F431362

General Info

Members Datasets Scaffolds Average Seq Length
389 198 778 100

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100633562|Ga0068863_1006335622
Length 109
Sequence LRSFQNNLNKFNEAGIRIVGISVDTPEQTRTHMVQEAGYSFTFLSDPKLETILSYDLVHAHELASGKDIARPAEFLLDSSGVIRWRMVTENFFKIARPEEVLEAAKLLK

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
149 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
150 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
151 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
152 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
153 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
154 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
155 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
168 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
169 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
176 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
177 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
178 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
179 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
180 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
181 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
182 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
183 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
184 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
185 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
186 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
187 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
188 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
189 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
190 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.54
Rhizosphere 98.46
Stem 0
Stem Tuber 0
Unclassified 31.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100633562 3300005841 Bacteria 1060
2 SwRhRL2b_contig_1185725 2162886007 Unclassified 815
3 SwRhRL2b_contig_1339468 2162886007 Unclassified 1141
4 CNBas_1001547 3300000531 Bacteria 1219
5 Ga0065704_10129347 3300005289 Bacteria 1650
6 Ga0065704_10475107 3300005289 Unclassified 686
7 Ga0065712_10030225 3300005290 Bacteria 871
8 Ga0065715_10176998 3300005293 Bacteria 1504
9 Ga0065707_10012045 3300005295 Bacteria 1741
10 Ga0070676_10003275 3300005328 Bacteria 8412
11 Ga0070690_100002131 3300005330 Bacteria 10575
12 Ga0070670_100096623 3300005331 Bacteria 2541
13 Ga0070670_100687858 3300005331 Bacteria 919
14 Ga0068869_100232013 3300005334 Bacteria 1467
15 Ga0068869_100426866 3300005334 Unclassified 1095
16 Ga0068869_100938187 3300005334 Unclassified 751
17 Ga0070666_10050650 3300005335 Bacteria 2793
18 Ga0070666_10966223 3300005335 Unclassified 631
19 Ga0070680_100316011 3300005336 Bacteria 1326
20 Ga0070682_100189634 3300005337 Bacteria 1442
21 Ga0068868_100029456 3300005338 Bacteria 4204
22 Ga0070660_100873817 3300005339 Bacteria 757
23 Ga0070689_100274407 3300005340 Bacteria 1397
24 Ga0070689_100722585 3300005340 Unclassified 871
25 Ga0070691_10051029 3300005341 Bacteria 1974
26 Ga0070687_100237672 3300005343 Bacteria 1125
27 Ga0070687_101230956 3300005343 Bacteria 553
28 Ga0070661_100150557 3300005344 Bacteria 1759
29 Ga0070692_10300886 3300005345 Unclassified 979
30 Ga0070668_100164859 3300005347 Bacteria 1800
31 Ga0070668_101846674 3300005347 Bacteria 556
32 Ga0070669_100012050 3300005353 Bacteria 6134
33 Ga0070669_100018581 3300005353 Bacteria 4969
34 Ga0070669_100357534 3300005353 Bacteria 1187
35 Ga0070674_100558172 3300005356 Bacteria 962
36 Ga0070673_100198542 3300005364 Bacteria 1727
37 Ga0070673_101082646 3300005364 Bacteria 748
38 Ga0070673_102003411 3300005364 Unclassified 549
39 Ga0070673_102383216 3300005364 Unclassified 503
40 Ga0070688_101559397 3300005365 Unclassified 538
41 Ga0070659_100188437 3300005366 Bacteria 1695
42 Ga0070659_100635190 3300005366 Unclassified 920
43 Ga0070667_100905163 3300005367 Unclassified 821
44 Ga0070701_10027365 3300005438 Unclassified 2792
45 Ga0070701_10129501 3300005438 Unclassified 1432
46 Ga0070701_10954149 3300005438 Bacteria 595
47 Ga0070700_100005512 3300005441 Bacteria 6715
48 Ga0070700_100057921 3300005441 Bacteria 2433
49 Ga0070700_100072334 3300005441 Bacteria 2204
50 Ga0070694_100059861 3300005444 Bacteria 2596
