F431371

General Info

Members Datasets Scaffolds Average Seq Length
389 244 778 357

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10049547|Ga0081539_100495471
Length 415
Sequence MQPWQHLYDPAGNLWLSSLIALLPIAFFFVALAVLRMKGWLAGTITVAIALGVALLFYRMPLPQALGAAGFGFVYWLHNSTGIGARSTYHLQFDGPVPGLLVGASVLFNGIRVGEVTELKLATDNPRRVNAAIAVAADTPVRPDTKVGLDFQGLTGVPVVALEGGKQVAASGSVPTLIAEPGAGQSMTQAARDALRRVDTILAENSEPLHGMIDNFRTFSDGLARNTGKLDSIVAGLERMTGASTPPPKIVYNLQAAAAPATPGKPLKGQLVIPEPSTVVMLDTQRILFSPANDSAEFANAQWADTIPRLLQARLIQSFENYDIAHAPLRNGDGVEVDYQLLIDIREFQVAAGAQPAANIAFSVRLLKQGKVVAARVFSVSQPVGKVDPASVGAAFDAGFAGVAKELIAWTGQTL

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
77 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
78 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
79 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
80 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
83 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
91 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
92 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
94 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
95 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
98 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
99 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
100 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
118 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
126 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
127 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
139 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
142 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
143 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
175 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
208 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
215 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
216 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
217 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
218 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
219 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
220 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
221 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
222 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
223 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
224 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
225 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
226 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
229 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
232 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
233 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
234 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
235 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
236 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
237 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
241 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
242 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
243 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
244 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 0
Isolates 1.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.48
Nodule 0.77
Rhizoplane 3.86
Rhizosphere 79.95
Stem 0
Stem Tuber 0
Unclassified 2.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10049547 3300005985 Bacteria 2382
2 Ga0070658_10044519 3300005327 Bacteria 3587
3 Ga0070680_100013650 3300005336 Bacteria 6333
4 Ga0070680_100208796 3300005336 Bacteria 1647
5 Ga0070660_100001124 3300005339 Bacteria 18036
6 Ga0070691_10040644 3300005341 Bacteria 2198
7 Ga0070675_100341259 3300005354 Bacteria 1327
8 Ga0070709_10000537 3300005434 Bacteria 22204
9 Ga0070709_10008113 3300005434 Bacteria 5763
10 Ga0070709_10064444 3300005434 Bacteria 2344
11 Ga0070709_10139214 3300005434 Bacteria 1665
