Bacteria 874
360 Ga0495663_0271486 3300046525 Bacteria 606
361 Ga0495669_0105110 3300046684 Bacteria 1314
362 Ga0495669_0107043 3300046684 Unclassified 1303
363 Ga0496100_0150736 3300048903 Unclassified 1658
364 Ga0496101_0040677 3300048904 Bacteria 3311
365 Ga0496102_1358738 3300048905 Bacteria 629
366 Ga0496104_1854501 3300048907 Unclassified 505
367 Ga0496105_0714370 3300048908 Bacteria 768
368 Ga0496106_0047022 3300048909 Bacteria 3245
369 Ga0496106_1059112 3300048909 Bacteria 636
370 Ga0496107_0000753 3300048910 Bacteria 18608
371 Ga0496107_0239546 3300048910 Bacteria 1350
372 Ga0496108_0005546 3300048911 Bacteria 10212
373 Ga0496109_0001450 3300048912 Bacteria 19654
374 Ga0496110_0005201 3300048913 Bacteria 10181
375 Ga0496111_0008598 3300048914 Bacteria 6768
376 Ga0496111_0145689 3300048914 Bacteria 1756
377 Ga0496112_0002102 3300048915 Bacteria 15796
378 Ga0496112_0007988 3300048915 Bacteria 9438
379 Ga0496112_1564616 3300048915 Unclassified 573
380 Ga0496113_0060512 3300048916 Bacteria 2855
381 Ga0496113_0410251 3300048916 Bacteria 1088
382 Ga0501249_015449 3300049679 Bacteria 1633
383 nmdc:mga06r32_1489911_c1 3300050510 Unclassified 617
384 nmdc:mga08y16_16_c1 3300050511 Bacteria 386948
385 nmdc:mga0a205_1012743_c1 3300050515 Unclassified 678
386 Ga0466962_0004900 3300061719 Bacteria 6439
387 Ga0466962_0011300 3300061719 Bacteria 4300
388 Ga0466962_0084335 3300061719 Bacteria 1520
389 Ga0466962_0365687 3300061719 Bacteria 719
390 Ga0395900_0041397
391 JGI24740J21852_10000395
392 JGI24740J21852_10020588
393 JGI24737J22298_10097553
394 JGI24735J21928_10009401
395 JGI24735J21928_10081154
396 Ga0058862_12571477
397 Ga0070658_10009323
398 Ga0070658_10014048
399 Ga0070658_10031261
400 Ga0070658_10181633
401 Ga0070658_10189768
402 Ga0070658_10784051
403 Ga0070658_10973615
404 Ga0070683_100007368
405 Ga0070683_100173904
406 Ga0070683_100264727
407 Ga0070670_100648316
408 Ga0070680_100001266
409 Ga0070680_100001515
410 Ga0070680_100022870
411 Ga0070680_100038077
412 Ga0070680_100446446
413 Ga0070682_100090348
414 Ga0070682_100887591
415 Ga0070660_100047650
416 Ga0070660_100093569
417 Ga0070660_100266888
418 Ga0070660_100308426
419 Ga0070691_10002404
420 Ga0070661_100000751
421 Ga0070661_100073520
422 Ga0070661_100118344
423 Ga0070661_100297503
424 Ga0070692_10172216
425 Ga0070671_100002812
426 Ga0070659_100020365
427 Ga0070659_100076535
428 Ga0070659_100097765
429 Ga0070659_100283053
430 Ga0070659_100525669
431 Ga0070659_101107615
432 Ga0070714_100013667
433 Ga0070714_100927938
434 Ga0070663_100161137
435 Ga0070663_100307023
436 Ga0070663_100558705
437 Ga0070681_10046599
438 Ga0070681_10897617
439 Ga0070679_100034003
440 Ga0070679_100096515
441 Ga0070679_100348148
442 Ga0070679_100411502
443 Ga0070679_101110218
444 Ga0070684_100013978
445 Ga0070684_100018762
446 Ga0070684_100095540
447 Ga0070684_101521791
448 Ga0068853_100023429
449 Ga0068853_100344232
450 Ga0068853_100644623
451 Ga0068853_100663064
452 Ga0070672_100226914
