F431356

General Info

Members Datasets Scaffolds Average Seq Length
389 178 389 372

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100179049|Ga0070665_1001790492
Length 404
Sequence MSDLETFPTAAVTARASTYRVTCLTPTLVGDGYKLSPIDYMVWRDQVNVLDQTRIFKLLAKGPRLDSYLTQIKKATKLDFASWGGFAQNYAGRRIPFESAASSKYWERAATEQLAIPTFASGASGPYLPAAAIKGALRTGLLFGSIKDNTMRSIAERVTGDRPMRHPGSAVEDQLVGVSGSDRMRLFSAGDSAPIDTSTFRIYLLRTATLTSRSGKPGATPDTASYALAWKQSPRGSVPRAEDSTPSFAEMADPGTAFQGPWNEKPFFDHQEVRRVLRWDRTLTRRALFNAANKYAAAQLALHRQYAAWAGIEALLNEIGELEEKLRQAEANGACLLSIGWGGGFVGKSAAPDTTGEDSRKILGAQPFYQRAIQSGLPFPKTRRVVFTGDRPSTLPGWVYLEVA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
98 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
101 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
111 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
176 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 0.77
Rhizosphere 96.92
Stem 0
Stem Tuber 0
Unclassified 2.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10003165 3300005327 Bacteria 13592
2 Ga0070658_10124826 3300005327 Unclassified 2142
3 Ga0070683_100000137 3300005329 Bacteria 47423
4 Ga0070683_100003054 3300005329 Bacteria 13466
5 Ga0070683_100055177 3300005329 Bacteria 3686
6 Ga0070683_100066975 3300005329 Unclassified 3344
7 Ga0070690_100061512 3300005330 Bacteria 2419
8 Ga0070670_100167929 3300005331 Bacteria 1903
9 Ga0068869_100094378 3300005334 Bacteria 2255
10 Ga0070666_10012638 3300005335 Bacteria 5333
11 Ga0070680_100020882 3300005336 Bacteria 5199
12 Ga0070680_100129853 3300005336 Bacteria 2108
13 Ga0068868_100003385 3300005338 Bacteria 11095
14 Ga0070660_100053045 3300005339 Unclassified 3127
15 Ga0070689_100202771 3300005340 Unclassified 1620
16 Ga0070691_10007443 3300005341 Bacteria 5017
17 Ga0070675_100297087 3300005354 Bacteria 1422
18 Ga0070667_100027308 3300005367 Bacteria 4749
19 Ga0070709_10086901 3300005434 Unclassified 2053
20 Ga0070714_100026980 3300005435 Unclassified 4752
21 Ga0070713_100003823 3300005436 Bacteria 9967
22 Ga0070713_100030486 3300005436 Bacteria 4284
23 Ga0070662_100057334 3300005457 Bacteria 2831
24 Ga0070681_10019992 3300005458 Bacteria 6708
25 Ga0070681_10105088 3300005458 Unclassified 2766
26 Ga0070681_10109158 3300005458 Bacteria 2707
27 Ga0070681_10151504 3300005458 Bacteria 2245
28 Ga0070679_100002635 3300005530 Bacteria 16322
29 Ga0070679_100116561 3300005530 Bacteria 2656
30 Ga0070679_100191338 3300005530 Bacteria 2015
31 Ga0070679_100191948 3300005530 Bacteria 2011
32 Ga0070684_100000899 3300005535 Bacteria 21053
33 Ga0070684_100001036 3300005535 Bacteria 19847
34 Ga0070684_100017919 3300005535 Bacteria 5821
35 Ga0070684_100026226 3300005535 Bacteria 4907
36 Ga0070684_100039843 3300005535 Unclassified 4043
37 Ga0070684_100118269 3300005535 Unclassified 2382
38 Ga0068853_100049785 3300005539 Unclassified 3602
39 Ga0070693_100031058 3300005547 Bacteria 2925
40 Ga0070665_100008755 3300005548 Bacteria 10244