51 Ga0070694_100349225 3300005444 Unclassified 1145
52 Ga0070694_100367290 3300005444 Unclassified 1119
53 Ga0070694_100370140 3300005444 Bacteria 1115
54 Ga0070694_100708881 3300005444 Bacteria 819
55 Ga0070662_100006011 3300005457 Bacteria 7785
56 Ga0070662_100102420 3300005457 Bacteria 2169
57 Ga0070681_11277780 3300005458 Bacteria 656
58 Ga0068867_100029611 3300005459 Bacteria 3945
59 Ga0068867_100435101 3300005459 Bacteria 1114
60 Ga0068867_102249721 3300005459 Unclassified 518
61 Ga0070685_10073263 3300005466 Bacteria 2035
62 Ga0070685_10335515 3300005466 Unclassified 1029
63 Ga0070706_100000023 3300005467 Bacteria 159966
64 Ga0070706_101817372 3300005467 Bacteria 554
65 Ga0070707_100013235 3300005468 Bacteria 7713
66 Ga0070698_100000010 3300005471 Bacteria 117353
67 Ga0070698_100002192 3300005471 Bacteria 21683
68 Ga0070698_100048427 3300005471 Bacteria 4342
69 Ga0070698_100331384 3300005471 Unclassified 1453
70 Ga0070699_100192951 3300005518 Bacteria 1810
71 Ga0070699_100613168 3300005518 Unclassified 992
72 Ga0070699_100634870 3300005518 Bacteria 974
73 Ga0070679_100175346 3300005530 Bacteria 2116
74 Ga0070679_100197520 3300005530 Bacteria 1978
75 Ga0070684_100534159 3300005535 Unclassified 1087
76 Ga0070697_100034749 3300005536 Unclassified 4065
77 Ga0070672_100004782 3300005543 Bacteria 8888
78 Ga0070672_100324067 3300005543 Bacteria 1310
79 Ga0070695_100493145 3300005545 Unclassified 946
80 Ga0070695_101097853 3300005545 Unclassified 651
81 Ga0070696_100040632 3300005546 Bacteria 3211
82 Ga0070665_100063614 3300005548 Bacteria 3699
83 Ga0070704_100117577 3300005549 Bacteria 2035
84 Ga0070704_100172880 3300005549 Bacteria 1720
85 Ga0068855_100887932 3300005563 Unclassified 942
86 Ga0068855_101290340 3300005563 Unclassified 756
87 Ga0068857_100303362 3300005577 Unclassified 1472
88 Ga0068857_100517184 3300005577 Bacteria 1121
89 Ga0068857_100909361 3300005577 Unclassified 844
90 Ga0068857_101772664 3300005577 Unclassified 604
91 Ga0068854_100018396 3300005578 Bacteria 4689
92 Ga0068854_100983089 3300005578 Unclassified 746
93 Ga0068856_100015347 3300005614 Bacteria 7404
94 Ga0070702_100093960 3300005615 Bacteria 1825
95 Ga0070702_100531686 3300005615 Unclassified 869
96 Ga0068859_100212017 3300005617 Bacteria 2023
97 Ga0068859_100319977 3300005617 Bacteria 1645
98 Ga0068859_100529207 3300005617 Unclassified 1273
99 Ga0068859_100577432 3300005617 Unclassified 1218
100 Ga0068864_100000166 3300005618 Bacteria 60717
101 Ga0068864_100016354 3300005618 Bacteria 6175
102 Ga0068864_100249659 3300005618 Bacteria 1647
103 Ga0068864_100388237 3300005618 Bacteria 1325
104 Ga0068864_100496333 3300005618 Bacteria 1174
105 Ga0068864_100975816 3300005618 Bacteria 839
106 Ga0068866_10007009 3300005718 Bacteria 4710
107 Ga0068866_10014509 3300005718 Bacteria 3481
108 Ga0068861_100154762 3300005719 Bacteria 1884
109 Ga0068861_100561720 3300005719 Bacteria 1041
110 Ga0068861_101469969 3300005719 Unclassified 668
111 Ga0068870_10044191 3300005840 Bacteria 2327
112 Ga0068870_10153793 3300005840 Bacteria 1357
113 Ga0068870_10752041 3300005840 Unclassified 677
114 Ga0068870_11156684 3300005840 Unclassified 558
115 Ga0068863_100762906 3300005841 Bacteria 963
116 Ga0068863_101580027 3300005841 Bacteria 665
117 Ga0068858_100000173 3300005842 Bacteria 68371
118 Ga0068858_100345069 3300005842 Bacteria 1425
119 Ga0068858_101056628 3300005842 Bacteria 796
120 Ga0068860_100014669 3300005843 Bacteria 7667
121 Ga0068860_100384522 3300005843 Bacteria 1386
122 Ga0068860_100546268 3300005843 Bacteria 1160
123 Ga0068862_100017832 3300005844 Bacteria 5911
124 Ga0068862_100081643 3300005844 Bacteria 2805
125 Ga0068862_100236605 3300005844 Bacteria 1659
126 Ga0068862_100351467 3300005844 Bacteria 1368
127 Ga0068862_101775755 3300005844 Unclassified 626
128 Ga0070712_100586335 3300006175 Bacteria 942
129 Ga0097621_100018894 3300006237 Bacteria 5278
130 Ga0068871_101570082 3300006358 Unclassified 623
131 Ga0075428_101281665 3300006844 Bacteria 771
132 Ga0075433_10097669 3300006852 Unclassified 2599
133 Ga0075433_10187974 3300006852 Bacteria 1837
134 Ga0075433_10192448 3300006852 Bacteria 1814
135 Ga0075433_10395542 3300006852 Unclassified 1219
136 Ga0075434_100066336 3300006871 Bacteria 3595
137 Ga0075434_100418559 3300006871 Bacteria 1361