453 Ga0070693_100007893
454 Ga0070693_100716675
455 Ga0068855_100017478
456 Ga0068855_100159926
457 Ga0068855_100210107
458 Ga0068855_100233415
459 Ga0068855_100923829
460 Ga0068855_101175996
461 Ga0068855_102413001
462 Ga0070664_100091223
463 Ga0070664_100136972
464 Ga0070664_101367616
465 Ga0070664_102309911
466 Ga0068857_100048485
467 Ga0068857_100072384
468 Ga0068857_101557466
469 Ga0068854_100164659
470 Ga0068854_100528151
471 Ga0068856_100002283
472 Ga0068856_100008535
473 Ga0068856_100267475
474 Ga0068852_100001393
475 Ga0068852_100046516
476 Ga0068852_100248118
477 Ga0068852_100301931
478 Ga0068852_100702425
479 Ga0068852_100908772
480 Ga0068852_102135988
481 Ga0068859_100055175
482 Ga0068864_100008522
483 Ga0068851_10164192
484 Ga0068863_100089558
485 Ga0068863_100333296
486 Ga0068858_100329850
487 Ga0068860_100302956
488 Ga0075428_100287974
489 Ga0075431_101983743
490 Ga0075433_11181052
491 Ga0097620_100036195
492 Ga0097620_100055175
493 Ga0105240_10016800
494 Ga0105240_10186903
495 Ga0111539_10007458
496 Ga0105247_10202027
497 Ga0105241_10252872
498 Ga0105241_10309507
499 Ga0105241_11787739
500 Ga0105248_10002411
501 Ga0105248_10024475
502 Ga0105237_10034200
503 Ga0105237_12532380
504 Ga0105238_10087416
505 Ga0105238_10191603
506 Ga0105238_10292240
507 Ga0105238_10359999
508 Ga0105239_11525815
509 Ga0157373_10019335
510 Ga0157373_10024721
511 Ga0157373_10331213
512 Ga0157373_10390682
513 Ga0157371_10007970
514 Ga0157371_10029261
515 Ga0157371_10052572
516 Ga0157371_10071577
517 Ga0157371_10196197
518 Ga0157371_10822390
519 Ga0157370_10014992
520 Ga0157370_10033904
521 Ga0157370_10113000
522 Ga0157370_10260062
523 Ga0157370_10615138
524 Ga0157370_10721090
525 Ga0157370_10805765
526 Ga0157369_10019164
527 Ga0157369_10029087
528 Ga0157369_10030651
529 Ga0157369_10033384
530 Ga0157369_10076543
531 Ga0157369_10236494
532 Ga0157369_10264362
533 Ga0157369_10358344
534 Ga0157369_10481911
535 Ga0157369_10928043
536 Ga0157372_10092088
537 Ga0157372_10892055
538 Ga0157372_11187326
539 Ga0157372_11343893
540 Ga0197907_10183265
541 Ga0206354_10090054
542 Ga0206354_10397790
543 Ga0206353_10486291
544 Ga0206353_12029464
545 Ga0224712_10013205
546 Ga0207656_10465930
547 Ga0207647_10001244
548 Ga0207705_10003328
549 Ga0207705_10016769
550 Ga0207705_10055665
551 Ga0207705_10093338
552 Ga0207705_10135717
553 Ga0207705_10148252
554 Ga0207654_11135421
555 Ga0207707_11302482
556 Ga0207695_10127540
557 Ga0207695_10395018
558 Ga0207671_10102236
559 Ga0207660_10000428
560 Ga0207660_10001990
561 Ga0207660_10004722
562 Ga0207660_10010029
563 Ga0207660_10616357
564 Ga0207657_10006517
565 Ga0207657_10007289
566 Ga0207657_10103159
567 Ga0207657_10244292
568 Ga0207657_11495857
569 Ga0207649_10034521
570 Ga0207649_10266186
571 Ga0207652_10023716
572 Ga0207652_10691256
573 Ga0207694_10285693
574 Ga0207694_10506151
575 Ga0207694_10525896
576 Ga0207694_10796510
577 Ga0207664_10102392
578 Ga0207664_10791370
579 Ga0207644_10038007
580 Ga0207690_10007818
