F431376

General Info

Members Datasets Scaffolds Average Seq Length
389 229 389 160

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100181821|Ga0075363_1001818213
Length 162
Sequence MIKRVIDTKVVNLDELKLEKFSAVGGKFEGESARIGQLLGAKDLGYSYDVVQPGKISCPFHSHAAEEEMFFIVKGSGTLRYGAETRKVRAGDFIFCPTGGPETAHQLVNDSEATLAYISVSTNKAAEVCEYPDSGKIGAFGEGGMRHMTKADAKVDYWKDEA

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
178 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
179 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
180 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.8
Nodule 0
Rhizoplane 3.34
Rhizosphere 94.34
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1032720 3300001976 Unclassified 688
2 JGI24747J21853_1026906 3300001978 Bacteria 646
3 Ga0065712_10647607 3300005290 Bacteria 561
4 Ga0065715_10351863 3300005293 Unclassified 943
5 Ga0070658_10025699 3300005327 Bacteria 4719
6 Ga0070676_10028488 3300005328 Bacteria 3173
7 Ga0070683_100006579 3300005329 Bacteria 9759
8 Ga0070683_100083903 3300005329 Bacteria 2985
9 Ga0070670_100004813 3300005331 Bacteria 11336
10 Ga0070670_100173938 3300005331 Unclassified 1868
11 Ga0070670_100998774 3300005331 Bacteria 761
12 Ga0070677_10018389 3300005333 Bacteria 2516
13 Ga0068869_100343213 3300005334 Bacteria 1216
14 Ga0070666_10045708 3300005335 Bacteria 2935
15 Ga0070680_100085566 3300005336 Bacteria 2605
16 Ga0070680_100326695 3300005336 Bacteria 1302
17 Ga0070680_100926477 3300005336 Bacteria 752
18 Ga0070680_100980819 3300005336 Bacteria 729
19 Ga0070682_100062303 3300005337 Bacteria 2362
20 Ga0068868_100093963 3300005338 Bacteria 2419
21 Ga0068868_100175369 3300005338 Bacteria 1776
22 Ga0070660_100156841 3300005339 Bacteria 1832
23 Ga0070660_100170168 3300005339 Unclassified 1759
24 Ga0070660_100433105 3300005339 Bacteria 1090
25 Ga0070660_101184080 3300005339 Bacteria 648
26 Ga0070689_100152215 3300005340 Bacteria 1866
27 Ga0070689_100300680 3300005340 Bacteria 1336
28 Ga0070689_100429284 3300005340 Bacteria 1121
29 Ga0070687_100144547 3300005343 Bacteria 1389
30 Ga0070661_100016160 3300005344 Bacteria 5270
31 Ga0070661_100019456 3300005344 Bacteria 4839
32 Ga0070661_100059811 3300005344 Unclassified 2795
33 Ga0070661_100164045 3300005344 Bacteria 1684
34 Ga0070668_100007069 3300005347 Bacteria 8316
35 Ga0070668_100163649 3300005347 Bacteria 1807
36 Ga0070669_100064240 3300005353 Bacteria 2703
37 Ga0070671_100020736 3300005355 Bacteria 5361
38 Ga0070671_100044056 3300005355 Bacteria 3707
39 Ga0070671_100098979 3300005355 Unclassified 2446
40 Ga0070671_100631371 3300005355 Bacteria 927
41 Ga0070671_100889475 3300005355 Bacteria 778
42 Ga0070674_100009639 3300005356 Bacteria 5792
43 Ga0070674_100451135 3300005356 Bacteria 1061
44 Ga0070673_100062399 3300005364 Bacteria 2960
45 Ga0070688_100029232 3300005365 Unclassified 3299
46 Ga0070688_100708875 3300005365 Bacteria 780
47 Ga0070659_100068610 3300005366 Bacteria 2813
48 Ga0070667_100154551 3300005367 Bacteria 2017
49 Ga0070709_10009145 3300005434 Bacteria 5453
50 Ga0070714_100009300 3300005435 Bacteria 7723
51 Ga0070714_100271491 3300005435 Bacteria 1573
52 Ga0070713_100000033 3300005436 Bacteria 86758
53 Ga0070713_100349978 3300005436 Bacteria 1370
54 Ga0070710_10004660 3300005437 Bacteria 6485
55 Ga0070701_10230514 3300005438 Bacteria 1109
56 Ga0070711_100929221 3300005439 Bacteria 744
57 Ga0070705_100161359 3300005440 Bacteria 1499
58 Ga0070705_100820064 3300005440 Bacteria 742
59 Ga0070700_100283621 3300005441 Bacteria 1202
60 Ga0070700_100294637 3300005441 Bacteria 1182
61 Ga0070694_100240413 3300005444 Bacteria 1366
62 Ga0070708_100448534 3300005445 Bacteria 1217
63 Ga0070708_100496836 3300005445 Bacteria 1151
64 Ga0070708_100713762 3300005445 Bacteria 943
65 Ga0070663_100009653 3300005455 Bacteria 5985
66 Ga0070663_100637809 3300005455 Bacteria 900
67 Ga0070678_100763390 3300005456 Bacteria 875
68 Ga0070678_101308001 3300005456 Bacteria 675
69 Ga0070662_100955794 3300005457 Bacteria 732
70 Ga0070681_10016744 3300005458 Bacteria 7318
71 Ga0070681_10159376 3300005458 Bacteria 2180
72 Ga0070681_10523626 3300005458 Bacteria 1099
73 Ga0070681_11064040 3300005458 Bacteria 729
74 Ga0068867_100037181 3300005459 Bacteria 3538
75 Ga0070706_100042191 3300005467 Bacteria 4213
76 Ga0070706_100179241 3300005467 Bacteria 1978
77 Ga0070706_100229256 3300005467 Bacteria 1734
78 Ga0070707_100031454 3300005468 Bacteria 5056
79 Ga0070707_100574996 3300005468 Bacteria 1089
80 Ga0070699_100057762 3300005518 Bacteria 3360
81 Ga0070699_100191200 3300005518 Bacteria 1818
82 Ga0070679_100029525 3300005530 Bacteria 5411
83 Ga0070679_100152705 3300005530 Bacteria 2285
84 Ga0070679_100247646 3300005530 Bacteria 1739
85 Ga0070684_100084765 3300005535 Unclassified 2809
86 Ga0070684_100725703 3300005535 Unclassified 927
87 Ga0068853_100018586 3300005539 Bacteria 5755
88 Ga0068853_100221028 3300005539 Bacteria 1730
89 Ga0068853_100500452 3300005539 Bacteria 1147
90 Ga0068853_100502544 3300005539 Unclassified 1145
91 Ga0070672_100615107 3300005543 Bacteria 947
92 Ga0070672_100675259 3300005543 Unclassified 903
93 Ga0070672_101335157 3300005543 Unclassified 641
94 Ga0070686_100974876 3300005544 Bacteria 694
95 Ga0070695_100121128 3300005545 Bacteria 1790
96 Ga0070695_100251769 3300005545 Bacteria 1286
97 Ga0070696_100266096 3300005546 Bacteria 1302
98 Ga0070696_100920789 3300005546 Bacteria 726
99 Ga0070693_100000927 3300005547 Bacteria 13023
100 Ga0070665_100035323 3300005548 Bacteria 5025
101 Ga0070704_100111525 3300005549 Bacteria 2082
102 Ga0070704_100413100 3300005549 Bacteria 1154
103 Ga0070704_100464072 3300005549 Bacteria 1093
104 Ga0068855_100054211 3300005563 Bacteria 4713
105 Ga0070664_100016958 3300005564 Bacteria 5978
106 Ga0070664_100025537 3300005564 Bacteria 4898
107 Ga0070664_100784240 3300005564 Bacteria 890
108 Ga0068857_100038342 3300005577 Bacteria 4244
109 Ga0068857_100164193 3300005577 Bacteria 2016
110 Ga0068854_100011025 3300005578 Bacteria 5867
111 Ga0068854_100440708 3300005578 Bacteria 1086
112 Ga0068854_100995767 3300005578 Bacteria 742
113 Ga0068856_100003867 3300005614 Bacteria 15029
114 Ga0068856_100642954 3300005614 Unclassified 1081
115 Ga0068852_100089747 3300005616 Bacteria 2748
116 Ga0068859_100085863 3300005617 Bacteria 3193
117 Ga0068859_100098199 3300005617 Bacteria 2982
118 Ga0068859_100174022 3300005617 Bacteria 2234
119 Ga0068859_100387343 3300005617 Bacteria 1493
120 Ga0068864_100077767 3300005618 Bacteria 2902
121 Ga0068864_100089818 3300005618 Bacteria 2707