41 Ga0070665_100179049 3300005548 Bacteria 2121
42 Ga0070665_100355902 3300005548 Bacteria 1470
43 Ga0068855_100001548 3300005563 Bacteria 28938
44 Ga0068855_100006192 3300005563 Bacteria 14588
45 Ga0068855_100007949 3300005563 Bacteria 12814
46 Ga0068855_100068162 3300005563 Bacteria 4142
47 Ga0068855_100091651 3300005563 Unclassified 3505
48 Ga0068855_100098109 3300005563 Bacteria 3375
49 Ga0068855_100138670 3300005563 Unclassified 2774
50 Ga0068855_100184985 3300005563 Bacteria 2354
51 Ga0068857_100002269 3300005577 Bacteria 15632
52 Ga0068857_100012995 3300005577 Bacteria 7255
53 Ga0068856_100011785 3300005614 Bacteria 8478
54 Ga0068856_100028630 3300005614 Bacteria 5442
55 Ga0068852_100110897 3300005616 Bacteria 2494
56 Ga0068859_100127581 3300005617 Unclassified 2614
57 Ga0068859_100152248 3300005617 Bacteria 2388
58 Ga0068864_100101441 3300005618 Unclassified 2553
59 Ga0068864_100127511 3300005618 Bacteria 2282
60 Ga0068870_10117342 3300005840 Bacteria 1528
61 Ga0068863_100029809 3300005841 Bacteria 5210
62 Ga0068863_100030915 3300005841 Bacteria 5114
63 Ga0068863_100155842 3300005841 Bacteria 2187
64 Ga0068858_100003289 3300005842 Bacteria 16097
65 Ga0068858_100005450 3300005842 Bacteria 12456
66 Ga0068858_100044635 3300005842 Unclassified 4107
67 Ga0068860_100015158 3300005843 Bacteria 7530
68 Ga0081539_10047153 3300005985 Unclassified 2464
69 Ga0070717_10012119 3300006028 Bacteria 6571
70 Ga0070717_10065940 3300006028 Unclassified 3010
71 Ga0070717_10104464 3300006028 Bacteria 2410
72 Ga0097621_100050841 3300006237 Bacteria 3371
73 Ga0097621_100236834 3300006237 Bacteria 1595
74 Ga0068871_100031865 3300006358 Unclassified 4160
75 Ga0068871_100033807 3300006358 Unclassified 4051
76 Ga0068871_100036457 3300006358 Bacteria 3916
77 Ga0068871_100092301 3300006358 Bacteria 2525
78 Ga0097620_100127584 3300006931 Unclassified 2614
79 Ga0097620_100152248 3300006931 Bacteria 2388
80 Ga0105240_10000651 3300009093 Bacteria 64114
81 Ga0105240_10003336 3300009093 Bacteria 24993
82 Ga0105240_10004172 3300009093 Bacteria 22151
83 Ga0105240_10005788 3300009093 Bacteria 18336
84 Ga0105240_10007579 3300009093 Bacteria 15723
85 Ga0105240_10034438 3300009093 Bacteria 6532
86 Ga0105240_10043843 3300009093 Bacteria 5688
87 Ga0105240_10061377 3300009093 Bacteria 4684
88 Ga0105240_10074075 3300009093 Unclassified 4204
89 Ga0105240_10093169 3300009093 Bacteria 3677
90 Ga0105240_10129786 3300009093 Unclassified 3024
91 Ga0105240_10174390 3300009093 Unclassified 2543
92 Ga0111539_10306542 3300009094 Bacteria 1848
93 Ga0105245_10015442 3300009098 Bacteria 6657
94 Ga0105245_10016312 3300009098 Bacteria 6477
95 Ga0105245_10018200 3300009098 Bacteria 6143
96 Ga0105245_10021302 3300009098 Bacteria 5684
97 Ga0105245_10025267 3300009098 Bacteria 5222
98 Ga0105245_10063227 3300009098 Unclassified 3341
99 Ga0105245_10094173 3300009098 Bacteria 2761
100 Ga0105245_10245932 3300009098 Unclassified 1736