138 Ga0097620_100212019 3300006931 Bacteria 2023
139 Ga0097620_100319940 3300006931 Bacteria 1645
140 Ga0097620_100327838 3300006931 Bacteria 1625
141 Ga0097620_100529205 3300006931 Unclassified 1273
142 Ga0097620_100577325 3300006931 Unclassified 1218
143 Ga0075435_100007411 3300007076 Bacteria 7814
144 Ga0105240_10424111 3300009093 Bacteria 1494
145 Ga0105240_10643207 3300009093 Bacteria 1163
146 Ga0111539_10119891 3300009094 Bacteria 3082
147 Ga0111539_11079550 3300009094 Unclassified 933
148 Ga0105245_10169156 3300009098 Bacteria 2080
149 Ga0105245_11065974 3300009098 Unclassified 854
150 Ga0105245_12906810 3300009098 Unclassified 531
151 Ga0105247_10027564 3300009101 Bacteria 3434
152 Ga0114129_10892423 3300009147 Bacteria 1127
153 Ga0114129_11395995 3300009147 Unclassified 864
154 Ga0114129_11494491 3300009147 Bacteria 830
155 Ga0105243_10066646 3300009148 Bacteria 2896
156 Ga0105243_10297930 3300009148 Unclassified 1460
157 Ga0105243_10892282 3300009148 Bacteria 884
158 Ga0105243_11604241 3300009148 Bacteria 677
159 Ga0105243_12651220 3300009148 Bacteria 541
160 Ga0105241_10038052 3300009174 Bacteria 3627
161 Ga0105241_10130607 3300009174 Bacteria 2033
162 Ga0105241_11061747 3300009174 Unclassified 761
163 Ga0105242_10417325 3300009176 Bacteria 1257
164 Ga0105248_10004294 3300009177 Bacteria 15771
165 Ga0105237_10815792 3300009545 Unclassified 940
166 Ga0105237_10847624 3300009545 Bacteria 921
167 Ga0105238_10125253 3300009551 Bacteria 2549
168 Ga0105238_11012209 3300009551 Bacteria 852
169 Ga0105249_10011574 3300009553 Bacteria 7753
170 Ga0105249_10020137 3300009553 Bacteria 5960
171 Ga0105249_10104168 3300009553 Bacteria 2673
172 Ga0105249_11071495 3300009553 Bacteria 876
173 Ga0105239_10083648 3300010375 Bacteria 3515
174 Ga0105239_10292322 3300010375 Bacteria 1835
175 Ga0105239_10320994 3300010375 Bacteria 1746
176 Ga0105239_10700225 3300010375 Bacteria 1158
177 Ga0105239_11437568 3300010375 Bacteria 796
178 Ga0105246_10032546 3300011119 Bacteria 3458
179 Ga0105246_11178952 3300011119 Bacteria 704
180 Ga0105246_11271147 3300011119 Unclassified 681
181 Ga0157373_10043949 3300013100 Bacteria 3190
182 Ga0157373_10046508 3300013100 Bacteria 3097
183 Ga0157373_10836844 3300013100 Bacteria 680
184 Ga0157371_10015905 3300013102 Bacteria 5627
185 Ga0157370_10535011 3300013104 Bacteria 1075
186 Ga0157369_10048322 3300013105 Bacteria 4617
187 Ga0157374_10014783 3300013296 Bacteria 6835
188 Ga0157378_10058850 3300013297 Unclassified 3427
189 Ga0157378_10074169 3300013297 Bacteria 3061
190 Ga0157378_10077836 3300013297 Bacteria 2990
191 Ga0157378_10670681 3300013297 Bacteria 1054
192 Ga0157378_11651497 3300013297 Unclassified 687
193 Ga0157378_12158465 3300013297 Bacteria 608
194 Ga0163162_10241964 3300013306 Bacteria 1935
195 Ga0163162_10887353 3300013306 Unclassified 1005
196 Ga0163162_10888736 3300013306 Bacteria 1005
197 Ga0157372_10098734 3300013307 Bacteria 3331
198 Ga0157372_12624378 3300013307 Unclassified 578
199 Ga0157375_10001126 3300013308 Bacteria 23143
200 Ga0157375_10144248 3300013308 Bacteria 2510
201 Ga0157375_11003728 3300013308 Unclassified 974
202 Ga0157375_11516636 3300013308 Unclassified 791
203 Ga0157375_12955621 3300013308 Unclassified 568
204 Ga0163163_10005487 3300014325 Bacteria 10973
205 Ga0163163_10140384 3300014325 Bacteria 2458
206 Ga0163163_10777326 3300014325 Bacteria 1021
207 Ga0163163_11299722 3300014325 Unclassified 789
208 Ga0157380_10003355 3300014326 Bacteria 10985
209 Ga0157380_10307070 3300014326 Bacteria 1464
210 Ga0157380_12106204 3300014326 Unclassified 627
211 Ga0157377_10048621 3300014745 Bacteria 2381
212 Ga0157377_11424262 3300014745 Unclassified 547
213 Ga0157376_10178261 3300014969 Bacteria 1940
214 Ga0207642_10182631 3300025899 Bacteria 1144
215 Ga0207642_10194474 3300025899 Bacteria 1116
216 Ga0207710_10237851 3300025900 Bacteria 908
217 Ga0207680_10072267 3300025903 Bacteria 2141
218 Ga0207680_11182080 3300025903 Unclassified 546
219 Ga0207647_10390865 3300025904 Unclassified 784
220 Ga0207645_10004345 3300025907 Bacteria 10499
221 Ga0207643_10010235 3300025908 Bacteria 5045
222 Ga0207684_10000146 3300025910 Bacteria 125829
223 Ga0207654_10005612 3300025911 Bacteria 6346
224 Ga0207654_10032934 3300025911 Bacteria 2869
225 Ga0207654_10465379 3300025911 Unclassified 889