122 Ga0068864_100593796 3300005618 Bacteria 1074
123 Ga0068866_10014932 3300005718 Bacteria 3439
124 Ga0068861_100513455 3300005719 Bacteria 1085
125 Ga0068851_10007940 3300005834 Bacteria 4892
126 Ga0068851_10096475 3300005834 Bacteria 1563
127 Ga0068851_10177022 3300005834 Bacteria 1180
128 Ga0068870_10086390 3300005840 Bacteria 1745
129 Ga0068863_102335030 3300005841 Unclassified 545
130 Ga0068858_100017103 3300005842 Bacteria 6807
131 Ga0068862_100061574 3300005844 Bacteria 3226
132 Ga0068862_100539086 3300005844 Unclassified 1113
133 Ga0068862_100588665 3300005844 Bacteria 1067
134 Ga0070717_10101183 3300006028 Bacteria 2447
135 Ga0075363_100181821 3300006048 Bacteria 1197
136 Ga0075364_10031743 3300006051 Bacteria 3393
137 Ga0070716_100537504 3300006173 Bacteria 869
138 Ga0070716_100545940 3300006173 Bacteria 863
139 Ga0070712_100152519 3300006175 Bacteria 1776
140 Ga0075362_10151365 3300006177 Bacteria 1113
141 Ga0075366_10019082 3300006195 Bacteria 3962
142 Ga0097621_100064017 3300006237 Bacteria 3023
143 Ga0097621_100092006 3300006237 Bacteria 2539
144 Ga0097621_100568564 3300006237 Bacteria 1033
145 Ga0068871_100007260 3300006358 Bacteria 7904
146 Ga0068871_100036560 3300006358 Bacteria 3911
147 Ga0068871_100309008 3300006358 Bacteria 1389
148 Ga0075428_100489306 3300006844 Bacteria 1316
149 Ga0075433_10179200 3300006852 Bacteria 1885
150 Ga0075433_10238317 3300006852 Bacteria 1615
151 Ga0075434_100530804 3300006871 Bacteria 1197
152 Ga0068865_100064029 3300006881 Unclassified 2586
153 Ga0068865_100371619 3300006881 Bacteria 1164
154 Ga0097620_100085861 3300006931 Bacteria 3193
155 Ga0097620_100098199 3300006931 Bacteria 2982
156 Ga0097620_100174029 3300006931 Bacteria 2234
157 Ga0097620_100387341 3300006931 Bacteria 1493
158 Ga0075435_100330257 3300007076 Bacteria 1306
159 Ga0105240_10221972 3300009093 Unclassified 2201
160 Ga0111539_11152801 3300009094 Bacteria 901
161 Ga0105245_10050399 3300009098 Bacteria 3731
162 Ga0105245_10088006 3300009098 Bacteria 2852
163 Ga0114129_10068815 3300009147 Bacteria 4935
164 Ga0114129_10241518 3300009147 Bacteria 2428
165 Ga0114129_11033844 3300009147 Bacteria 1032
166 Ga0105243_10983365 3300009148 Bacteria 845
167 Ga0105241_10001935 3300009174 Bacteria 15666
168 Ga0105241_10051480 3300009174 Bacteria 3140
169 Ga0105242_10128584 3300009176 Bacteria 2183
170 Ga0105242_10497729 3300009176 Bacteria 1159
171 Ga0105242_11012166 3300009176 Bacteria 839
172 Ga0105248_10017721 3300009177 Bacteria 7855
173 Ga0105248_10108550 3300009177 Bacteria 3129
174 Ga0105248_10110570 3300009177 Bacteria 3098
175 Ga0105248_10112638 3300009177 Unclassified 3068
176 Ga0105237_10161058 3300009545 Bacteria 2242
177 Ga0105238_10038374 3300009551 Bacteria 4865
178 Ga0105238_10119343 3300009551 Unclassified 2617
179 Ga0105249_10188269 3300009553 Bacteria 2013
180 Ga0105249_10190209 3300009553 Bacteria 2003
181 Ga0105249_10724953 3300009553 Bacteria 1055
182 Ga0105239_10044655 3300010375 Unclassified 4857
183 Ga0105239_11521073 3300010375 Bacteria 773
184 Ga0105246_10144781 3300011119 Bacteria 1792
185 Ga0157373_10051545 3300013100 Unclassified 2931
186 Ga0157373_10068433 3300013100 Bacteria 2509
187 Ga0157370_10127853 3300013104 Unclassified 2371
188 Ga0157369_10389712 3300013105 Bacteria 1446
189 Ga0157369_10668208 3300013105 Bacteria 1071
190 Ga0157369_11008749 3300013105 Bacteria 852
191 Ga0157374_10022334 3300013296 Bacteria 5643
192 Ga0157374_10032866 3300013296 Unclassified 4728
193 Ga0157378_10114311 3300013297 Bacteria 2479
194 Ga0163162_10158948 3300013306 Bacteria 2381
195 Ga0157372_10028065 3300013307 Bacteria 6139
196 Ga0157372_10034306 3300013307 Bacteria 5578
197 Ga0157372_10043096 3300013307 Bacteria 4995
198 Ga0157372_11086212 3300013307 Bacteria 926
199 Ga0157375_10273514 3300013308 Bacteria 1851
200 Ga0163163_10052004 3300014325 Bacteria 4040
201 Ga0157380_10141257 3300014326 Bacteria 2069
202 Ga0157380_10641276 3300014326 Bacteria 1058
203 Ga0157379_10080822 3300014968 Bacteria 2912
204 Ga0157379_10084245 3300014968 Bacteria 2849
205 Ga0157376_10060851 3300014969 Bacteria 3173
206 Ga0157376_10172820 3300014969 Bacteria 1969
207 Ga0157376_10195599 3300014969 Bacteria 1857
208 Ga0163161_10204645 3300017792 Bacteria 1522
209 Ga0206356_11822962 3300020070 Bacteria 699
210 Ga0207673_1052437 3300025290 Bacteria 578
211 Ga0207697_10005428 3300025315 Bacteria 5927
212 Ga0207697_10012082 3300025315 Bacteria 3634
213 Ga0207656_10036649 3300025321 Bacteria 2059
214 Ga0207656_10196401 3300025321 Bacteria 973
215 Ga0207682_10023834 3300025893 Bacteria 2421
216 Ga0207692_10399868 3300025898 Bacteria 856
217 Ga0207642_10012261 3300025899 Bacteria 3090
218 Ga0207699_10053322 3300025906 Bacteria 2397
219 Ga0207645_10174468 3300025907 Bacteria 1409
220 Ga0207643_10134559 3300025908 Bacteria 1473
221 Ga0207705_10115619 3300025909 Bacteria 1985
222 Ga0207684_10126212 3300025910 Bacteria 2196
223 Ga0207684_10152895 3300025910 Bacteria 1986
224 Ga0207654_10048047 3300025911 Unclassified 2441
225 Ga0207707_10015415 3300025912 Bacteria 6657
226 Ga0207707_10020498 3300025912 Bacteria 5773
227 Ga0207707_10117224 3300025912 Bacteria 2328
228 Ga0207695_10090670 3300025913 Unclassified 3072
229 Ga0207671_10272810 3300025914 Bacteria 1333
230 Ga0207693_11151424 3300025915 Bacteria 587
231 Ga0207663_10145443 3300025916 Bacteria 1657
232 Ga0207660_10010847 3300025917 Bacteria 5923
233 Ga0207660_10962529 3300025917 Bacteria 696
234 Ga0207662_10117776 3300025918 Bacteria 1662
235 Ga0207662_10217266 3300025918 Bacteria 1243
236 Ga0207657_10017222 3300025919 Bacteria 6940
237 Ga0207657_10018006 3300025919 Bacteria 6759
238 Ga0207657_10485086 3300025919 Bacteria 969
239 Ga0207649_10050579 3300025920 Unclassified 2571
240 Ga0207649_10059803 3300025920 Bacteria 2392
241 Ga0207649_10067749 3300025920 Unclassified 2267
242 Ga0207652_10015193 3300025921 Bacteria 6247
243 Ga0207652_10037363 3300025921 Bacteria 4110
244 Ga0207652_10200535 3300025921 Bacteria 1796
245 Ga0207646_10461499 3300025922 Bacteria 1146
246 Ga0207681_10277059 3300025923 Bacteria 1319
247 Ga0207694_10025625 3300025924 Unclassified 4483
248 Ga0207650_10006234 3300025925 Bacteria 8127
249 Ga0207659_10001810 3300025926 Bacteria 12648
250 Ga0207687_10090244 3300025927 Bacteria 2233
251 Ga0207687_10595099 3300025927 Bacteria 932
252 Ga0207700_10000099 3300025928 Bacteria 53179
253 Ga0207664_10187113 3300025929 Bacteria 1781
254 Ga0207664_10521336 3300025929 Bacteria 1065