12 Ga0070714_100020513 3300005435 Bacteria 5398
13 Ga0070714_100032673 3300005435 Bacteria 4345
14 Ga0070714_100128072 3300005435 Bacteria 2266
15 Ga0070713_100006321 3300005436 Bacteria 8206
16 Ga0070713_100109709 3300005436 Bacteria 2404
17 Ga0070710_10003271 3300005437 Bacteria 7681
18 Ga0070710_10185039 3300005437 Bacteria 1307
19 Ga0070711_100008021 3300005439 Bacteria 6446
20 Ga0070711_100010481 3300005439 Bacteria 5738
21 Ga0070711_100027000 3300005439 Bacteria 3766
22 Ga0070708_100202907 3300005445 Bacteria 1857
23 Ga0070708_100366507 3300005445 Bacteria 1358
24 Ga0070663_100047330 3300005455 Bacteria 3047
25 Ga0070678_100246003 3300005456 Bacteria 1497
26 Ga0070681_10040314 3300005458 Bacteria 4679
27 Ga0070681_10122365 3300005458 Bacteria 2535
28 Ga0070706_100161151 3300005467 Bacteria 2095
29 Ga0070698_100117388 3300005471 Bacteria 2623
30 Ga0070679_100036243 3300005530 Bacteria 4895
31 Ga0070684_100331744 3300005535 Bacteria 1398
32 Ga0070697_100074079 3300005536 Bacteria 2797
33 Ga0068853_100108257 3300005539 Bacteria 2465
34 Ga0070704_100160802 3300005549 Bacteria 1776
35 Ga0068855_100051873 3300005563 Bacteria 4831
36 Ga0070702_100082201 3300005615 Bacteria 1932
37 Ga0068864_100322255 3300005618 Bacteria 1452
38 Ga0068863_100113108 3300005841 Bacteria 2585
39 Ga0068858_100108071 3300005842 Bacteria 2597
40 Ga0068858_100174833 3300005842 Bacteria 2026
41 Ga0068858_100203635 3300005842 Bacteria 1872
42 Ga0068860_100000302 3300005843 Bacteria 68581
43 Ga0081455_10007131 3300005937 Bacteria 11831
44 Ga0081455_10113168 3300005937 Bacteria 2153
45 Ga0081540_1000585 3300005983 Bacteria 35126
46 Ga0070717_10062179 3300006028 Bacteria 3096
47 Ga0070717_10091729 3300006028 Bacteria 2565
48 Ga0070717_10110848 3300006028 Bacteria 2341
49 Ga0075365_10015666 3300006038 Bacteria 4592
50 Ga0070715_10024949 3300006163 Bacteria 2363
51 Ga0070716_100004821 3300006173 Bacteria 6483
52 Ga0070716_100108663 3300006173 Bacteria 1714
53 Ga0070712_100024567 3300006175 Bacteria 3995
54 Ga0070712_100026291 3300006175 Bacteria 3876
55 Ga0070712_100088571 3300006175 Bacteria 2262
56 Ga0075434_100295849 3300006871 Bacteria 1639
57 Ga0075436_100078798 3300006914 Bacteria 2282
58 Ga0075435_100059145 3300007076 Bacteria 3106
59 Ga0105247_10006243 3300009101 Bacteria 7391
60 Ga0105247_10006815 3300009101 Bacteria 7042
61 Ga0105247_10034533 3300009101 Bacteria 3080
62 Ga0105237_10002097 3300009545 Bacteria 25173
63 Ga0105237_10130395 3300009545 Bacteria 2509
64 Ga0105238_10012485 3300009551 Bacteria 8569
65 Ga0105238_10029929 3300009551 Bacteria 5543
66 Ga0105239_10013662 3300010375 Bacteria 9016
67 Ga0105239_10066754 3300010375 Bacteria 3951
68 Ga0105239_10068480 3300010375 Bacteria 3900
69 Ga0157370_10011827 3300013104 Bacteria 9107
70 Ga0157369_10028834 3300013105 Bacteria 6139
71 Ga0163162_10026643 3300013306 Bacteria 5714
72 Ga0157375_10530911 3300013308 Bacteria 1339
73 Ga0163163_10055204 3300014325 Bacteria 3926
74 Ga0157379_10013168 3300014968 Bacteria 7241
75 Ga0157379_10131134 3300014968 Bacteria 2256
76 Ga0157376_10144060 3300014969 Bacteria 2141
77 Ga0207692_10001477 3300025898 Bacteria 8810
78 Ga0207692_10046139 3300025898 Bacteria 2183
79 Ga0207710_10023418 3300025900 Bacteria 2654
80 Ga0207710_10033117 3300025900 Bacteria 2266
81 Ga0207685_10016423 3300025905 Bacteria 2369
82 Ga0207685_10046347 3300025905 Bacteria 1654
83 Ga0207699_10014448 3300025906 Bacteria 4071
84 Ga0207699_10025562 3300025906 Bacteria 3243
85 Ga0207707_10003412 3300025912 Bacteria 14088
86 Ga0207707_10176634 3300025912 Bacteria 1866
87 Ga0207695_10117208 3300025913 Bacteria 2636
88 Ga0207671_10235857 3300025914 Bacteria 1436
89 Ga0207693_10000326 3300025915 Bacteria 44051
90 Ga0207693_10003223 3300025915 Bacteria 14005
91 Ga0207693_10198770 3300025915 Bacteria 1577
92 Ga0207663_10005353 3300025916 Bacteria 6457