226 Ga0207707_10016277 3300025912 Bacteria 6487
227 Ga0207707_10417840 3300025912 Bacteria 1150
228 Ga0207695_10095381 3300025913 Bacteria 2979
229 Ga0207671_10128025 3300025914 Bacteria 1947
230 Ga0207660_10071400 3300025917 Bacteria 2526
231 Ga0207662_10091452 3300025918 Bacteria 1872
232 Ga0207657_10004787 3300025919 Bacteria 14280
233 Ga0207646_10014734 3300025922 Bacteria 7408
234 Ga0207681_10090417 3300025923 Bacteria 2185
235 Ga0207681_10816676 3300025923 Unclassified 779
236 Ga0207681_10998242 3300025923 Unclassified 702
237 Ga0207650_10021726 3300025925 Bacteria 4537
238 Ga0207650_10139569 3300025925 Bacteria 1904
239 Ga0207650_10468844 3300025925 Bacteria 1050
240 Ga0207650_10522751 3300025925 Bacteria 993
241 Ga0207650_10531229 3300025925 Bacteria 985
242 Ga0207650_11404645 3300025925 Unclassified 594
243 Ga0207659_10263599 3300025926 Unclassified 1403
244 Ga0207687_10027290 3300025927 Bacteria 3830
245 Ga0207687_11485909 3300025927 Bacteria 582
246 Ga0207687_11897499 3300025927 Unclassified 509
247 Ga0207690_10093188 3300025932 Bacteria 2134
248 Ga0207690_10727020 3300025932 Unclassified 817
249 Ga0207706_10003234 3300025933 Bacteria 15611
250 Ga0207706_10152982 3300025933 Bacteria 2029
251 Ga0207686_10025073 3300025934 Bacteria 3464
252 Ga0207686_10191439 3300025934 Bacteria 1458
253 Ga0207709_11261296 3300025935 Unclassified 610
254 Ga0207670_10000557 3300025936 Bacteria 20631
255 Ga0207670_10132104 3300025936 Bacteria 1830
256 Ga0207670_10148441 3300025936 Bacteria 1737
257 Ga0207670_10167369 3300025936 Unclassified 1645
258 Ga0207670_10435047 3300025936 Unclassified 1055
259 Ga0207669_10589876 3300025937 Bacteria 902
260 Ga0207704_10270620 3300025938 Bacteria 1286
261 Ga0207665_10426716 3300025939 Bacteria 1014
262 Ga0207691_10000675 3300025940 Bacteria 33714
263 Ga0207691_10564284 3300025940 Unclassified 965
264 Ga0207691_10748163 3300025940 Bacteria 823
265 Ga0207711_10011528 3300025941 Bacteria 7348
266 Ga0207711_11364879 3300025941 Unclassified 651
267 Ga0207689_10056597 3300025942 Bacteria 3227
268 Ga0207689_10152830 3300025942 Bacteria 1903
269 Ga0207689_10168427 3300025942 Bacteria 1805
270 Ga0207689_10642770 3300025942 Bacteria 894
271 Ga0207689_11051890 3300025942 Bacteria 686
272 Ga0207689_11723975 3300025942 Unclassified 519
273 Ga0207689_11834350 3300025942 Unclassified 500
274 Ga0207661_10148383 3300025944 Bacteria 2025
275 Ga0207661_10423882 3300025944 Unclassified 1209
276 Ga0207667_10004050 3300025949 Bacteria 18001
277 Ga0207651_11108131 3300025960 Unclassified 710
278 Ga0207712_10007284 3300025961 Bacteria 6977
279 Ga0207712_10213631 3300025961 Unclassified 1538
280 Ga0207712_11200617 3300025961 Unclassified 677
281 Ga0207668_10943343 3300025972 Unclassified 769
282 Ga0207640_10002588 3300025981 Bacteria 9689
283 Ga0207640_11227548 3300025981 Unclassified 667
284 Ga0207677_10024051 3300026023 Bacteria 3777
285 Ga0207703_10000211 3300026035 Bacteria 68033
286 Ga0207703_10074934 3300026035 Bacteria 2803
287 Ga0207678_10000388 3300026067 Bacteria 40020
288 Ga0207708_10010871 3300026075 Bacteria 6771
289 Ga0207708_10212807 3300026075 Unclassified 1546
290 Ga0207708_10295448 3300026075 Bacteria 1316
291 Ga0207702_10997822 3300026078 Bacteria 831
292 Ga0207641_10029385 3300026088 Bacteria 4545
293 Ga0207641_10242211 3300026088 Bacteria 1681
294 Ga0207641_10587368 3300026088 Unclassified 1089
295 Ga0207641_10866757 3300026088 Unclassified 896
296 Ga0207641_11939243 3300026088 Bacteria 590
297 Ga0207648_10013795 3300026089 Bacteria 7496
298 Ga0207648_10449563 3300026089 Bacteria 1173
299 Ga0207648_11596671 3300026089 Unclassified 613
300 Ga0207676_10000136 3300026095 Bacteria 64065
301 Ga0207676_10052562 3300026095 Bacteria 3185
302 Ga0207676_10297036 3300026095 Unclassified 1473
303 Ga0207676_10389824 3300026095 Unclassified 1299
304 Ga0207674_10087199 3300026116 Bacteria 3115
305 Ga0207674_10357956 3300026116 Unclassified 1411
306 Ga0207674_10759260 3300026116 Bacteria 936
307 Ga0207674_10838237 3300026116 Bacteria 887
308 Ga0207674_11573898 3300026116 Bacteria 626
309 Ga0207675_100013698 3300026118 Bacteria 7569
310 Ga0207675_100282639 3300026118 Bacteria 1613
311 Ga0207675_100361632 3300026118 Bacteria 1424
312 Ga0207675_101551848 3300026118 Unclassified 683