581 Ga0207690_10086869
582 Ga0207690_10247883
583 Ga0207690_10785668
584 Ga0207706_10657002
585 Ga0207706_11141232
586 Ga0207706_11476227
587 Ga0207691_10235970
588 Ga0207711_10000371
589 Ga0207711_10047285
590 Ga0207661_10011354
591 Ga0207661_10038977
592 Ga0207661_10094715
593 Ga0207661_10585828
594 Ga0207661_11129081
595 Ga0207679_10130446
596 Ga0207679_10185281
597 Ga0207679_10594578
598 Ga0207667_10025075
599 Ga0207667_10467183
600 Ga0207651_10517365
601 Ga0207640_10081829
602 Ga0207640_10153510
603 Ga0207640_10226552
604 Ga0207640_10356333
605 Ga0207640_10937498
606 Ga0207703_10128977
607 Ga0207639_10077583
608 Ga0207639_10299987
609 Ga0207678_10101657
610 Ga0207678_10189845
611 Ga0207678_10838889
612 Ga0207702_10017241
613 Ga0207702_10018243
614 Ga0207702_10176674
615 Ga0207702_10547852
616 Ga0207702_10661996
617 Ga0207702_10723154
618 Ga0207702_10813902
619 Ga0207641_10075046
620 Ga0207641_10365112
621 Ga0207676_10003000
622 Ga0207674_10005756
623 Ga0207674_10017200
624 Ga0207674_10186499
625 Ga0207674_11883124
626 Ga0207698_10000125
627 Ga0207698_10003409
628 Ga0207698_10026493
629 Ga0207698_10256770
630 Ga0207698_11145364
631 Ga0207698_11890688
632 Ga0207428_10000107
633 Ga0268264_10166734
634 Ga0307413_10023026
635 Ga0307410_10017052
636 Ga0307410_10198290
637 Ga0307410_11368834
638 Ga0307406_10362073
639 Ga0307407_10141919
640 Ga0307409_100090400
641 Ga0307409_100527804
642 Ga0307409_100716241
643 Ga0307416_100581702
644 Ga0307414_10007118
645 Ga0307411_10051098
646 Ga0307415_100218240
647 Ga0395899_0010064
648 Ga0395899_0010148
649 Ga0395899_0021577
650 Ga0395899_0054972
651 Ga0395899_0062262
652 Ga0395899_0088166
653 Ga0395899_0175428
654 Ga0395899_0189386
655 Ga0395899_0193154
656 Ga0395899_0368587
657 Ga0395899_0406156
658 Ga0395899_0685583
659 Ga0395900_0003817
660 Ga0395900_0004938
661 Ga0395900_0026826
662 Ga0395900_0056442
663 Ga0395900_0086051
664 Ga0395900_0094367
665 Ga0395900_0125501
666 Ga0395900_0188028
667 Ga0395900_0209758
668 Ga0395900_0327201
669 Ga0395900_0580154
670 Ga0395900_0781807
671 Ga0395900_0789870
672 Ga0395900_0855217
673 Ga0395900_1256040
674 Ga0395898_0016370
675 Ga0395898_0031279
676 Ga0395898_0033182
677 Ga0395898_0070893
678 Ga0395898_0077904
679 Ga0395898_0108721
680 Ga0395898_0170757
681 Ga0395898_0655169
682 Ga0395898_0721804
683 Ga0395898_0776886
684 Ga0395905_0028270
685 Ga0395905_0041519
686 Ga0395905_0045307
687 Ga0395905_0325416
688 Ga0395905_0331300
689 Ga0395905_0335568
690 Ga0395905_0366623
691 Ga0395905_0606759
692 Ga0395905_0850038
693 Ga0395905_0894947
694 Ga0395905_0948153
695 Ga0395901_0000276
696 Ga0395901_0002407
697 Ga0395901_0007202
698 Ga0395901_0021478
699 Ga0395901_0034786
700 Ga0395901_0136123
701 Ga0395901_0280046
702 Ga0395901_0305496
703 Ga0395901_0430966
704 Ga0395901_0454002
705 Ga0395901_0683490
706 Ga0395901_1649602
707 Ga0466966_0187330
708 Ga0466961_0286037
709 Ga0466961_0511274
710 Ga0466961_0582450
711 Ga0466963_0009183
712 Ga0466963_0013494