255 Ga0207644_10056055 3300025931 Bacteria 2843
256 Ga0207644_10157974 3300025931 Bacteria 1760
257 Ga0207644_10249964 3300025931 Bacteria 1414
258 Ga0207644_10802378 3300025931 Bacteria 787
259 Ga0207706_10105594 3300025933 Bacteria 2478
260 Ga0207706_10753676 3300025933 Bacteria 829
261 Ga0207670_10048873 3300025936 Bacteria 2826
262 Ga0207670_10069237 3300025936 Bacteria 2433
263 Ga0207670_10139496 3300025936 Bacteria 1786
264 Ga0207670_10158117 3300025936 Bacteria 1689
265 Ga0207670_10242136 3300025936 Bacteria 1390
266 Ga0207669_10194055 3300025937 Bacteria 1467
267 Ga0207669_10330199 3300025937 Bacteria 1170
268 Ga0207704_10759350 3300025938 Bacteria 807
269 Ga0207711_10026799 3300025941 Bacteria 4837
270 Ga0207711_10071627 3300025941 Bacteria 3008
271 Ga0207711_10246711 3300025941 Bacteria 1638
272 Ga0207689_10109828 3300025942 Bacteria 2266
273 Ga0207689_10141633 3300025942 Bacteria 1981
274 Ga0207689_10553633 3300025942 Bacteria 966
275 Ga0207661_10128865 3300025944 Unclassified 2164
276 Ga0207661_10208927 3300025944 Unclassified 1719
277 Ga0207679_10065941 3300025945 Bacteria 2711
278 Ga0207679_10090184 3300025945 Bacteria 2369
279 Ga0207667_10003067 3300025949 Bacteria 20706
280 Ga0207667_10614570 3300025949 Bacteria 1095
281 Ga0207651_10065188 3300025960 Bacteria 2553
282 Ga0207668_10089487 3300025972 Bacteria 2257
283 Ga0207668_10165499 3300025972 Bacteria 1728
284 Ga0207640_10059499 3300025981 Unclassified 2521
285 Ga0207640_10132129 3300025981 Bacteria 1806
286 Ga0207658_10037517 3300025986 Bacteria 3483
287 Ga0207658_10063261 3300025986 Bacteria 2772
288 Ga0207677_10243235 3300026023 Bacteria 1457
289 Ga0207677_10722685 3300026023 Unclassified 885
290 Ga0207703_10031035 3300026035 Bacteria 4225
291 Ga0207703_10042938 3300026035 Bacteria 3627
292 Ga0207703_10190146 3300026035 Bacteria 1818
293 Ga0207703_10250867 3300026035 Bacteria 1595
294 Ga0207639_10395059 3300026041 Bacteria 1245
295 Ga0207639_10626106 3300026041 Unclassified 994
296 Ga0207678_10020876 3300026067 Bacteria 5740
297 Ga0207678_10112186 3300026067 Bacteria 2326
298 Ga0207708_10019179 3300026075 Bacteria 5151
299 Ga0207708_11019136 3300026075 Bacteria 720
300 Ga0207702_10012373 3300026078 Bacteria 7105
301 Ga0207641_10728574 3300026088 Bacteria 978
302 Ga0207648_10185486 3300026089 Bacteria 1842
303 Ga0207676_10021830 3300026095 Unclassified 4702
304 Ga0207674_10023636 3300026116 Bacteria 6580
305 Ga0207674_10298412 3300026116 Bacteria 1560
306 Ga0207674_10710876 3300026116 Bacteria 970
307 Ga0207675_100132832 3300026118 Bacteria 2360
308 Ga0207675_100586366 3300026118 Bacteria 1117
309 Ga0207698_10032471 3300026142 Bacteria 3782
310 Ga0207698_10062064 3300026142 Bacteria 2916
311 Ga0207428_10087026 3300027907 Bacteria 2431
312 Ga0268264_10308793 3300028381 Bacteria 1491
313 Ga0268264_10494881 3300028381 Bacteria 1191
314 Ga0307408_100087310 3300031548 Bacteria 2346
315 Ga0307408_100229757 3300031548 Bacteria 1519
316 Ga0316575_10148832 3300031665 Unclassified 965
317 Ga0307405_10257353 3300031731 Bacteria 1302
318 Ga0307407_10451857 3300031903 Bacteria 933
319 Ga0307412_10300574 3300031911 Bacteria 1268
320 Ga0307409_100274323 3300031995 Bacteria 1555
321 Ga0307415_100204202 3300032126 Bacteria 1571
322 Ga0373926_0192428 3300035083 Bacteria 784
323 Ga0373939_0201276 3300035114 Bacteria 753
324 Ga0373954_0092588 3300035118 Bacteria 1453
325 Ga0373957_0029310 3300035120 Bacteria 2010
326 Ga0373946_0089137 3300035171 Unclassified 1364
327 Ga0373955_0017820 3300035172 Bacteria 3520
328 Ga0373955_0055591 3300035172 Bacteria 2168
329 Ga0373935_0196674 3300035692 Bacteria 1391
330 Ga0373947_0245939 3300035725 Bacteria 1181
331 Ga0373937_0093739 3300036401 Bacteria 2784
332 Ga0373937_0199251 3300036401 Bacteria 1882
333 Ga0395905_0196157 3300037471 Unclassified 1893
334 Ga0242420_048627 3300038996 Bacteria 825
335 Ga0436361_0734848 3300039447 Unclassified 1221
336 Ga0451853_0180633 3300041512 Bacteria 1270
337 Ga0451853_0779226 3300041512 Bacteria 1487
338 Ga0439441_036222 3300042001 Bacteria 975
339 Ga0451577_0189494 3300042876 Bacteria 1855
340 Ga0451577_1038611 3300042876 Bacteria 735
341 Ga0453683_1064225 3300044673 Bacteria 538
342 Ga0451576_0043365 3300045051 Bacteria 4747
343 Ga0451576_0337062 3300045051 Bacteria 1579
344 Ga0495592_0037010 3300046454 Bacteria 3674
345 Ga0495651_0082948 3300046462 Bacteria 2418
346 Ga0495664_0147593 3300046477 Bacteria 1426
347 Ga0495585_0143316 3300046492 Unclassified 1250
348 Ga0495608_0014788 3300046511 Bacteria 5414
349 Ga0495618_0492307 3300046514 Bacteria 740
350 Ga0495652_0096802 3300046529 Bacteria 2402
351 Ga0495586_0336233 3300046535 Bacteria 867
352 Ga0495587_0040752 3300046536 Bacteria 2773
353 Ga0495598_0213422 3300046537 Bacteria 702
354 Ga0495645_0001557 3300046543 Bacteria 15525
355 Ga0495645_0017006 3300046543 Bacteria 5206
356 Ga0495667_0117461 3300046559 Bacteria 1718
357 Ga0495625_0456925 3300046660 Bacteria 788
358 Ga0495635_0089015 3300046663 Bacteria 2112
359 Ga0495657_0078763 3300046675 Bacteria 2135
360 Ga0495599_0025439 3300046678 Bacteria 3705
361 Ga0495599_0474306 3300046678 Bacteria 739
362 Ga0495680_0045329 3300047322 Bacteria 3472
363 Ga0496101_0022194 3300048904 Bacteria 4368
364 Ga0496102_0806498 3300048905 Bacteria 861
365 Ga0496104_0045512 3300048907 Unclassified 4128
366 Ga0496108_0046911 3300048911 Bacteria 3611
367 Ga0496108_0955377 3300048911 Bacteria 734
368 Ga0496109_0031590 3300048912 Unclassified 4754
369 Ga0496109_0573231 3300048912 Bacteria 1064
370 Ga0496110_0039333 3300048913 Bacteria 4118
371 Ga0496110_0296430 3300048913 Bacteria 1473
372 Ga0496111_0211156 3300048914 Unclassified 1442
373 Ga0496111_0239617 3300048914 Bacteria 1347
374 Ga0496112_0010361 3300048915 Bacteria 8453
375 Ga0496113_0730183 3300048916 Bacteria 789
376 nmdc:mga03683_133129_c1 3300050489 Bacteria 1113
377 nmdc:mga0k408_100866_c1 3300050493 Bacteria 1702
378 nmdc:mga0k408_163366_c1 3300050493 Bacteria 1327
379 nmdc:mga05p37_187510_c1 3300050507 Bacteria 2514
380 nmdc:mga0rr50_354946_c1 3300050513 Bacteria 1233
381 nmdc:mga08x19_932297_c1 3300050514 Unclassified 617
382 nmdc:mga0a205_239065_c1 3300050515 Bacteria 1697
383 nmdc:mga0a205_256798_c1 3300050515 Bacteria 1626
384 nmdc:mga0a205_866226_c1 3300050515 Bacteria 750
385 Ga0495601_0007447 3300053077 Bacteria 6420
386 Ga0495601_0551676 3300053077 Bacteria 741
387 Ga0495612_0073781 3300053078 Bacteria 1426
388 Ga0495595_0040316 3300053084 Bacteria 2134
389 Ga0495619_0036356 3300053085 Bacteria 3207