313 Ga0207428_10412964 3300027907 Unclassified 987
314 Ga0268266_10173524 3300028379 Bacteria 1958
315 Ga0268265_10021019 3300028380 Bacteria 4565
316 Ga0268265_10322088 3300028380 Unclassified 1400
317 Ga0268265_10923315 3300028380 Unclassified 858
318 Ga0268264_10377091 3300028381 Bacteria 1357
319 Ga0268264_10717094 3300028381 Bacteria 994
320 Ga0307411_10094403 3300032005 Bacteria 2097
321 Ga0307415_102447931 3300032126 Bacteria 514
322 Ga0373930_0005205 3300034816 Bacteria 2153
323 Ga0373948_0172715 3300034817 Unclassified 551
324 Ga0373959_0187344 3300034820 Unclassified 541
325 Ga0373938_0117888 3300034957 Bacteria 682
326 Ga0373929_0036037 3300035085 Bacteria 1080
327 Ga0373940_0213726 3300035088 Unclassified 638
328 Ga0373951_0244615 3300035091 Unclassified 537
329 Ga0373932_0325714 3300035112 Bacteria 579
330 Ga0373939_0310794 3300035114 Bacteria 631
331 Ga0373960_0045074 3300035121 Bacteria 1290
332 Ga0373931_0054269 3300035691 Bacteria 2141
333 Ga0373931_0100595 3300035691 Bacteria 1625
334 Ga0373937_1980486 3300036401 Unclassified 529
335 Ga0395899_0281656 3300037312 Bacteria 1131
336 Ga0395898_1310370 3300037466 Unclassified 653
337 Ga0439462_0103042 3300042015 Bacteria 787
338 Ga0439446_0154699 3300042156 Bacteria 756
339 Ga0466963_1155152 3300044694 Bacteria 544
340 Ga0466960_0046420 3300044901 Unclassified 2080
341 Ga0451576_0585444 3300045051 Bacteria 1173
342 Ga0451576_0591467 3300045051 Unclassified 1166
343 Ga0451576_1379386 3300045051 Unclassified 734
344 Ga0495663_0384312 3300046525 Bacteria 515
345 Ga0495633_0437019 3300046558 Bacteria 591
346 Ga0495669_0172986 3300046684 Bacteria 1028
347 Ga0496102_0037848 3300048905 Bacteria 4352
348 Ga0496102_0110097 3300048905 Bacteria 2567
349 Ga0496106_0418949 3300048909 Bacteria 1076
350 Ga0496107_0103508 3300048910 Bacteria 2089
351 Ga0496110_0550191 3300048913 Bacteria 1049
352 Ga0496112_0158837 3300048915 Bacteria 2227
353 Ga0501291_157778 3300049514 Unclassified 516
354 Ga0501292_107922 3300049515 Unclassified 558
355 Ga0501198_002107 3300049649 Bacteria 2649
356 Ga0501198_096375 3300049649 Unclassified 594
357 Ga0501217_002060 3300049661 Bacteria 3893
358 Ga0501217_132377 3300049661 Unclassified 732
359 Ga0501223_016323 3300049663 Unclassified 1467
360 Ga0501224_069659 3300049664 Unclassified 555
361 Ga0501240_005610 3300049673 Bacteria 1510
362 Ga0501251_034044 3300049681 Unclassified 741
363 Ga0501253_005986 3300049683 Bacteria 1625
364 Ga0501260_011720 3300049689 Unclassified 890
365 Ga0501261_030221 3300049690 Unclassified 817
366 Ga0501225_0141522 3300049705 Unclassified 727
367 Ga0501241_070945 3300049758 Bacteria 712
368 Ga0501241_099607 3300049758 Unclassified 625
369 Ga0501272_015632 3300049769 Unclassified 885
370 Ga0501274_032633 3300049771 Unclassified 595
371 Ga0501212_069479 3300049851 Unclassified 621
372 nmdc:mga05p37_1209212_c1 3300050507 Unclassified 780
373 nmdc:mga09592_1484629_c1 3300050508 Unclassified 552
374 nmdc:mga06r32_1147548_c1 3300050510 Unclassified 725
375 nmdc:mga08y16_268088_c1 3300050511 Bacteria 1763
376 nmdc:mga08y16_43097_c1 3300050511 Bacteria 4728
377 nmdc:mga0n895_1026107_c1 3300050512 Bacteria 805
378 nmdc:mga0n895_2078542_c1 3300050512 Bacteria 525
379 nmdc:mga0n895_211238_c1 3300050512 Bacteria 1971
380 nmdc:mga0n895_855127_c1 3300050512 Bacteria 897
381 nmdc:mga0rr50_53745_c1 3300050513 Bacteria 2997
382 nmdc:mga0a205_186727_c1 3300050515 Bacteria 1965
383 nmdc:mga0a205_205864_c1 3300050515 Bacteria 1857
384 nmdc:mga0a205_51829_c1 3300050515 Bacteria 3962
385 nmdc:mga0a205_62737_c1 3300050515 Bacteria 3590
386 nmdc:mga0a205_72297_c1 3300050515 Bacteria 3332
387 nmdc:mga0a205_753409_c1 3300050515 Bacteria 822
388 nmdc:mga0a205_86523_c1 3300050515 Unclassified 3027
389 Ga0587075_103835 3300059644 Bacteria 570
390 Ga0068863_100633562
391 SwRhRL2b_contig_1185725
392 SwRhRL2b_contig_1339468
393 CNBas_1001547
394 Ga0065704_10129347
395 Ga0065704_10475107
396 Ga0065712_10030225
397 Ga0065715_10176998
398 Ga0065707_10012045
399 Ga0070676_10003275
400 Ga0070690_100002131
401 Ga0070670_100096623
402 Ga0070670_100687858
403 Ga0068869_100232013
404 Ga0068869_100426866
405 Ga0068869_100938187
406 Ga0070666_10050650
407 Ga0070666_10966223
408 Ga0070680_100316011
409 Ga0070682_100189634
410 Ga0068868_100029456
411 Ga0070660_100873817