93 Ga0207660_10002475 3300025917 Bacteria 12137
94 Ga0207657_10000702 3300025919 Bacteria 35592
95 Ga0207657_10053900 3300025919 Bacteria 3481
96 Ga0207694_10042850 3300025924 Bacteria 3492
97 Ga0207650_10302346 3300025925 Bacteria 1307
98 Ga0207659_10270932 3300025926 Bacteria 1385
99 Ga0207700_10023429 3300025928 Bacteria 4256
100 Ga0207700_10102885 3300025928 Bacteria 2282
101 Ga0207664_10016481 3300025929 Bacteria 5392
102 Ga0207690_10046160 3300025932 Bacteria 2884
103 Ga0207670_10087248 3300025936 Bacteria 2198
104 Ga0207665_10001364 3300025939 Bacteria 16457
105 Ga0207665_10004369 3300025939 Bacteria 9387
106 Ga0207679_10371974 3300025945 Bacteria 1251
107 Ga0207667_10001330 3300025949 Bacteria 30977
108 Ga0207703_10132591 3300026035 Bacteria 2153
109 Ga0207678_10036656 3300026067 Bacteria 4269
110 Ga0207641_10093338 3300026088 Bacteria 2638
111 Ga0207676_10286890 3300026095 Bacteria 1497
112 Ga0268264_10000020 3300028381 Bacteria 483593
113 Ga0265337_1010821 3300028556 Bacteria 3174
114 Ga0265319_1000642 3300028563 Bacteria 23018
115 Ga0265334_10002301 3300028573 Bacteria 8979
116 Ga0265323_10000169 3300028653 Bacteria 38978
117 Ga0265336_10000663 3300028666 Bacteria 18699
118 Ga0265338_10000013 3300028800 Bacteria 379065
119 Ga0265330_10002148 3300031235 Bacteria 10875
120 Ga0265328_10051038 3300031239 Bacteria 1519
121 Ga0265325_10004341 3300031241 Bacteria 8981
122 Ga0265340_10023424 3300031247 Bacteria 3149
123 Ga0265340_10051349 3300031247 Bacteria 1997
124 Ga0265340_10079731 3300031247 Bacteria 1543
125 Ga0265339_10028982 3300031249 Bacteria 3144
126 Ga0265331_10050408 3300031250 Bacteria 1996
127 Ga0265331_10111313 3300031250 Bacteria 1256
128 Ga0307508_10000058 3300031616 Bacteria 125293
129 Ga0265342_10084611 3300031712 Bacteria 1826
130 Ga0307507_10089997 3300033179 Bacteria 2636
131 Ga0373934_0024472 3300035086 Bacteria 2334
132 Ga0373923_0019542 3300035111 Bacteria 2624
133 Ga0373923_0057579 3300035111 Unclassified 1644
134 Ga0373932_0014939 3300035112 Bacteria 1961
135 Ga0373945_0012768 3300035116 Bacteria 2795
136 Ga0373945_0082346 3300035116 Bacteria 1235
137 Ga0373953_0026359 3300035117 Bacteria 2226
138 Ga0373954_0011723 3300035118 Bacteria 3889
139 Ga0373956_0007546 3300035119 Bacteria 4381
140 Ga0373956_0076611 3300035119 Bacteria 1531
141 Ga0373957_0012022 3300035120 Bacteria 2904
142 Ga0373943_0027386 3300035170 Bacteria 2678
143 Ga0373943_0067289 3300035170 Bacteria 1806
144 Ga0373924_0060652 3300035410 Bacteria 1582
145 Ga0373935_0004983 3300035692 Bacteria 7813
146 Ga0373935_0024391 3300035692 Bacteria 3723
147 Ga0373935_0036293 3300035692 Bacteria 3081
148 Ga0373935_0063196 3300035692 Bacteria 2372
149 Ga0373927_0008479 3300035695 Bacteria 6916
150 Ga0373927_0014897 3300035695 Bacteria 5143
151 Ga0373927_0052737 3300035695 Bacteria 2630
152 Ga0373927_0099073 3300035695 Bacteria 1895
153 Ga0373927_0181315 3300035695 Bacteria 1381
154 Ga0373933_0015319 3300035724 Bacteria 4274
155 Ga0373933_0111931 3300035724 Unclassified 1704
156 Ga0373947_0017614 3300035725 Bacteria 4110
157 Ga0373947_0023677 3300035725 Bacteria 3574
158 Ga0373937_0128387 3300036401 Bacteria 2366
159 Ga0373925_0027345 3300037068 Bacteria 4175
160 Ga0373925_0041897 3300037068 Bacteria 3396
161 Ga0373925_0061269 3300037068 Bacteria 2826
162 Ga0373925_0112562 3300037068 Bacteria 2104
163 Ga0373925_0235996 3300037068 Bacteria 1463
164 Ga0436362_1213750 3300039453 Bacteria 1646
165 Ga0495592_0039274 3300046454 Bacteria 3556
166 Ga0495603_0017843 3300046455 Bacteria 4296
167 Ga0495603_0028074 3300046455 Bacteria 3394
168 Ga0495603_0041109 3300046455 Bacteria 2765
169 Ga0495629_0000401 3300046459 Bacteria 36430
170 Ga0495629_0011003 3300046459 Bacteria 6571
171 Ga0495629_0154389 3300046459 Bacteria 1595
172 Ga0495638_0002720 3300046460 Bacteria 14221