713 Ga0466963_0032786
714 Ga0466963_0040755
715 Ga0466963_0063039
716 Ga0466963_0432220
717 Ga0466963_0483634
718 Ga0466963_1344121
719 Ga0466971_0001327
720 Ga0466971_0014589
721 Ga0466971_0441756
722 Ga0466971_0451012
723 Ga0466957_0015723
724 Ga0466957_0036328
725 Ga0466957_0235846
726 Ga0466957_0422916
727 Ga0466957_0432827
728 Ga0466960_0071438
729 Ga0466959_0052320
730 Ga0466958_0006764
731 Ga0466958_0031933
732 Ga0466958_0081566
733 Ga0466958_0128614
734 Ga0466958_0141761
735 Ga0466958_0290222
736 Ga0466967_0006215
737 Ga0466967_0011679
738 Ga0466967_0018975
739 Ga0466967_0023042
740 Ga0466967_0024138
741 Ga0466967_0025854
742 Ga0466967_0100832
743 Ga0466967_0101824
744 Ga0466967_0141523
745 Ga0466967_0422316
746 Ga0466967_0781611
747 Ga0466967_0809862
748 Ga0466967_0911000
749 Ga0495663_0271486
750 Ga0495669_0105110
751 Ga0495669_0107043
752 Ga0496100_0150736
753 Ga0496101_0040677
754 Ga0496102_1358738
755 Ga0496104_1854501
756 Ga0496105_0714370
757 Ga0496106_0047022
758 Ga0496106_1059112
759 Ga0496107_0000753
760 Ga0496107_0239546
761 Ga0496108_0005546
762 Ga0496109_0001450
763 Ga0496110_0005201
764 Ga0496111_0008598
765 Ga0496111_0145689
766 Ga0496112_0002102
767 Ga0496112_0007988
768 Ga0496112_1564616
769 Ga0496113_0060512
770 Ga0496113_0410251
771 Ga0501249_015449
772 nmdc:mga06r32_1489911_c1
773 nmdc:mga08y16_16_c1
774 nmdc:mga0a205_1012743_c1
775 Ga0466962_0004900
776 Ga0466962_0011300
777 Ga0466962_0084335
778 Ga0466962_0365687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ieb-assembly1.cif.gz_A solution structure of sdrg from sphingomonas melonis fr1 0.9167 19 131
1zy2-assembly1.cif.gz_A crystal structure of the phosphorylated receiver domain of the transcription regulator ntrc1 from aquifex aeolicus 0.8835 21 133
6ifh-assembly1.cif.gz_A unphosphorylated spo0f from paenisporosarcina sp. tg-14 0.882 20 131
7ssi-assembly1.cif.gz_C crystal structure of the desk:desr-q10a complex in the phosphotransfer state 0.8765 18 133
5ieb-assembly1.cif.gz_A solution structure of sdrg from sphingomonas melonis fr1 0.8735 19 131
ID Description Score Start End Superfamily
5iebA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9167 19 131 3.40.50.2300
af_P0AFJ5_1_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9045 19 97 3.40.50.2300
af_Q2FVQ9_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9034 21 95 3.40.50.2300
af_Q2G2U6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9006 20 95 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8921 19 97 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7G9SIY2-F1-model_v4 Response regulator 0.9825 15 130 GO:0000160
AF-A0A1K2I1G7-F1-model_v4 CheY chemotaxis protein or a CheY-like REC (Receiver) domain 0.9713 17 132 GO:0000160
AF-A0A7G9SEB5-F1-model_v4 Response regulator 0.9711 37 131 GO:0000160
AF-A0A5N8AAD8-F1-model_v4 Response regulator 0.9702 19 131 GO:0000160
AF-A0A1T4LIT7-F1-model_v4 CheY chemotaxis protein or a CheY-like REC (Receiver) domain 0.9702 17 131 GO:0000160

Map