101 Ga0105247_10081732 3300009101 Bacteria 2038
102 Ga0105241_10008615 3300009174 Bacteria 7495
103 Ga0105241_10110889 3300009174 Bacteria 2195
104 Ga0105241_10137400 3300009174 Unclassified 1986
105 Ga0105242_10014587 3300009176 Bacteria 6083
106 Ga0105242_10043160 3300009176 Bacteria 3647
107 Ga0105242_10089541 3300009176 Bacteria 2587
108 Ga0105242_10110810 3300009176 Unclassified 2339
109 Ga0105242_10194971 3300009176 Bacteria 1796
110 Ga0105248_10009985 3300009177 Bacteria 10451
111 Ga0105248_10011881 3300009177 Bacteria 9607
112 Ga0105248_10013591 3300009177 Bacteria 8962
113 Ga0105248_10053088 3300009177 Bacteria 4548
114 Ga0105248_10104651 3300009177 Unclassified 3191
115 Ga0105248_10163169 3300009177 Unclassified 2512
116 Ga0105248_10167787 3300009177 Unclassified 2474
117 Ga0105237_10001745 3300009545 Bacteria 28090
118 Ga0105237_10020803 3300009545 Bacteria 6758
119 Ga0105237_10026222 3300009545 Bacteria 5957
120 Ga0105237_10136636 3300009545 Bacteria 2446
121 Ga0105238_10002267 3300009551 Bacteria 19371
122 Ga0105238_10004308 3300009551 Bacteria 14118
123 Ga0105238_10005668 3300009551 Bacteria 12343
124 Ga0105238_10015535 3300009551 Bacteria 7709
125 Ga0105238_10054542 3300009551 Bacteria 4014
126 Ga0105238_10081878 3300009551 Bacteria 3218
127 Ga0105249_10033810 3300009553 Bacteria 4631
128 Ga0105249_10223543 3300009553 Unclassified 1854
129 Ga0105239_10005269 3300010375 Bacteria 15204
130 Ga0105239_10025779 3300010375 Bacteria 6474
131 Ga0105239_10041145 3300010375 Bacteria 5064
132 Ga0105239_10238885 3300010375 Bacteria 2039
133 Ga0105239_10417695 3300010375 Bacteria 1519
134 Ga0105246_10131066 3300011119 Bacteria 1873
135 Ga0105246_10190681 3300011119 Unclassified 1586
136 Ga0157371_10058349 3300013102 Unclassified 2738
137 Ga0157371_10247169 3300013102 Bacteria 1284
138 Ga0157370_10004190 3300013104 Bacteria 16686
139 Ga0157370_10005656 3300013104 Bacteria 13973
140 Ga0157370_10026396 3300013104 Bacteria 5736
141 Ga0157370_10213063 3300013104 Bacteria 1790
142 Ga0157369_10005839 3300013105 Bacteria 14307
143 Ga0157369_10009438 3300013105 Bacteria 11154
144 Ga0157369_10010656 3300013105 Bacteria 10464
145 Ga0157369_10171981 3300013105 Unclassified 2282
146 Ga0157374_10006059 3300013296 Bacteria 10235
147 Ga0157374_10049698 3300013296 Bacteria 3896
148 Ga0157374_10120583 3300013296 Bacteria 2531
149 Ga0157374_10343374 3300013296 Bacteria 1482
150 Ga0157378_10014423 3300013297 Bacteria 6919
151 Ga0163162_10015993 3300013306 Bacteria 7333
152 Ga0163162_10337049 3300013306 Bacteria 1640
153 Ga0157372_10013955 3300013307 Bacteria 8584
154 Ga0157372_10039605 3300013307 Bacteria 5201
155 Ga0157372_10102343 3300013307 Bacteria 3272
156 Ga0157375_10003180 3300013308 Bacteria 14268
157 Ga0157375_10202021 3300013308 Bacteria 2144
158 Ga0163163_10015983 3300014325 Bacteria 6955
159 Ga0163163_10024938 3300014325 Bacteria 5694
160 Ga0163163_10031168 3300014325 Bacteria 5145
161 Ga0163163_10246489 3300014325 Bacteria 1837