173 Ga0495641_0009987 3300046461 Bacteria 5573
174 Ga0495641_0011812 3300046461 Bacteria 4938
175 Ga0495651_0104363 3300046462 Bacteria 2104
176 Ga0495651_0119694 3300046462 Bacteria 1936
177 Ga0495653_0082692 3300046463 Bacteria 2369
178 Ga0495653_0107664 3300046463 Bacteria 2008
179 Ga0495580_0196270 3300046472 Bacteria 1391
180 Ga0495580_0215494 3300046472 Bacteria 1320
181 Ga0495639_0002142 3300046475 Bacteria 8708
182 Ga0495662_0011092 3300046476 Bacteria 4403
183 Ga0495662_0024841 3300046476 Bacteria 2892
184 Ga0495594_0002226 3300046499 Bacteria 10087
185 Ga0495594_0004129 3300046499 Bacteria 7463
186 Ga0495594_0011198 3300046499 Bacteria 4657
187 Ga0495594_0152891 3300046499 Bacteria 1310
188 Ga0495608_0033306 3300046511 Bacteria 3483
189 Ga0495610_0021420 3300046512 Bacteria 3556
190 Ga0495618_0150945 3300046514 Bacteria 1484
191 Ga0495628_0020863 3300046516 Bacteria 5398
192 Ga0495628_0025963 3300046516 Bacteria 4782
193 Ga0495630_0035944 3300046517 Bacteria 3703
194 Ga0495630_0102760 3300046517 Bacteria 2162
195 Ga0495630_0151584 3300046517 Bacteria 1764
196 Ga0495643_0080899 3300046522 Bacteria 1690
197 Ga0495644_0032009 3300046523 Bacteria 1988
198 Ga0495648_0003070 3300046524 Bacteria 14912
199 Ga0495648_0092633 3300046524 Bacteria 1687
200 Ga0495666_0023605 3300046526 Plasmid 3041
201 Ga0495652_0071914 3300046529 Bacteria 2884
202 Ga0495652_0138164 3300046529 Bacteria 1920
203 Ga0495652_0148822 3300046529 Bacteria 1832
204 Ga0495654_0015738 3300046530 Bacteria 4013
205 Ga0495665_0002068 3300046531 Bacteria 10862
206 Ga0495665_0052600 3300046531 Bacteria 2156
207 Ga0495665_0057642 3300046531 Unclassified 2050
208 Ga0495640_0019241 3300046533 Bacteria 5044
209 Ga0495640_0076246 3300046533 Bacteria 2237
210 Ga0495640_0079341 3300046533 Bacteria 2185
211 Ga0495587_0024115 3300046536 Bacteria 3732
212 Ga0495587_0091427 3300046536 Unclassified 1758
213 Ga0495622_0054770 3300046557 Unclassified 1850
214 Ga0495667_0044033 3300046559 Bacteria 2956
215 Ga0495667_0121081 3300046559 Bacteria 1689
216 Ga0495667_0189948 3300046559 Bacteria 1316
217 Ga0495634_0048518 3300046642 Bacteria 2858
218 Ga0495634_0058946 3300046642 Bacteria 2559
219 Ga0495634_0060157 3300046642 Bacteria 2528
220 Ga0495634_0077068 3300046642 Bacteria 2187
221 Ga0495625_0029874 3300046660 Bacteria 4071
222 Ga0495635_0020301 3300046663 Bacteria 4629
223 Ga0495635_0053133 3300046663 Bacteria 2791
224 Ga0495635_0129377 3300046663 Bacteria 1721
225 Ga0495588_0091573 3300046674 Bacteria 1593
226 Ga0495588_0093116 3300046674 Unclassified 1579
227 Ga0495657_0112906 3300046675 Bacteria 1719
228 Ga0495599_0003308 3300046678 Bacteria 9409
229 Ga0495599_0077603 3300046678 Bacteria 2074
230 Ga0495623_0018839 3300046679 Bacteria 4456
231 Ga0495646_0017623 3300046680 Bacteria 4529
232 Ga0495646_0107413 3300046680 Bacteria 1592
233 Ga0495647_0005387 3300046681 Bacteria 4189
234 Ga0495658_0000265 3300046683 Bacteria 29770
235 Ga0495658_0003333 3300046683 Bacteria 7969
236 Ga0495658_0043431 3300046683 Unclassified 2514
237 Ga0495658_0086274 3300046683 Bacteria 1851
238 Ga0495669_0084198 3300046684 Bacteria 1462
239 Ga0495613_0008228 3300046689 Bacteria 7744
240 Ga0495613_0034201 3300046689 Bacteria 3776
241 Ga0495613_0073087 3300046689 Bacteria 2499
242 Ga0495624_0038116 3300046690 Bacteria 3089
243 Ga0495671_0018090 3300046692 Bacteria 3747
244 Ga0495600_0027449 3300046809 Bacteria 3678
245 Ga0495600_0098273 3300046809 Bacteria 1908
246 Ga0495600_0145296 3300046809 Bacteria 1537
247 Ga0495600_0201247 3300046809 Unclassified 1279
248 Ga0495660_0095110 3300046810 Bacteria 1541
249 Ga0495581_0015814 3300047315 Bacteria 4382
250 Ga0495604_0021963 3300047317 Bacteria 5093
251 Ga0495604_0111385 3300047317 Bacteria 1995
252 Ga0495674_0013608 3300047319 Bacteria 7643
253 Ga0495674_0014838 3300047319 Bacteria 7289