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038996 Ga0242420_048627 Ga0242420_048627_356_808 150
2 3300035083 Ga0373926_0192428 Ga0373926_0192428_312_767 151
3 3300005327 Ga0070658_10025699 Ga0070658_100256993 156
4 3300005329 Ga0070683_100006579 Ga0070683_1000065791 156
5 3300005337 Ga0070682_100062303 Ga0070682_1000623032 156
6 3300005339 Ga0070660_100170168 Ga0070660_1001701681 156
7 3300005344 Ga0070661_100059811 Ga0070661_1000598112 156
8 3300005435 Ga0070714_100009300 Ga0070714_1000093005 156
9 3300005455 Ga0070663_100009653 Ga0070663_1000096537 156
10 3300005535 Ga0070684_100084765 Ga0070684_1000847653 156
11 3300005539 Ga0068853_100018586 Ga0068853_1000185862 156
12 3300005564 Ga0070664_100784240 Ga0070664_1007842401 156
13 3300005577 Ga0068857_100038342 Ga0068857_1000383421 156
14 3300005578 Ga0068854_100011025 Ga0068854_1000110254 156
15 3300005834 Ga0068851_10096475 Ga0068851_100964752 156
16 3300025321 Ga0207656_10196401 Ga0207656_101964011 156
17 3300025909 Ga0207705_10115619 Ga0207705_101156191 156
18 3300025911 Ga0207654_10048047 Ga0207654_100480472 156
19 3300025912 Ga0207707_10015415 Ga0207707_100154153 156
20 3300025913 Ga0207695_10090670 Ga0207695_100906702 156
21 3300025914 Ga0207671_10272810 Ga0207671_102728101 156
22 3300025917 Ga0207660_10010847 Ga0207660_100108471 156
23 3300025919 Ga0207657_10018006 Ga0207657_100180063 156
24 3300025920 Ga0207649_10067749 Ga0207649_100677492 156
25 3300025921 Ga0207652_10015193 Ga0207652_100151932 156
26 3300025924 Ga0207694_10025625 Ga0207694_100256255 156
27 3300025938 Ga0207704_10759350 Ga0207704_107593502 156
28 3300025944 Ga0207661_10208927 Ga0207661_102089272 156
29 3300025949 Ga0207667_10003067 Ga0207667_100030673 156
30 3300025981 Ga0207640_10059499 Ga0207640_100594992 156
31 3300026067 Ga0207678_10020876 Ga0207678_100208766 156
32 3300026116 Ga0207674_10023636 Ga0207674_100236362 156
33 3300005578 Ga0068854_100440708 Ga0068854_1004407082 157
34 3300006177 Ga0075362_10151365 Ga0075362_101513652 157
35 3300006195 Ga0075366_10019082 Ga0075366_100190824 157
36 3300009553 Ga0105249_10724953 Ga0105249_107249532 157
37 3300031548 Ga0307408_100229757 Ga0307408_1002297573 157
38 3300045051 Ga0451576_0337062 Ga0451576_0337062_158_643 157
39 3300050489 nmdc:mga03683_133129_c1 nmdc:mga03683_133129_c1_268_753 157
40 3300050493 nmdc:mga0k408_100866_c1 nmdc:mga0k408_100866_c1_801_1286 157
41 3300050493 nmdc:mga0k408_163366_c1 nmdc:mga0k408_163366_c1_832_1317 157
42 3300001976 JGI24752J21851_1032720 JGI24752J21851_10327201 158
43 3300001978 JGI24747J21853_1026906 JGI24747J21853_10269061 158
44 3300005290 Ga0065712_10647607 Ga0065712_106476071 158
45 3300005293 Ga0065715_10351863 Ga0065715_103518632 158
46 3300005328 Ga0070676_10028488 Ga0070676_100284884 158
47 3300005329 Ga0070683_100083903 Ga0070683_1000839036 158
48 3300005331 Ga0070670_100004813 Ga0070670_10000481318 158
49 3300005331 Ga0070670_100173938 Ga0070670_1001739381 158
50 3300005331 Ga0070670_100998774 Ga0070670_1009987742 158
51 3300005333 Ga0070677_10018389 Ga0070677_100183891 158
52 3300005334 Ga0068869_100343213 Ga0068869_1003432132 158
53 3300005335 Ga0070666_10045708 Ga0070666_100457083 158
54 3300005336 Ga0070680_100085566 Ga0070680_1000855663 158
55 3300005336 Ga0070680_100326695 Ga0070680_1003266952 158
56 3300005336 Ga0070680_100926477 Ga0070680_1009264771 158
57 3300005336 Ga0070680_100980819 Ga0070680_1009808191 158
58 3300005338 Ga0068868_100093963 Ga0068868_1000939632 158
59 3300005338 Ga0068868_100175369 Ga0068868_1001753694 158
60 3300005339 Ga0070660_100156841 Ga0070660_1001568411 158
61 3300005339 Ga0070660_100433105 Ga0070660_1004331052 158
62 3300005339 Ga0070660_101184080 Ga0070660_1011840801 158
63 3300005340 Ga0070689_100152215 Ga0070689_1001522153 158
64 3300005340 Ga0070689_100300680 Ga0070689_1003006803 158
65 3300005340 Ga0070689_100429284 Ga0070689_1004292841 158
66 3300005343 Ga0070687_100144547 Ga0070687_1001445472 158
67 3300005344 Ga0070661_100016160 Ga0070661_1000161602 158
68 3300005344 Ga0070661_100019456 Ga0070661_1000194567 158
69 3300005344 Ga0070661_100164045 Ga0070661_1001640452 158
70 3300005347 Ga0070668_100007069 Ga0070668_1000070695 158
71 3300005347 Ga0070668_100163649 Ga0070668_1001636491 158
72 3300005353 Ga0070669_100064240 Ga0070669_1000642402 158
73 3300005355 Ga0070671_100020736 Ga0070671_1000207363 158
74 3300005355 Ga0070671_100044056 Ga0070671_1000440562 158
75 3300005355 Ga0070671_100098979 Ga0070671_1000989791 158
76 3300005355 Ga0070671_100631371 Ga0070671_1006313712 158
77 3300005355 Ga0070671_100889475 Ga0070671_1008894751 158
78 3300005356 Ga0070674_100009639 Ga0070674_1000096398 158
79 3300005356 Ga0070674_100451135 Ga0070674_1004511352 158
80 3300005364 Ga0070673_100062399 Ga0070673_1000623992 158
81 3300005365 Ga0070688_100029232 Ga0070688_1000292323 158
82 3300005365 Ga0070688_100708875 Ga0070688_1007088752 158
83 3300005366 Ga0070659_100068610 Ga0070659_1000686103 158
84 3300005367 Ga0070667_100154551 Ga0070667_1001545512 158
85 3300005434 Ga0070709_10009145 Ga0070709_100091458 158
86 3300005435 Ga0070714_100271491 Ga0070714_1002714912 158
87 3300005436 Ga0070713_100000033 Ga0070713_10000003342 158
88 3300005436 Ga0070713_100349978 Ga0070713_1003499782 158
89 3300005437 Ga0070710_10004660 Ga0070710_100046604 158
90 3300005438 Ga0070701_10230514 Ga0070701_102305142 158
91 3300005439 Ga0070711_100929221 Ga0070711_1009292212 158
92 3300005440 Ga0070705_100161359 Ga0070705_1001613593 158
93 3300005440 Ga0070705_100820064 Ga0070705_1008200641 158
94 3300005441 Ga0070700_100283621 Ga0070700_1002836212 158
95 3300005441 Ga0070700_100294637 Ga0070700_1002946372 158
96 3300005444 Ga0070694_100240413 Ga0070694_1002404132 158
97 3300005445 Ga0070708_100448534 Ga0070708_1004485342 158
98 3300005445 Ga0070708_100496836 Ga0070708_1004968362 158