162 Ga0163163_10270514 3300014325 Archaea 1750
163 Ga0213875_10017731 3300021388 Unclassified 3435
164 Ga0213875_10038749 3300021388 Bacteria 2245
165 Ga0207680_10005305 3300025903 Bacteria 6154
166 Ga0207654_10089210 3300025911 Unclassified 1875
167 Ga0207707_10001544 3300025912 Bacteria 21199
168 Ga0207707_10014678 3300025912 Bacteria 6826
169 Ga0207707_10094594 3300025912 Bacteria 2611
170 Ga0207695_10000768 3300025913 Bacteria 61199
171 Ga0207695_10001778 3300025913 Bacteria 34036
172 Ga0207695_10023293 3300025913 Bacteria 7002
173 Ga0207695_10027315 3300025913 Bacteria 6358
174 Ga0207695_10079612 3300025913 Bacteria 3320
175 Ga0207695_10080956 3300025913 Bacteria 3288
176 Ga0207695_10082739 3300025913 Unclassified 3244
177 Ga0207695_10088213 3300025913 Bacteria 3123
178 Ga0207671_10019382 3300025914 Bacteria 5201
179 Ga0207671_10055255 3300025914 Bacteria 2942
180 Ga0207671_10103804 3300025914 Unclassified 2156
181 Ga0207663_10059411 3300025916 Bacteria 2418
182 Ga0207663_10128355 3300025916 Bacteria 1748
183 Ga0207660_10014513 3300025917 Bacteria 5182
184 Ga0207660_10114015 3300025917 Bacteria 2038
185 Ga0207657_10000858 3300025919 Bacteria 32103
186 Ga0207657_10027446 3300025919 Bacteria 5214
187 Ga0207649_10029806 3300025920 Unclassified 3226
188 Ga0207652_10300263 3300025921 Bacteria 1449
189 Ga0207694_10001566 3300025924 Bacteria 19383
190 Ga0207694_10005586 3300025924 Bacteria 9640
191 Ga0207694_10016523 3300025924 Bacteria 5573
192 Ga0207694_10028156 3300025924 Bacteria 4283
193 Ga0207694_10119326 3300025924 Bacteria 2105
194 Ga0207694_10217376 3300025924 Bacteria 1558
195 Ga0207687_10008471 3300025927 Bacteria 6723
196 Ga0207687_10010590 3300025927 Bacteria 6028
197 Ga0207687_10010832 3300025927 Bacteria 5959
198 Ga0207687_10088548 3300025927 Bacteria 2252
199 Ga0207700_10005928 3300025928 Bacteria 7352
200 Ga0207700_10112884 3300025928 Unclassified 2190
201 Ga0207700_10166481 3300025928 Unclassified 1835
202 Ga0207700_10264678 3300025928 Bacteria 1473
203 Ga0207664_10008790 3300025929 Bacteria 7064
204 Ga0207664_10062085 3300025929 Bacteria 2983
205 Ga0207706_10081529 3300025933 Bacteria 2843
206 Ga0207686_10006270 3300025934 Bacteria 6398
207 Ga0207686_10021239 3300025934 Unclassified 3723
208 Ga0207686_10147265 3300025934 Bacteria 1635
209 Ga0207686_10163767 3300025934 Bacteria 1561
210 Ga0207709_10255156 3300025935 Unclassified 1283
211 Ga0207670_10163595 3300025936 Unclassified 1663
212 Ga0207665_10076322 3300025939 Unclassified 2298
213 Ga0207665_10118828 3300025939 Bacteria 1865
214 Ga0207711_10001299 3300025941 Bacteria 23656
215 Ga0207711_10092661 3300025941 Unclassified 2660
216 Ga0207711_10115203 3300025941 Unclassified 2395
217 Ga0207711_10118596 3300025941 Unclassified 2361
218 Ga0207711_10406638 3300025941 Bacteria 1265
219 Ga0207689_10056771 3300025942 Bacteria 3222
220 Ga0207661_10000105 3300025944 Bacteria 53174
221 Ga0207661_10035402 3300025944 Unclassified 3890