254 Ga0495674_0080551 3300047319 Bacteria 2794
255 Ga0495672_0054401 3300047320 Bacteria 2340
256 Ga0495676_0031404 3300047321 Bacteria 4493
257 Ga0495676_0163354 3300047321 Bacteria 1573
258 Ga0495680_0030163 3300047322 Bacteria 4431
259 Ga0495680_0076356 3300047322 Bacteria 2540
260 Ga0495675_0013961 3300047444 Bacteria 5079
261 Ga0495673_0014114 3300047469 Bacteria 4164
262 Ga0495684_0006948 3300047471 Bacteria 8788
263 Ga0495684_0031108 3300047471 Bacteria 4097
264 Ga0495684_0061741 3300047471 Bacteria 2851
265 Ga0495686_0130298 3300047472 Bacteria 1492
266 Ga0495593_0002908 3300047673 Bacteria 10322
267 Ga0495593_0016992 3300047673 Bacteria 4095
268 Ga0496102_0025851 3300048905 Bacteria 5230
269 Ga0496104_0433976 3300048907 Unclassified 1225
270 Ga0496105_0199964 3300048908 Bacteria 1631
271 Ga0496106_0007382 3300048909 Bacteria 8124
272 Ga0496108_0026285 3300048911 Bacteria 4801
273 Ga0496109_0043189 3300048912 Bacteria 4086
274 Ga0496109_0146572 3300048912 Bacteria 2209
275 Ga0496111_0120941 3300048914 Bacteria 1934
276 Ga0496112_0020631 3300048915 Bacteria 6248
277 Ga0496112_0059616 3300048915 Bacteria 3761
278 Ga0496112_0131299 3300048915 Bacteria 2476
279 Ga0496114_0329305 3300048917 Bacteria 1350
280 Ga0496115_0057816 3300048918 Bacteria 3120
281 Ga0496115_0140675 3300048918 Bacteria 1991
282 Ga0496115_0321326 3300048918 Bacteria 1266
283 Ga0496117_0008333 3300048920 Bacteria 9863
284 Ga0496117_0039490 3300048920 Bacteria 3483
285 Ga0496118_0010695 3300048921 Bacteria 9047
286 Ga0496118_0064329 3300048921 Bacteria 2692
287 Ga0496119_0033622 3300048922 Bacteria 3395
288 Ga0496119_0056814 3300048922 Bacteria 2369
289 Ga0496120_0016663 3300048923 Bacteria 4796
290 Ga0496121_0001451 3300048924 Bacteria 40023
291 Ga0496121_0002396 3300048924 Bacteria 28735
292 Ga0496121_0012595 3300048924 Bacteria 9193
293 Ga0496121_0126523 3300048924 Bacteria 1919
294 Ga0496121_0154790 3300048924 Bacteria 1683
295 Ga0496122_0008649 3300048925 Bacteria 10923
296 Ga0496122_0116624 3300048925 Bacteria 1736
297 Ga0496124_0019555 3300048927 Bacteria 6295
298 Ga0496124_0088645 3300048927 Bacteria 2528
299 Ga0496125_0000515 3300048928 Bacteria 67237
300 Ga0496125_0000744 3300048928 Bacteria 53740
301 Ga0496125_0006386 3300048928 Bacteria 12773
302 Ga0496125_0014654 3300048928 Bacteria 7621
303 Ga0496126_0111816 3300048929 Bacteria 2379
304 Ga0496126_0156880 3300048929 Bacteria 1947
305 Ga0496126_0190693 3300048929 Bacteria 1736
306 Ga0501031_0001866 3300049568 Bacteria 13252
307 Ga0501032_0014244 3300049569 Bacteria 5632
308 Ga0501032_0021768 3300049569 Bacteria 4453
309 Ga0501032_0138189 3300049569 Bacteria 1605
310 Ga0501033_0076975 3300049570 Bacteria 2448
311 Ga0501033_0083945 3300049570 Bacteria 2334
312 Ga0501033_0187210 3300049570 Bacteria 1482
313 Ga0501034_0271538 3300049571 Bacteria 1636
314 Ga0501036_0023203 3300049572 Bacteria 5224
315 Ga0501037_0000595 3300049573 Bacteria 28225
316 Ga0501037_0035125 3300049573 Bacteria 3697
317 Ga0501038_0005164 3300049574 Bacteria 12140
318 Ga0501038_0022542 3300049574 Bacteria 5640
319 Ga0501039_0015580 3300049575 Bacteria 5817
320 Ga0501039_0082231 3300049575 Bacteria 2507
321 Ga0501040_0093222 3300049576 Bacteria 2094
322 Ga0501041_0143139 3300049577 Bacteria 1491
323 Ga0501042_0002901 3300049578 Bacteria 10643
324 Ga0501043_0022706 3300049579 Bacteria 4920
325 Ga0501043_0049516 3300049579 Bacteria 3303
326 Ga0501046_0002131 3300049580 Bacteria 18703
327 Ga0501048_0001447 3300049582 Bacteria 18018
328 Ga0501067_0006079 3300049583 Bacteria 6692
329 Ga0501068_0013601 3300049584 Bacteria 4634
330 Ga0501070_0085388 3300049586 Bacteria 2613
331 Ga0501071_0210888 3300049587 Bacteria 1460
332 Ga0501072_0042227 3300049588 Bacteria 3582
333 Ga0501073_0040917 3300049589 Bacteria 3276
334 Ga0501074_0023251 3300049590 Bacteria 4508