412 Ga0070689_100274407
413 Ga0070689_100722585
414 Ga0070691_10051029
415 Ga0070687_100237672
416 Ga0070687_101230956
417 Ga0070661_100150557
418 Ga0070692_10300886
419 Ga0070668_100164859
420 Ga0070668_101846674
421 Ga0070669_100012050
422 Ga0070669_100018581
423 Ga0070669_100357534
424 Ga0070674_100558172
425 Ga0070673_100198542
426 Ga0070673_101082646
427 Ga0070673_102003411
428 Ga0070673_102383216
429 Ga0070688_101559397
430 Ga0070659_100188437
431 Ga0070659_100635190
432 Ga0070667_100905163
433 Ga0070701_10027365
434 Ga0070701_10129501
435 Ga0070701_10954149
436 Ga0070700_100005512
437 Ga0070700_100057921
438 Ga0070700_100072334
439 Ga0070694_100059861
440 Ga0070694_100349225
441 Ga0070694_100367290
442 Ga0070694_100370140
443 Ga0070694_100708881
444 Ga0070662_100006011
445 Ga0070662_100102420
446 Ga0070681_11277780
447 Ga0068867_100029611
448 Ga0068867_100435101
449 Ga0068867_102249721
450 Ga0070685_10073263
451 Ga0070685_10335515
452 Ga0070706_100000023
453 Ga0070706_101817372
454 Ga0070707_100013235
455 Ga0070698_100000010
456 Ga0070698_100002192
457 Ga0070698_100048427
458 Ga0070698_100331384
459 Ga0070699_100192951
460 Ga0070699_100613168
461 Ga0070699_100634870
462 Ga0070679_100175346
463 Ga0070679_100197520
464 Ga0070684_100534159
465 Ga0070697_100034749
466 Ga0070672_100004782
467 Ga0070672_100324067
468 Ga0070695_100493145
469 Ga0070695_101097853
470 Ga0070696_100040632
471 Ga0070665_100063614
472 Ga0070704_100117577
473 Ga0070704_100172880
474 Ga0068855_100887932
475 Ga0068855_101290340
476 Ga0068857_100303362
477 Ga0068857_100517184
478 Ga0068857_100909361
479 Ga0068857_101772664
480 Ga0068854_100018396
481 Ga0068854_100983089
482 Ga0068856_100015347
483 Ga0070702_100093960
484 Ga0070702_100531686
485 Ga0068859_100212017
486 Ga0068859_100319977
487 Ga0068859_100529207
488 Ga0068859_100577432
489 Ga0068864_100000166
490 Ga0068864_100016354
491 Ga0068864_100249659
492 Ga0068864_100388237
493 Ga0068864_100496333
494 Ga0068864_100975816
495 Ga0068866_10007009
496 Ga0068866_10014509
497 Ga0068861_100154762
498 Ga0068861_100561720
499 Ga0068861_101469969
500 Ga0068870_10044191
501 Ga0068870_10153793
502 Ga0068870_10752041
503 Ga0068870_11156684
504 Ga0068863_100762906
505 Ga0068863_101580027
506 Ga0068858_100000173
507 Ga0068858_100345069
508 Ga0068858_101056628
509 Ga0068860_100014669
510 Ga0068860_100384522
511 Ga0068860_100546268
512 Ga0068862_100017832
513 Ga0068862_100081643
514 Ga0068862_100236605
515 Ga0068862_100351467
516 Ga0068862_101775755
517 Ga0070712_100586335
518 Ga0097621_100018894
519 Ga0068871_101570082
520 Ga0075428_101281665
521 Ga0075433_10097669
522 Ga0075433_10187974
523 Ga0075433_10192448
524 Ga0075433_10395542
525 Ga0075434_100066336
526 Ga0075434_100418559
527 Ga0097620_100212019
528 Ga0097620_100319940
529 Ga0097620_100327838
530 Ga0097620_100529205
531 Ga0097620_100577325
532 Ga0075435_100007411
533 Ga0105240_10424111
534 Ga0105240_10643207
535 Ga0111539_10119891
536 Ga0111539_11079550
537 Ga0105245_10169156
538 Ga0105245_11065974
539 Ga0105245_12906810
540 Ga0105247_10027564
541 Ga0114129_10892423
542 Ga0114129_11395995
543 Ga0114129_11494491
544 Ga0105243_10066646
545 Ga0105243_10297930
546 Ga0105243_10892282
547 Ga0105243_11604241
548 Ga0105243_12651220
549 Ga0105241_10038052
550 Ga0105241_10130607
551 Ga0105241_11061747
552 Ga0105242_10417325
553 Ga0105248_10004294
554 Ga0105237_10815792
555 Ga0105237_10847624
556 Ga0105238_10125253
557 Ga0105238_11012209
558 Ga0105249_10011574
559 Ga0105249_10020137
560 Ga0105249_10104168
561 Ga0105249_11071495
562 Ga0105239_10083648
563 Ga0105239_10292322
564 Ga0105239_10320994
565 Ga0105239_10700225
566 Ga0105239_11437568
567 Ga0105246_10032546
568 Ga0105246_11178952
569 Ga0105246_11271147
570 Ga0157373_10043949
571 Ga0157373_10046508
572 Ga0157373_10836844
573 Ga0157371_10015905
574 Ga0157370_10535011
575 Ga0157369_10048322
576 Ga0157374_10014783
577 Ga0157378_10058850
578 Ga0157378_10074169
579 Ga0157378_10077836
580 Ga0157378_10670681
581 Ga0157378_11651497
582 Ga0157378_12158465
583 Ga0163162_10241964
584 Ga0163162_10887353
585 Ga0163162_10888736
586 Ga0157372_10098734
587 Ga0157372_12624378
588 Ga0157375_10001126
589 Ga0157375_10144248
590 Ga0157375_11003728
591 Ga0157375_11516636
592 Ga0157375_12955621
593 Ga0163163_10005487