222 Ga0207661_10036786 3300025944 Unclassified 3824
223 Ga0207667_10000367 3300025949 Bacteria 60946
224 Ga0207667_10000368 3300025949 Bacteria 60870
225 Ga0207667_10004819 3300025949 Bacteria 16501
226 Ga0207667_10019558 3300025949 Bacteria 7556
227 Ga0207667_10027938 3300025949 Bacteria 6131
228 Ga0207667_10081318 3300025949 Bacteria 3356
229 Ga0207667_10103141 3300025949 Unclassified 2942
230 Ga0207712_10017603 3300025961 Bacteria 4644
231 Ga0207658_10099857 3300025986 Unclassified 2271
232 Ga0207703_10003892 3300026035 Bacteria 12396
233 Ga0207703_10025920 3300026035 Bacteria 4614
234 Ga0207703_10065833 3300026035 Unclassified 2979
235 Ga0207639_10019880 3300026041 Unclassified 4798
236 Ga0207702_10000616 3300026078 Bacteria 39200
237 Ga0207702_10009870 3300026078 Bacteria 8001
238 Ga0207702_10037991 3300026078 Bacteria 4032
239 Ga0207702_10122476 3300026078 Bacteria 2329
240 Ga0207641_10006040 3300026088 Bacteria 10262
241 Ga0207641_10061565 3300026088 Unclassified 3201
242 Ga0207641_10231222 3300026088 Bacteria 1718
243 Ga0207648_10005760 3300026089 Bacteria 12416
244 Ga0207676_10084268 3300026095 Bacteria 2591
245 Ga0207676_10104194 3300026095 Unclassified 2359
246 Ga0207674_10000072 3300026116 Bacteria 105507
247 Ga0207674_10017375 3300026116 Bacteria 7850
248 Ga0207674_10024656 3300026116 Bacteria 6423
249 Ga0207674_10025948 3300026116 Bacteria 6236
250 Ga0207674_10091043 3300026116 Bacteria 3041
251 Ga0207683_10135787 3300026121 Bacteria 2214
252 Ga0207698_10026225 3300026142 Unclassified 4119
253 Ga0207698_10034337 3300026142 Bacteria 3696
254 Ga0268266_10021693 3300028379 Bacteria 5472
255 Ga0268264_10004756 3300028381 Bacteria 11526
256 Ga0268264_10384147 3300028381 Unclassified 1345
257 Ga0265323_10001175 3300028653 Bacteria 13374
258 Ga0265336_10032303 3300028666 Bacteria 1624
259 Ga0265338_10019100 3300028800 Bacteria 7295
260 Ga0265338_10103889 3300028800 Bacteria 2307
261 Ga0265332_10046554 3300031238 Bacteria 1867
262 Ga0265332_10093652 3300031238 Bacteria 1269
263 Ga0265320_10018891 3300031240 Bacteria 3782
264 Ga0265325_10004900 3300031241 Bacteria 8362
265 Ga0265339_10021058 3300031249 Bacteria 3802
266 Ga0265331_10013628 3300031250 Bacteria 4364
267 Ga0265331_10036823 3300031250 Bacteria 2400
268 Ga0265331_10121593 3300031250 Bacteria 1194
269 Ga0265316_10001734 3300031344 Bacteria 23126
270 Ga0265316_10003410 3300031344 Bacteria 16079
271 Ga0265316_10044410 3300031344 Bacteria 3535
272 Ga0265316_10057498 3300031344 Unclassified 3032
273 Ga0265316_10060827 3300031344 Unclassified 2935
274 Ga0265316_10071978 3300031344 Unclassified 2664
275 Ga0265316_10102209 3300031344 Unclassified 2177
276 Ga0265313_10002739 3300031595 Bacteria 14877
277 Ga0265314_10002749 3300031711 Bacteria 17571
278 Ga0265314_10012068 3300031711 Bacteria 7080
279 Ga0265342_10013718 3300031712 Bacteria 5417
280 Ga0265342_10018691 3300031712 Bacteria 4481