335 Ga0501080_0049161 3300049742 Bacteria 3925
336 Ga0501083_0023504 3300049744 Bacteria 4273
337 Ga0501035_0000838 3300049822 Bacteria 32854
338 Ga0501035_0075828 3300049822 Bacteria 2974
339 Ga0501035_0244781 3300049822 Bacteria 1524
340 Ga0501044_0010287 3300049823 Bacteria 10161
341 Ga0501045_0001658 3300049824 Bacteria 14971
342 nmdc:mga03n38_109653_c1 3300050490 Bacteria 1342
343 nmdc:mga0yw44_10870_c1 3300050492 Bacteria 4667
344 nmdc:mga0n895_116975_c1 3300050512 Bacteria 2685
345 nmdc:mga08x19_108712_c1 3300050514 Bacteria 1847
346 Ga0495601_0069031 3300053077 Bacteria 2253
347 Ga0495601_0070604 3300053077 Bacteria 2229
348 Ga0495612_0062373 3300053078 Bacteria 1545
349 Ga0495619_0000164 3300053085 Bacteria 48672
350 Ga0495619_0006470 3300053085 Bacteria 7418
351 Ga0495619_0065287 3300053085 Bacteria 2428
352 Ga0495619_0079148 3300053085 Bacteria 2210
353 Ga0500647_0015614 3300053091 Bacteria 3477
354 Ga0500651_0130530 3300053093 Bacteria 1520
355 Ga0500566_0000400 3300053094 Bacteria 24130
356 Ga0500650_0000315 3300053098 Bacteria 11676
357 Ga0500556_0000030 3300053104 Bacteria 165098
358 Ga0500572_000121 3300053111 Bacteria 26132
359 Ga0500572_000853 3300053111 Bacteria 9498
360 Ga0500592_004210 3300053116 Bacteria 2299
361 Ga0500593_024577 3300053117 Bacteria 2677
362 Ga0500595_000749 3300053119 Bacteria 19100
363 Ga0500595_006637 3300053119 Bacteria 4883
364 Ga0500608_003152 3300053122 Bacteria 6126
365 Ga0500642_0000006 3300053130 Bacteria 350064
366 Ga0500652_003613 3300053131 Bacteria 4698
367 Ga0500559_0001188 3300053136 Bacteria 15483
368 Ga0500559_0001424 3300053136 Bacteria 13570
369 Ga0500559_0016013 3300053136 Bacteria 3166
370 Ga0500568_0001277 3300053139 Bacteria 16583
371 Ga0500568_0027350 3300053139 Bacteria 2386
372 Ga0500573_0035071 3300053140 Bacteria 2893
373 Ga0500603_002026 3300053150 Bacteria 4486
374 Ga0500616_0038665 3300053153 Bacteria 2576
375 Ga0500622_0001022 3300053156 Bacteria 23514
376 Ga0500627_0026960 3300053158 Bacteria 2375
377 Ga0500630_001045 3300053159 Bacteria 12946
378 Ga0500638_064210 3300053162 Bacteria 1761
379 Ga0500639_000219 3300053163 Bacteria 28391
380 Ga0500611_002536 3300053727 Bacteria 2205
381 Ga0500596_000227 3300053735 Bacteria 9566
382 Ga0500596_006845 3300053735 Bacteria 1897
383 Ga0501084_0072744 3300054114 Bacteria 2879
384 Ga0501082_0198877 3300060353 Bacteria 1743
385 2509148573 2508501128 Bacteria 8613869
386 2513888418 2513237141 Bacteria 8496279
387 2857525288 2857524615 Bacteria 6615449
388 2919075021 2919073203 Bacteria 6531949
389 2935702746 2935694250 Bacteria 9291695
390 Ga0081539_10049547
391 Ga0070658_10044519
392 Ga0070680_100013650
393 Ga0070680_100208796
394 Ga0070660_100001124
395 Ga0070691_10040644
396 Ga0070675_100341259
397 Ga0070709_10000537
398 Ga0070709_10008113
399 Ga0070709_10064444
400 Ga0070709_10139214
401 Ga0070714_100020513
402 Ga0070714_100032673
403 Ga0070714_100128072
404 Ga0070713_100006321
405 Ga0070713_100109709
406 Ga0070710_10003271
407 Ga0070710_10185039
408 Ga0070711_100008021
409 Ga0070711_100010481
410 Ga0070711_100027000
411 Ga0070708_100202907
412 Ga0070708_100366507
413 Ga0070663_100047330
414 Ga0070678_100246003
415 Ga0070681_10040314
416 Ga0070681_10122365
417 Ga0070706_100161151
418 Ga0070698_100117388
419 Ga0070679_100036243
420 Ga0070684_100331744
421 Ga0070697_100074079
422 Ga0068853_100108257
423 Ga0070704_100160802
424 Ga0068855_100051873
425 Ga0070702_100082201
426 Ga0068864_100322255
427 Ga0068863_100113108
428 Ga0068858_100108071
429 Ga0068858_100174833
430 Ga0068858_100203635
431 Ga0068860_100000302
432 Ga0081455_10007131
433 Ga0081455_10113168
434 Ga0081540_1000585
435 Ga0070717_10062179
436 Ga0070717_10091729
437 Ga0070717_10110848
438 Ga0075365_10015666
439 Ga0070715_10024949
440 Ga0070716_100004821
441 Ga0070716_100108663
442 Ga0070712_100024567
443 Ga0070712_100026291