594 Ga0163163_10140384
595 Ga0163163_10777326
596 Ga0163163_11299722
597 Ga0157380_10003355
598 Ga0157380_10307070
599 Ga0157380_12106204
600 Ga0157377_10048621
601 Ga0157377_11424262
602 Ga0157376_10178261
603 Ga0207642_10182631
604 Ga0207642_10194474
605 Ga0207710_10237851
606 Ga0207680_10072267
607 Ga0207680_11182080
608 Ga0207647_10390865
609 Ga0207645_10004345
610 Ga0207643_10010235
611 Ga0207684_10000146
612 Ga0207654_10005612
613 Ga0207654_10032934
614 Ga0207654_10465379
615 Ga0207707_10016277
616 Ga0207707_10417840
617 Ga0207695_10095381
618 Ga0207671_10128025
619 Ga0207660_10071400
620 Ga0207662_10091452
621 Ga0207657_10004787
622 Ga0207646_10014734
623 Ga0207681_10090417
624 Ga0207681_10816676
625 Ga0207681_10998242
626 Ga0207650_10021726
627 Ga0207650_10139569
628 Ga0207650_10468844
629 Ga0207650_10522751
630 Ga0207650_10531229
631 Ga0207650_11404645
632 Ga0207659_10263599
633 Ga0207687_10027290
634 Ga0207687_11485909
635 Ga0207687_11897499
636 Ga0207690_10093188
637 Ga0207690_10727020
638 Ga0207706_10003234
639 Ga0207706_10152982
640 Ga0207686_10025073
641 Ga0207686_10191439
642 Ga0207709_11261296
643 Ga0207670_10000557
644 Ga0207670_10132104
645 Ga0207670_10148441
646 Ga0207670_10167369
647 Ga0207670_10435047
648 Ga0207669_10589876
649 Ga0207704_10270620
650 Ga0207665_10426716
651 Ga0207691_10000675
652 Ga0207691_10564284
653 Ga0207691_10748163
654 Ga0207711_10011528
655 Ga0207711_11364879
656 Ga0207689_10056597
657 Ga0207689_10152830
658 Ga0207689_10168427
659 Ga0207689_10642770
660 Ga0207689_11051890
661 Ga0207689_11723975
662 Ga0207689_11834350
663 Ga0207661_10148383
664 Ga0207661_10423882
665 Ga0207667_10004050
666 Ga0207651_11108131
667 Ga0207712_10007284
668 Ga0207712_10213631
669 Ga0207712_11200617
670 Ga0207668_10943343
671 Ga0207640_10002588
672 Ga0207640_11227548
673 Ga0207677_10024051
674 Ga0207703_10000211
675 Ga0207703_10074934
676 Ga0207678_10000388
677 Ga0207708_10010871
678 Ga0207708_10212807
679 Ga0207708_10295448
680 Ga0207702_10997822
681 Ga0207641_10029385
682 Ga0207641_10242211
683 Ga0207641_10587368
684 Ga0207641_10866757
685 Ga0207641_11939243
686 Ga0207648_10013795
687 Ga0207648_10449563
688 Ga0207648_11596671
689 Ga0207676_10000136
690 Ga0207676_10052562
691 Ga0207676_10297036
692 Ga0207676_10389824
693 Ga0207674_10087199
694 Ga0207674_10357956
695 Ga0207674_10759260
696 Ga0207674_10838237
697 Ga0207674_11573898
698 Ga0207675_100013698
699 Ga0207675_100282639
700 Ga0207675_100361632
701 Ga0207675_101551848
702 Ga0207428_10412964
703 Ga0268266_10173524
704 Ga0268265_10021019
705 Ga0268265_10322088
706 Ga0268265_10923315
707 Ga0268264_10377091
708 Ga0268264_10717094
709 Ga0307411_10094403
710 Ga0307415_102447931
711 Ga0373930_0005205
712 Ga0373948_0172715
713 Ga0373959_0187344
714 Ga0373938_0117888
715 Ga0373929_0036037
716 Ga0373940_0213726
717 Ga0373951_0244615
718 Ga0373932_0325714
719 Ga0373939_0310794
720 Ga0373960_0045074
721 Ga0373931_0054269
722 Ga0373931_0100595
723 Ga0373937_1980486
724 Ga0395899_0281656
725 Ga0395898_1310370
726 Ga0439462_0103042
727 Ga0439446_0154699
728 Ga0466963_1155152
729 Ga0466960_0046420
730 Ga0451576_0585444
731 Ga0451576_0591467
732 Ga0451576_1379386
733 Ga0495663_0384312
734 Ga0495633_0437019
735 Ga0495669_0172986
736 Ga0496102_0037848
737 Ga0496102_0110097
738 Ga0496106_0418949
739 Ga0496107_0103508
740 Ga0496110_0550191
741 Ga0496112_0158837
742 Ga0501291_157778
743 Ga0501292_107922
744 Ga0501198_002107
745 Ga0501198_096375
746 Ga0501217_002060
747 Ga0501217_132377
748 Ga0501223_016323
749 Ga0501224_069659
750 Ga0501240_005610
751 Ga0501251_034044
752 Ga0501253_005986
753 Ga0501260_011720
754 Ga0501261_030221
755 Ga0501225_0141522
756 Ga0501241_070945
757 Ga0501241_099607
758 Ga0501272_015632
759 Ga0501274_032633
760 Ga0501212_069479
761 nmdc:mga05p37_1209212_c1
762 nmdc:mga09592_1484629_c1
763 nmdc:mga06r32_1147548_c1
764 nmdc:mga08y16_268088_c1
765 nmdc:mga08y16_43097_c1
766 nmdc:mga0n895_1026107_c1
767 nmdc:mga0n895_2078542_c1
768 nmdc:mga0n895_211238_c1
769 nmdc:mga0n895_855127_c1
770 nmdc:mga0rr50_53745_c1
771 nmdc:mga0a205_186727_c1
772 nmdc:mga0a205_205864_c1
773 nmdc:mga0a205_51829_c1
774 nmdc:mga0a205_62737_c1
775 nmdc:mga0a205_72297_c1
776 nmdc:mga0a205_753409_c1
777 nmdc:mga0a205_86523_c1
778 Ga0587075_103835