281 Ga0307414_10399703 3300032004 Unclassified 1193
282 Ga0373934_0020957 3300035086 Bacteria 2516
283 Ga0373923_0003325 3300035111 Bacteria 5134
284 Ga0373923_0038598 3300035111 Bacteria 1958
285 Ga0373954_0001445 3300035118 Bacteria 9653
286 Ga0373954_0022168 3300035118 Bacteria 2878
287 Ga0373956_0007996 3300035119 Bacteria 4275
288 Ga0373956_0018233 3300035119 Bacteria 2970
289 Ga0373943_0125195 3300035170 Bacteria 1370
290 Ga0373955_0013824 3300035172 Bacteria 3916
291 Ga0373955_0014221 3300035172 Unclassified 3866
292 Ga0373955_0017093 3300035172 Bacteria 3583
293 Ga0373955_0114787 3300035172 Bacteria 1560
294 Ga0373935_0040736 3300035692 Unclassified 2916
295 Ga0373927_0003146 3300035695 Bacteria 11925
296 Ga0373927_0003324 3300035695 Bacteria 11571
297 Ga0373933_0030543 3300035724 Unclassified 3120
298 Ga0373933_0142118 3300035724 Unclassified 1516
299 Ga0373947_0010809 3300035725 Bacteria 5238
300 Ga0373947_0032145 3300035725 Unclassified 3091
301 Ga0373947_0098888 3300035725 Unclassified 1831
302 Ga0373937_0010730 3300036401 Bacteria 8013
303 Ga0373937_0053624 3300036401 Bacteria 3698
304 Ga0373937_0068809 3300036401 Bacteria 3264
305 Ga0373937_0284318 3300036401 Bacteria 1562
306 Ga0373925_0084262 3300037068 Bacteria 2422
307 Ga0436364_0060658 3300037853 Unclassified 2388
308 Ga0436364_0333119 3300037853 Bacteria 2503
309 Ga0436364_0557673 3300037853 Bacteria 2835
310 Ga0436364_0611476 3300037853 Bacteria 1848
311 Ga0436364_0869193 3300037853 Bacteria 3542
312 Ga0436365_0576096 3300039437 Bacteria 4513
313 Ga0436362_0939924 3300039453 Bacteria 6786
314 Ga0451576_0379817 3300045051 Bacteria 1481
315 Ga0495592_0057591 3300046454 Unclassified 2868
316 Ga0495629_0095757 3300046459 Bacteria 2071
317 Ga0495651_0080353 3300046462 Unclassified 2463
318 Ga0495651_0199024 3300046462 Unclassified 1403
319 Ga0495653_0120614 3300046463 Bacteria 1870
320 Ga0495580_0004526 3300046472 Bacteria 11674
321 Ga0495580_0007134 3300046472 Bacteria 9000
322 Ga0495580_0040419 3300046472 Unclassified 3331
323 Ga0495580_0084625 3300046472 Bacteria 2209
324 Ga0495662_0024609 3300046476 Unclassified 2905
325 Ga0495608_0050234 3300046511 Bacteria 2767
326 Ga0495618_0032230 3300046514 Unclassified 3282
327 Ga0495628_0054974 3300046516 Unclassified 3136
328 Ga0495628_0310390 3300046516 Unclassified 1166
329 Ga0495652_0049466 3300046529 Unclassified 3598
330 Ga0495665_0159801 3300046531 Bacteria 1175
331 Ga0495586_0164560 3300046535 Bacteria 1252
332 Ga0495587_0005962 3300046536 Bacteria 7944
333 Ga0495587_0141743 3300046536 Unclassified 1372
334 Ga0495645_0002427 3300046543 Bacteria 12659
335 Ga0495645_0028869 3300046543 Bacteria 4032
336 Ga0495645_0051518 3300046543 Bacteria 2995
337 Ga0495645_0149819 3300046543 Unclassified 1622
338 Ga0495667_0018657 3300046559 Bacteria 4685
339 Ga0495667_0030051 3300046559 Bacteria 3654
340 Ga0495599_0007048 3300046678 Bacteria 6800
341 Ga0495599_0010035 3300046678 Bacteria 5797