99 3300005445 Ga0070708_100713762 Ga0070708_1007137622 158
100 3300005455 Ga0070663_100637809 Ga0070663_1006378091 158
101 3300005456 Ga0070678_100763390 Ga0070678_1007633901 158
102 3300005456 Ga0070678_101308001 Ga0070678_1013080011 158
103 3300005457 Ga0070662_100955794 Ga0070662_1009557941 158
104 3300005458 Ga0070681_10016744 Ga0070681_100167443 158
105 3300005458 Ga0070681_10159376 Ga0070681_101593762 158
106 3300005458 Ga0070681_10523626 Ga0070681_105236262 158
107 3300005458 Ga0070681_11064040 Ga0070681_110640401 158
108 3300005459 Ga0068867_100037181 Ga0068867_1000371818 158
109 3300005467 Ga0070706_100042191 Ga0070706_1000421913 158
110 3300005467 Ga0070706_100179241 Ga0070706_1001792412 158
111 3300005467 Ga0070706_100229256 Ga0070706_1002292563 158
112 3300005468 Ga0070707_100031454 Ga0070707_1000314547 158
113 3300005468 Ga0070707_100574996 Ga0070707_1005749962 158
114 3300005518 Ga0070699_100057762 Ga0070699_1000577621 158
115 3300005518 Ga0070699_100191200 Ga0070699_1001912003 158
116 3300005530 Ga0070679_100029525 Ga0070679_1000295258 158
117 3300005530 Ga0070679_100152705 Ga0070679_1001527052 158
118 3300005530 Ga0070679_100247646 Ga0070679_1002476462 158
119 3300005535 Ga0070684_100725703 Ga0070684_1007257032 158
120 3300005539 Ga0068853_100221028 Ga0068853_1002210281 158
121 3300005539 Ga0068853_100500452 Ga0068853_1005004522 158
122 3300005539 Ga0068853_100502544 Ga0068853_1005025442 158
123 3300005543 Ga0070672_100615107 Ga0070672_1006151071 158
124 3300005543 Ga0070672_100675259 Ga0070672_1006752592 158
125 3300005543 Ga0070672_101335157 Ga0070672_1013351571 158
126 3300005544 Ga0070686_100974876 Ga0070686_1009748761 158
127 3300005545 Ga0070695_100121128 Ga0070695_1001211283 158
128 3300005545 Ga0070695_100251769 Ga0070695_1002517692 158
129 3300005546 Ga0070696_100266096 Ga0070696_1002660962 158
130 3300005546 Ga0070696_100920789 Ga0070696_1009207891 158
131 3300005547 Ga0070693_100000927 Ga0070693_10000092712 158
132 3300005548 Ga0070665_100035323 Ga0070665_1000353237 158
133 3300005549 Ga0070704_100111525 Ga0070704_1001115252 158
134 3300005549 Ga0070704_100413100 Ga0070704_1004131002 158
135 3300005549 Ga0070704_100464072 Ga0070704_1004640722 158
136 3300005563 Ga0068855_100054211 Ga0068855_1000542118 158
137 3300005564 Ga0070664_100016958 Ga0070664_1000169583 158
138 3300005564 Ga0070664_100025537 Ga0070664_1000255373 158
139 3300005577 Ga0068857_100164193 Ga0068857_1001641933 158
140 3300005578 Ga0068854_100995767 Ga0068854_1009957672 158
141 3300005614 Ga0068856_100003867 Ga0068856_1000038675 158
142 3300005614 Ga0068856_100642954 Ga0068856_1006429542 158
143 3300005616 Ga0068852_100089747 Ga0068852_1000897471 158
144 3300005617 Ga0068859_100085863 Ga0068859_1000858634 158
145 3300005617 Ga0068859_100098199 Ga0068859_1000981992 158
146 3300005617 Ga0068859_100174022 Ga0068859_1001740224 158
147 3300005617 Ga0068859_100387343 Ga0068859_1003873431 158
148 3300005618 Ga0068864_100077767 Ga0068864_1000777672 158
149 3300005618 Ga0068864_100089818 Ga0068864_1000898182 158
150 3300005618 Ga0068864_100593796 Ga0068864_1005937962 158
151 3300005718 Ga0068866_10014932 Ga0068866_100149324 158
152 3300005719 Ga0068861_100513455 Ga0068861_1005134551 158
153 3300005834 Ga0068851_10007940 Ga0068851_100079406 158
154 3300005834 Ga0068851_10177022 Ga0068851_101770222 158
155 3300005840 Ga0068870_10086390 Ga0068870_100863903 158
156 3300005841 Ga0068863_102335030 Ga0068863_1023350301 158
157 3300005842 Ga0068858_100017103 Ga0068858_1000171034 158
158 3300005844 Ga0068862_100061574 Ga0068862_1000615743 158
159 3300005844 Ga0068862_100539086 Ga0068862_1005390861 158
160 3300005844 Ga0068862_100588665 Ga0068862_1005886652 158
161 3300006028 Ga0070717_10101183 Ga0070717_101011833 158
162 3300006048 Ga0075363_100181821 Ga0075363_1001818213 158
163 3300006051 Ga0075364_10031743 Ga0075364_100317432 158
164 3300006173 Ga0070716_100537504 Ga0070716_1005375042 158
165 3300006173 Ga0070716_100545940 Ga0070716_1005459402 158
166 3300006175 Ga0070712_100152519 Ga0070712_1001525193 158
167 3300006237 Ga0097621_100064017 Ga0097621_1000640173 158
168 3300006237 Ga0097621_100092006 Ga0097621_1000920063 158
169 3300006237 Ga0097621_100568564 Ga0097621_1005685641 158
170 3300006358 Ga0068871_100007260 Ga0068871_1000072602 158
171 3300006358 Ga0068871_100036560 Ga0068871_1000365603 158
172 3300006358 Ga0068871_100309008 Ga0068871_1003090083 158
173 3300006844 Ga0075428_100489306 Ga0075428_1004893062 158
174 3300006852 Ga0075433_10179200 Ga0075433_101792003 158
175 3300006852 Ga0075433_10238317 Ga0075433_102383172 158
176 3300006871 Ga0075434_100530804 Ga0075434_1005308043 158
177 3300006881 Ga0068865_100064029 Ga0068865_1000640293 158
178 3300006881 Ga0068865_100371619 Ga0068865_1003716192 158
179 3300006931 Ga0097620_100085861 Ga0097620_1000858614 158
180 3300006931 Ga0097620_100098199 Ga0097620_1000981993 158
181 3300006931 Ga0097620_100174029 Ga0097620_1001740292 158
182 3300006931 Ga0097620_100387341 Ga0097620_1003873411 158
183 3300007076 Ga0075435_100330257 Ga0075435_1003302572 158
184 3300009093 Ga0105240_10221972 Ga0105240_102219722 158
185 3300009094 Ga0111539_11152801 Ga0111539_111528011 158
186 3300009098 Ga0105245_10050399 Ga0105245_100503994 158
187 3300009098 Ga0105245_10088006 Ga0105245_100880063 158
188 3300009147 Ga0114129_10068815 Ga0114129_100688154 158
189 3300009147 Ga0114129_10241518 Ga0114129_102415182 158
190 3300009147 Ga0114129_11033844 Ga0114129_110338443 158
191 3300009148 Ga0105243_10983365 Ga0105243_109833651 158
192 3300009174 Ga0105241_10001935 Ga0105241_1000193510 158
193 3300009174 Ga0105241_10051480 Ga0105241_100514803 158
194 3300009176 Ga0105242_10128584 Ga0105242_101285843 158
195 3300009176 Ga0105242_10497729 Ga0105242_104977291 158
196 3300009176 Ga0105242_11012166 Ga0105242_110121661 158