444 Ga0070712_100088571
445 Ga0075434_100295849
446 Ga0075436_100078798
447 Ga0075435_100059145
448 Ga0105247_10006243
449 Ga0105247_10006815
450 Ga0105247_10034533
451 Ga0105237_10002097
452 Ga0105237_10130395
453 Ga0105238_10012485
454 Ga0105238_10029929
455 Ga0105239_10013662
456 Ga0105239_10066754
457 Ga0105239_10068480
458 Ga0157370_10011827
459 Ga0157369_10028834
460 Ga0163162_10026643
461 Ga0157375_10530911
462 Ga0163163_10055204
463 Ga0157379_10013168
464 Ga0157379_10131134
465 Ga0157376_10144060
466 Ga0207692_10001477
467 Ga0207692_10046139
468 Ga0207710_10023418
469 Ga0207710_10033117
470 Ga0207685_10016423
471 Ga0207685_10046347
472 Ga0207699_10014448
473 Ga0207699_10025562
474 Ga0207707_10003412
475 Ga0207707_10176634
476 Ga0207695_10117208
477 Ga0207671_10235857
478 Ga0207693_10000326
479 Ga0207693_10003223
480 Ga0207693_10198770
481 Ga0207663_10005353
482 Ga0207660_10002475
483 Ga0207657_10000702
484 Ga0207657_10053900
485 Ga0207694_10042850
486 Ga0207650_10302346
487 Ga0207659_10270932
488 Ga0207700_10023429
489 Ga0207700_10102885
490 Ga0207664_10016481
491 Ga0207690_10046160
492 Ga0207670_10087248
493 Ga0207665_10001364
494 Ga0207665_10004369
495 Ga0207679_10371974
496 Ga0207667_10001330
497 Ga0207703_10132591
498 Ga0207678_10036656
499 Ga0207641_10093338
500 Ga0207676_10286890
501 Ga0268264_10000020
502 Ga0265337_1010821
503 Ga0265319_1000642
504 Ga0265334_10002301
505 Ga0265323_10000169
506 Ga0265336_10000663
507 Ga0265338_10000013
508 Ga0265330_10002148
509 Ga0265328_10051038
510 Ga0265325_10004341
511 Ga0265340_10023424
512 Ga0265340_10051349
513 Ga0265340_10079731
514 Ga0265339_10028982
515 Ga0265331_10050408
516 Ga0265331_10111313
517 Ga0307508_10000058
518 Ga0265342_10084611
519 Ga0307507_10089997
520 Ga0373934_0024472
521 Ga0373923_0019542
522 Ga0373923_0057579
523 Ga0373932_0014939
524 Ga0373945_0012768
525 Ga0373945_0082346
526 Ga0373953_0026359
527 Ga0373954_0011723
528 Ga0373956_0007546
529 Ga0373956_0076611
530 Ga0373957_0012022
531 Ga0373943_0027386
532 Ga0373943_0067289
533 Ga0373924_0060652
534 Ga0373935_0004983
535 Ga0373935_0024391
536 Ga0373935_0036293
537 Ga0373935_0063196
538 Ga0373927_0008479
539 Ga0373927_0014897
540 Ga0373927_0052737
541 Ga0373927_0099073
542 Ga0373927_0181315
543 Ga0373933_0015319
544 Ga0373933_0111931
545 Ga0373947_0017614
546 Ga0373947_0023677
547 Ga0373937_0128387
548 Ga0373925_0027345
549 Ga0373925_0041897
550 Ga0373925_0061269
551 Ga0373925_0112562
552 Ga0373925_0235996
553 Ga0436362_1213750
554 Ga0495592_0039274
555 Ga0495603_0017843
556 Ga0495603_0028074
557 Ga0495603_0041109
558 Ga0495629_0000401
559 Ga0495629_0011003
560 Ga0495629_0154389
561 Ga0495638_0002720
562 Ga0495641_0009987
563 Ga0495641_0011812
564 Ga0495651_0104363
565 Ga0495651_0119694
566 Ga0495653_0082692
567 Ga0495653_0107664
568 Ga0495580_0196270
569 Ga0495580_0215494
570 Ga0495639_0002142
571 Ga0495662_0011092
572 Ga0495662_0024841
573 Ga0495594_0002226
574 Ga0495594_0004129
575 Ga0495594_0011198
576 Ga0495594_0152891
577 Ga0495608_0033306
578 Ga0495610_0021420
579 Ga0495618_0150945
580 Ga0495628_0020863
581 Ga0495628_0025963
582 Ga0495630_0035944
583 Ga0495630_0102760
584 Ga0495630_0151584
585 Ga0495643_0080899
586 Ga0495644_0032009
587 Ga0495648_0003070
588 Ga0495648_0092633
589 Ga0495666_0023605
590 Ga0495652_0071914
591 Ga0495652_0138164
592 Ga0495652_0148822
593 Ga0495654_0015738
594 Ga0495665_0002068
595 Ga0495665_0052600
596 Ga0495665_0057642
597 Ga0495640_0019241
598 Ga0495640_0076246
599 Ga0495640_0079341
600 Ga0495587_0024115
601 Ga0495587_0091427
602 Ga0495622_0054770
603 Ga0495667_0044033
604 Ga0495667_0121081
605 Ga0495667_0189948
606 Ga0495634_0048518
607 Ga0495634_0058946
608 Ga0495634_0060157
609 Ga0495634_0077068
610 Ga0495625_0029874
611 Ga0495635_0020301
612 Ga0495635_0053133
613 Ga0495635_0129377
614 Ga0495588_0091573