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

1

86

0.92

PF08534

Redoxin

Redoxin

2

102

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pwj-assembly2.cif.gz_B structure of a mitochondrial type ii peroxiredoxin from pisum sativum 0.6304 9 92
4g2e-assembly1.cif.gz_A-2 crystal structure of a dimeric prxq from sulfolobus tokodaii 0.6115 9 98
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.6114 9 97
5k2j-assembly6.cif.gz_K crystal structure of reduced prx3 in complex with h2o2 from vibrio vulnificus 0.6066 9 93
5k1g-assembly1.cif.gz_A-2 crystal structure of reduced prx3 from vibrio vulnificus 0.6021 9 95
ID Description Score Start End Superfamily
af_Q9D1A0_27_140_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8142 9 46 3.40.30.10
af_Q54RI1_448_597_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6649 2 46 3.40.30.10
af_Q5A7P9_48_194_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6348 11 73 3.40.30.10
af_Q9ZUU2_69_247_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6345 2 47 3.40.30.10
af_Q2WEN9_319_424_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.617 51 74 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7J4FYL8-F1-model_v4 Redoxin domain-containing protein 0.9259 9 45 GO:0016209
GO:0016491
AF-A0A2D5NI53-F1-model_v4 deleted 0.9117 7 46
AF-A0A2E8WE26-F1-model_v4 Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant domain-containing protein 0.906 7 48 GO:0016209
GO:0016491
AF-A0A838F5H2-F1-model_v4 Redoxin domain-containing protein 0.9028 9 45 GO:0016209
GO:0016491
AF-A0A538KDD3-F1-model_v4 Redoxin domain-containing protein 0.8777 7 46

Map