197 3300009177 Ga0105248_10017721 Ga0105248_1001772110 158
198 3300009177 Ga0105248_10108550 Ga0105248_101085503 158
199 3300009177 Ga0105248_10110570 Ga0105248_101105702 158
200 3300009177 Ga0105248_10112638 Ga0105248_101126381 158
201 3300009545 Ga0105237_10161058 Ga0105237_101610584 158
202 3300009551 Ga0105238_10038374 Ga0105238_100383745 158
203 3300009551 Ga0105238_10119343 Ga0105238_101193432 158
204 3300009553 Ga0105249_10188269 Ga0105249_101882692 158
205 3300009553 Ga0105249_10190209 Ga0105249_101902094 158
206 3300010375 Ga0105239_10044655 Ga0105239_100446552 158
207 3300010375 Ga0105239_11521073 Ga0105239_115210732 158
208 3300011119 Ga0105246_10144781 Ga0105246_101447812 158
209 3300013100 Ga0157373_10051545 Ga0157373_100515452 158
210 3300013100 Ga0157373_10068433 Ga0157373_100684334 158
211 3300013104 Ga0157370_10127853 Ga0157370_101278532 158
212 3300013105 Ga0157369_10389712 Ga0157369_103897122 158
213 3300013105 Ga0157369_10668208 Ga0157369_106682081 158
214 3300013105 Ga0157369_11008749 Ga0157369_110087492 158
215 3300013296 Ga0157374_10022334 Ga0157374_100223344 158
216 3300013296 Ga0157374_10032866 Ga0157374_100328666 158
217 3300013297 Ga0157378_10114311 Ga0157378_101143113 158
218 3300013306 Ga0163162_10158948 Ga0163162_101589482 158
219 3300013307 Ga0157372_10028065 Ga0157372_100280652 158
220 3300013307 Ga0157372_10034306 Ga0157372_100343063 158
221 3300013307 Ga0157372_10043096 Ga0157372_100430965 158
222 3300013307 Ga0157372_11086212 Ga0157372_110862121 158
223 3300013308 Ga0157375_10273514 Ga0157375_102735144 158
224 3300014325 Ga0163163_10052004 Ga0163163_100520044 158
225 3300014326 Ga0157380_10141257 Ga0157380_101412572 158
226 3300014326 Ga0157380_10641276 Ga0157380_106412762 158
227 3300014968 Ga0157379_10080822 Ga0157379_100808221 158
228 3300014968 Ga0157379_10084245 Ga0157379_100842453 158
229 3300014969 Ga0157376_10060851 Ga0157376_100608514 158
230 3300014969 Ga0157376_10172820 Ga0157376_101728202 158
231 3300014969 Ga0157376_10195599 Ga0157376_101955993 158
232 3300017792 Ga0163161_10204645 Ga0163161_102046452 158
233 3300020070 Ga0206356_11822962 Ga0206356_118229621 158
234 3300025290 Ga0207673_1052437 Ga0207673_10524371 158
235 3300025315 Ga0207697_10005428 Ga0207697_100054283 158
236 3300025315 Ga0207697_10012082 Ga0207697_100120824 158
237 3300025321 Ga0207656_10036649 Ga0207656_100366492 158
238 3300025893 Ga0207682_10023834 Ga0207682_100238344 158
239 3300025898 Ga0207692_10399868 Ga0207692_103998681 158
240 3300025899 Ga0207642_10012261 Ga0207642_100122615 158
241 3300025906 Ga0207699_10053322 Ga0207699_100533225 158
242 3300025907 Ga0207645_10174468 Ga0207645_101744682 158
243 3300025908 Ga0207643_10134559 Ga0207643_101345591 158
244 3300025910 Ga0207684_10126212 Ga0207684_101262123 158
245 3300025910 Ga0207684_10152895 Ga0207684_101528951 158
246 3300025912 Ga0207707_10020498 Ga0207707_100204988 158
247 3300025912 Ga0207707_10117224 Ga0207707_101172242 158
248 3300025915 Ga0207693_11151424 Ga0207693_111514241 158
249 3300025916 Ga0207663_10145443 Ga0207663_101454432 158
250 3300025917 Ga0207660_10962529 Ga0207660_109625291 158
251 3300025918 Ga0207662_10117776 Ga0207662_101177762 158
252 3300025918 Ga0207662_10217266 Ga0207662_102172662 158
253 3300025919 Ga0207657_10017222 Ga0207657_100172225 158
254 3300025919 Ga0207657_10485086 Ga0207657_104850861 158
255 3300025920 Ga0207649_10050579 Ga0207649_100505793 158
256 3300025920 Ga0207649_10059803 Ga0207649_100598033 158
257 3300025921 Ga0207652_10037363 Ga0207652_100373631 158
258 3300025921 Ga0207652_10200535 Ga0207652_102005352 158
259 3300025922 Ga0207646_10461499 Ga0207646_104614992 158
260 3300025923 Ga0207681_10277059 Ga0207681_102770593 158
261 3300025925 Ga0207650_10006234 Ga0207650_1000623410 158
262 3300025926 Ga0207659_10001810 Ga0207659_100018102 158
263 3300025927 Ga0207687_10090244 Ga0207687_100902443 158
264 3300025927 Ga0207687_10595099 Ga0207687_105950992 158
265 3300025928 Ga0207700_10000099 Ga0207700_1000009941 158
266 3300025929 Ga0207664_10187113 Ga0207664_101871132 158
267 3300025929 Ga0207664_10521336 Ga0207664_105213362 158
268 3300025931 Ga0207644_10056055 Ga0207644_100560552 158
269 3300025931 Ga0207644_10157974 Ga0207644_101579741 158
270 3300025931 Ga0207644_10249964 Ga0207644_102499643 158
271 3300025931 Ga0207644_10802378 Ga0207644_108023781 158
272 3300025933 Ga0207706_10105594 Ga0207706_101055942 158
273 3300025933 Ga0207706_10753676 Ga0207706_107536762 158
274 3300025936 Ga0207670_10048873 Ga0207670_100488733 158
275 3300025936 Ga0207670_10069237 Ga0207670_100692372 158
276 3300025936 Ga0207670_10139496 Ga0207670_101394962 158
277 3300025936 Ga0207670_10158117 Ga0207670_101581173 158
278 3300025936 Ga0207670_10242136 Ga0207670_102421361 158
279 3300025937 Ga0207669_10194055 Ga0207669_101940554 158
280 3300025937 Ga0207669_10330199 Ga0207669_103301992 158
281 3300025941 Ga0207711_10026799 Ga0207711_100267994 158
282 3300025941 Ga0207711_10071627 Ga0207711_100716274 158
283 3300025941 Ga0207711_10246711 Ga0207711_102467111 158
284 3300025942 Ga0207689_10109828 Ga0207689_101098283 158
285 3300025942 Ga0207689_10141633 Ga0207689_101416332 158
286 3300025942 Ga0207689_10553633 Ga0207689_105536332 158
287 3300025944 Ga0207661_10128865 Ga0207661_101288652 158
288 3300025945 Ga0207679_10065941 Ga0207679_100659413 158
289 3300025945 Ga0207679_10090184 Ga0207679_100901842 158
290 3300025949 Ga0207667_10614570 Ga0207667_106145702 158
291 3300025960 Ga0207651_10065188 Ga0207651_100651882 158
292 3300025972 Ga0207668_10089487 Ga0207668_100894873 158
293 3300025972 Ga0207668_10165499 Ga0207668_101654993 158
294 3300025981 Ga0207640_10132129 Ga0207640_101321291 158
295 3300025986 Ga0207658_10037517 Ga0207658_100375176 158
296 3300025986 Ga0207658_10063261 Ga0207658_100632612 158
297 3300026023 Ga0207677_10243235 Ga0207677_102432352 158