615 Ga0495588_0093116
616 Ga0495657_0112906
617 Ga0495599_0003308
618 Ga0495599_0077603
619 Ga0495623_0018839
620 Ga0495646_0017623
621 Ga0495646_0107413
622 Ga0495647_0005387
623 Ga0495658_0000265
624 Ga0495658_0003333
625 Ga0495658_0043431
626 Ga0495658_0086274
627 Ga0495669_0084198
628 Ga0495613_0008228
629 Ga0495613_0034201
630 Ga0495613_0073087
631 Ga0495624_0038116
632 Ga0495671_0018090
633 Ga0495600_0027449
634 Ga0495600_0098273
635 Ga0495600_0145296
636 Ga0495600_0201247
637 Ga0495660_0095110
638 Ga0495581_0015814
639 Ga0495604_0021963
640 Ga0495604_0111385
641 Ga0495674_0013608
642 Ga0495674_0014838
643 Ga0495674_0080551
644 Ga0495672_0054401
645 Ga0495676_0031404
646 Ga0495676_0163354
647 Ga0495680_0030163
648 Ga0495680_0076356
649 Ga0495675_0013961
650 Ga0495673_0014114
651 Ga0495684_0006948
652 Ga0495684_0031108
653 Ga0495684_0061741
654 Ga0495686_0130298
655 Ga0495593_0002908
656 Ga0495593_0016992
657 Ga0496102_0025851
658 Ga0496104_0433976
659 Ga0496105_0199964
660 Ga0496106_0007382
661 Ga0496108_0026285
662 Ga0496109_0043189
663 Ga0496109_0146572
664 Ga0496111_0120941
665 Ga0496112_0020631
666 Ga0496112_0059616
667 Ga0496112_0131299
668 Ga0496114_0329305
669 Ga0496115_0057816
670 Ga0496115_0140675
671 Ga0496115_0321326
672 Ga0496117_0008333
673 Ga0496117_0039490
674 Ga0496118_0010695
675 Ga0496118_0064329
676 Ga0496119_0033622
677 Ga0496119_0056814
678 Ga0496120_0016663
679 Ga0496121_0001451
680 Ga0496121_0002396
681 Ga0496121_0012595
682 Ga0496121_0126523
683 Ga0496121_0154790
684 Ga0496122_0008649
685 Ga0496122_0116624
686 Ga0496124_0019555
687 Ga0496124_0088645
688 Ga0496125_0000515
689 Ga0496125_0000744
690 Ga0496125_0006386
691 Ga0496125_0014654
692 Ga0496126_0111816
693 Ga0496126_0156880
694 Ga0496126_0190693
695 Ga0501031_0001866
696 Ga0501032_0014244
697 Ga0501032_0021768
698 Ga0501032_0138189
699 Ga0501033_0076975
700 Ga0501033_0083945
701 Ga0501033_0187210
702 Ga0501034_0271538
703 Ga0501036_0023203
704 Ga0501037_0000595
705 Ga0501037_0035125
706 Ga0501038_0005164
707 Ga0501038_0022542
708 Ga0501039_0015580
709 Ga0501039_0082231
710 Ga0501040_0093222
711 Ga0501041_0143139
712 Ga0501042_0002901
713 Ga0501043_0022706
714 Ga0501043_0049516
715 Ga0501046_0002131
716 Ga0501048_0001447
717 Ga0501067_0006079
718 Ga0501068_0013601
719 Ga0501070_0085388
720 Ga0501071_0210888
721 Ga0501072_0042227
722 Ga0501073_0040917
723 Ga0501074_0023251
724 Ga0501080_0049161
725 Ga0501083_0023504
726 Ga0501035_0000838
727 Ga0501035_0075828
728 Ga0501035_0244781
729 Ga0501044_0010287
730 Ga0501045_0001658
731 nmdc:mga03n38_109653_c1
732 nmdc:mga0yw44_10870_c1
733 nmdc:mga0n895_116975_c1
734 nmdc:mga08x19_108712_c1
735 Ga0495601_0069031
736 Ga0495601_0070604
737 Ga0495612_0062373
738 Ga0495619_0000164
739 Ga0495619_0006470
740 Ga0495619_0065287
741 Ga0495619_0079148
742 Ga0500647_0015614
743 Ga0500651_0130530
744 Ga0500566_0000400
745 Ga0500650_0000315
746 Ga0500556_0000030
747 Ga0500572_000121
748 Ga0500572_000853
749 Ga0500592_004210
750 Ga0500593_024577
751 Ga0500595_000749
752 Ga0500595_006637
753 Ga0500608_003152
754 Ga0500642_0000006
755 Ga0500652_003613
756 Ga0500559_0001188
757 Ga0500559_0001424
758 Ga0500559_0016013
759 Ga0500568_0001277
760 Ga0500568_0027350
761 Ga0500573_0035071
762 Ga0500603_002026
763 Ga0500616_0038665
764 Ga0500622_0001022
765 Ga0500627_0026960
766 Ga0500630_001045
767 Ga0500638_064210
768 Ga0500639_000219
769 Ga0500611_002536
770 Ga0500596_000227
771 Ga0500596_006845
772 Ga0501084_0072744
773 Ga0501082_0198877
774 2509148573
775 2513888418
776 2857525288
777 2919075021
778 2935702746

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02652

Lactate_perm

L-lactate permease

16

89

0.94

PF02470

MlaD

MlaD protein

86

165

0.88

PF03886

ABC_trans_aux

ABC-type transport auxiliary lipoprotein component

252

408

0.85

Map