298 3300026023 Ga0207677_10722685 Ga0207677_107226851 158
299 3300026035 Ga0207703_10031035 Ga0207703_100310353 158
300 3300026035 Ga0207703_10042938 Ga0207703_100429385 158
301 3300026035 Ga0207703_10190146 Ga0207703_101901463 158
302 3300026035 Ga0207703_10250867 Ga0207703_102508673 158
303 3300026041 Ga0207639_10395059 Ga0207639_103950592 158
304 3300026041 Ga0207639_10626106 Ga0207639_106261061 158
305 3300026067 Ga0207678_10112186 Ga0207678_101121862 158
306 3300026075 Ga0207708_10019179 Ga0207708_100191794 158
307 3300026075 Ga0207708_11019136 Ga0207708_110191361 158
308 3300026078 Ga0207702_10012373 Ga0207702_100123738 158
309 3300026088 Ga0207641_10728574 Ga0207641_107285743 158
310 3300026089 Ga0207648_10185486 Ga0207648_101854863 158
311 3300026095 Ga0207676_10021830 Ga0207676_100218303 158
312 3300026116 Ga0207674_10298412 Ga0207674_102984122 158
313 3300026116 Ga0207674_10710876 Ga0207674_107108761 158
314 3300026118 Ga0207675_100132832 Ga0207675_1001328322 158
315 3300026118 Ga0207675_100586366 Ga0207675_1005863662 158
316 3300026142 Ga0207698_10032471 Ga0207698_100324713 158
317 3300026142 Ga0207698_10062064 Ga0207698_100620645 158
318 3300027907 Ga0207428_10087026 Ga0207428_100870262 158
319 3300028381 Ga0268264_10308793 Ga0268264_103087932 158
320 3300028381 Ga0268264_10494881 Ga0268264_104948812 158
321 3300031548 Ga0307408_100087310 Ga0307408_1000873103 158
322 3300031665 Ga0316575_10148832 Ga0316575_101488321 158
323 3300031731 Ga0307405_10257353 Ga0307405_102573533 158
324 3300031903 Ga0307407_10451857 Ga0307407_104518571 158
325 3300031911 Ga0307412_10300574 Ga0307412_103005742 158
326 3300031995 Ga0307409_100274323 Ga0307409_1002743233 158
327 3300032126 Ga0307415_100204202 Ga0307415_1002042023 158
328 3300035114 Ga0373939_0201276 Ga0373939_0201276_87_578 158
329 3300035118 Ga0373954_0092588 Ga0373954_0092588_385_891 158
330 3300035120 Ga0373957_0029310 Ga0373957_0029310_1386_1874 158
331 3300035171 Ga0373946_0089137 Ga0373946_0089137_650_1126 158
332 3300035172 Ga0373955_0017820 Ga0373955_0017820_2734_3222 158
333 3300035172 Ga0373955_0055591 Ga0373955_0055591_39_515 158
334 3300035692 Ga0373935_0196674 Ga0373935_0196674_100_579 158
335 3300035725 Ga0373947_0245939 Ga0373947_0245939_199_678 158
336 3300036401 Ga0373937_0093739 Ga0373937_0093739_866_1372 158
337 3300036401 Ga0373937_0199251 Ga0373937_0199251_70_546 158
338 3300037471 Ga0395905_0196157 Ga0395905_0196157_797_1273 158
339 3300039447 Ga0436361_0734848 Ga0436361_0734848_236_715 158
340 3300041512 Ga0451853_0180633 Ga0451853_0180633_267_755 158
341 3300041512 Ga0451853_0779226 Ga0451853_0779226_209_685 158
342 3300042001 Ga0439441_036222 Ga0439441_036222_465_941 158
343 3300042876 Ga0451577_0189494 Ga0451577_0189494_1036_1539 158
344 3300042876 Ga0451577_1038611 Ga0451577_1038611_153_647 158
345 3300044673 Ga0453683_1064225 Ga0453683_1064225_36_512 158
346 3300045051 Ga0451576_0043365 Ga0451576_0043365_3380_3871 158
347 3300046454 Ga0495592_0037010 Ga0495592_0037010_1917_2423 158
348 3300046462 Ga0495651_0082948 Ga0495651_0082948_1060_1548 158
349 3300046477 Ga0495664_0147593 Ga0495664_0147593_731_1207 158
350 3300046492 Ga0495585_0143316 Ga0495585_0143316_115_591 158
351 3300046511 Ga0495608_0014788 Ga0495608_0014788_1093_1599 158
352 3300046514 Ga0495618_0492307 Ga0495618_0492307_204_710 158
353 3300046529 Ga0495652_0096802 Ga0495652_0096802_957_1445 158
354 3300046535 Ga0495586_0336233 Ga0495586_0336233_235_711 158
355 3300046536 Ga0495587_0040752 Ga0495587_0040752_1367_1855 158
356 3300046537 Ga0495598_0213422 Ga0495598_0213422_79_567 158
357 3300046543 Ga0495645_0001557 Ga0495645_0001557_14095_14583 158
358 3300046543 Ga0495645_0017006 Ga0495645_0017006_2711_3187 158
359 3300046559 Ga0495667_0117461 Ga0495667_0117461_704_1192 158
360 3300046660 Ga0495625_0456925 Ga0495625_0456925_145_621 158
361 3300046663 Ga0495635_0089015 Ga0495635_0089015_981_1469 158
362 3300046675 Ga0495657_0078763 Ga0495657_0078763_400_906 158
363 3300046678 Ga0495599_0025439 Ga0495599_0025439_1497_1985 158
364 3300046678 Ga0495599_0474306 Ga0495599_0474306_123_599 158
365 3300047322 Ga0495680_0045329 Ga0495680_0045329_878_1366 158
366 3300048904 Ga0496101_0022194 Ga0496101_0022194_1535_2011 158
367 3300048905 Ga0496102_0806498 Ga0496102_0806498_95_571 158
368 3300048907 Ga0496104_0045512 Ga0496104_0045512_518_994 158
369 3300048911 Ga0496108_0046911 Ga0496108_0046911_1669_2145 158
370 3300048911 Ga0496108_0955377 Ga0496108_0955377_72_548 158
371 3300048912 Ga0496109_0031590 Ga0496109_0031590_89_565 158
372 3300048912 Ga0496109_0573231 Ga0496109_0573231_261_737 158
373 3300048913 Ga0496110_0039333 Ga0496110_0039333_1918_2394 158
374 3300048913 Ga0496110_0296430 Ga0496110_0296430_787_1263 158
375 3300048914 Ga0496111_0211156 Ga0496111_0211156_98_574 158
376 3300048914 Ga0496111_0239617 Ga0496111_0239617_558_1034 158
377 3300048915 Ga0496112_0010361 Ga0496112_0010361_6081_6557 158
378 3300048916 Ga0496113_0730183 Ga0496113_0730183_263_739 158
379 3300050507 nmdc:mga05p37_187510_c1 nmdc:mga05p37_187510_c1_631_1107 158
380 3300050513 nmdc:mga0rr50_354946_c1 nmdc:mga0rr50_354946_c1_354_836 158
381 3300050514 nmdc:mga08x19_932297_c1 nmdc:mga08x19_932297_c1_130_606 158
382 3300050515 nmdc:mga0a205_239065_c1 nmdc:mga0a205_239065_c1_97_591 158
383 3300050515 nmdc:mga0a205_256798_c1 nmdc:mga0a205_256798_c1_130_609 158
384 3300050515 nmdc:mga0a205_866226_c1 nmdc:mga0a205_866226_c1_13_507 158
385 3300053077 Ga0495601_0007447 Ga0495601_0007447_472_978 158
386 3300053077 Ga0495601_0551676 Ga0495601_0551676_76_552 158
387 3300053078 Ga0495612_0073781 Ga0495612_0073781_102_581 158
388 3300053084 Ga0495595_0040316 Ga0495595_0040316_816_1304 158
389 3300053085 Ga0495619_0036356 Ga0495619_0036356_1112_1618 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

47

121

0.96

PF05899

Cupin_3

EutQ-like cupin domain

51

114

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h0v-assembly1.cif.gz_B crystal structure of a putative quercetin 2,3-dioxygenase (yxag, bsu39980) from bacillus subtilis at 2.60 a resolution 0.8901 27 119
3i7d-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution 0.8843 8 148
8hfb-assembly1.cif.gz_B evolved variant of quercetin 2,4-dioxygenase from bacillus subtilis 0.8771 27 119
3l2h-assembly1.cif.gz_D crystal structure of putative sugar phosphate isomerase (afe_0303) from acidithiobacillus ferrooxidans atcc 23270 at 1.85 a resolution 0.8729 4 156
5jsp-assembly1.cif.gz_A new mechanistic insight from substrate and product bound structures of the metal-dependent dimethylsulfoniopropionate lyase dddq 0.8671 38 120
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9245 27 119 2.60.120.10
3l2hD01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8793 4 145 2.60.120.10
2h0vB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8762 27 119 2.60.120.10
3l2hD01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8619 4 145 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8566 29 121 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A536Z1I6-F1-model_v4 Cupin domain-containing protein 0.9879 1 138
AF-A0A536Z1I6-F1-model_v4 Cupin domain-containing protein 0.9808 1 138
AF-A0A7G6SJG3-F1-model_v4 Cupin domain-containing protein 0.9806 8 118
AF-A0A2D0IYP0-F1-model_v4 Cupin 0.9778 55 139
AF-A0A1Z8Z7J5-F1-model_v4 Cupin 0.9767 7 138

Feature Viewer

pLDDT pTM Quality
91.25 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map