342 Ga0495613_0102930 3300046689 Bacteria 2062
343 Ga0495604_0036062 3300047317 Bacteria 3901
344 Ga0495604_0065666 3300047317 Unclassified 2762
345 Ga0495636_0023050 3300047318 Bacteria 2519
346 Ga0495674_0015176 3300047319 Bacteria 7205
347 Ga0495674_0025759 3300047319 Bacteria 5387
348 Ga0495674_0038933 3300047319 Bacteria 4263
349 Ga0495674_0141504 3300047319 Unclassified 2022
350 Ga0495675_0155892 3300047444 Unclassified 1409
351 Ga0495684_0011188 3300047471 Bacteria 6935
352 Ga0495684_0043699 3300047471 Unclassified 3431
353 Ga0495684_0202392 3300047471 Unclassified 1463
354 Ga0495602_0049271 3300048088 Bacteria 3775
355 Ga0495602_0060028 3300048088 Bacteria 3317
356 Ga0495602_0071334 3300048088 Bacteria 2967
357 Ga0495602_0096962 3300048088 Unclassified 2431
358 Ga0496104_0088641 3300048907 Unclassified 2956
359 Ga0496115_0021853 3300048918 Unclassified 4948
360 Ga0496115_0161959 3300048918 Bacteria 1849
361 Ga0501031_0005523 3300049568 Bacteria 8234
362 Ga0501032_0000837 3300049569 Bacteria 25024
363 Ga0501033_0004077 3300049570 Bacteria 11786
364 Ga0501034_0023564 3300049571 Bacteria 6271
365 Ga0501036_0000824 3300049572 Bacteria 22971
366 Ga0501037_0006399 3300049573 Bacteria 8618
367 Ga0501038_0042968 3300049574 Unclassified 3933
368 Ga0501046_0000591 3300049580 Bacteria 35671
369 Ga0501047_0019177 3300049581 Bacteria 6560
370 Ga0501047_0088423 3300049581 Bacteria 2975
371 Ga0501048_0011743 3300049582 Bacteria 6529
372 Ga0501067_0018164 3300049583 Unclassified 3894
373 Ga0501068_0002241 3300049584 Bacteria 10291
374 Ga0501069_0000329 3300049585 Bacteria 21365
375 Ga0501070_0009595 3300049586 Bacteria 8175
376 Ga0501072_0001356 3300049588 Bacteria 18370
377 Ga0501073_0000929 3300049589 Bacteria 21018
378 Ga0501074_0017526 3300049590 Bacteria 5198
379 Ga0501076_0330091 3300049592 Unclassified 1251
380 Ga0501079_0004585 3300049741 Bacteria 10247
381 Ga0501080_0000466 3300049742 Bacteria 31417
382 Ga0501083_0017121 3300049744 Bacteria 5055
383 Ga0501035_0166553 3300049822 Unclassified 1905
384 Ga0501044_0007260 3300049823 Bacteria 12185
385 nmdc:mga08y16_248517_c1 3300050511 Bacteria 1838
386 Ga0495612_0061985 3300053078 Unclassified 1550
387 Ga0500568_0000290 3300053139 Bacteria 41395
388 Ga0501084_0005349 3300054114 Bacteria 10518
389 Ga0501082_0001662 3300060353 Bacteria 19587

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10018200 Ga0105245_1001820010 340
2 3300009098 Ga0105245_10025267 Ga0105245_100252675 340
3 3300009101 Ga0105247_10081732 Ga0105247_100817322 340
4 3300009176 Ga0105242_10014587 Ga0105242_100145871 340
5 3300009177 Ga0105248_10013591 Ga0105248_100135917 340
6 3300009553 Ga0105249_10223543 Ga0105249_102235432 340
7 3300013296 Ga0157374_10006059 Ga0157374_1000605910 340
8 3300013306 Ga0163162_10337049 Ga0163162_103370492 340
9 3300014325 Ga0163163_10270514 Ga0163163_102705142 340
10 3300031238 Ga0265332_10093652 Ga0265332_100936522 345
11 3300039453 Ga0436362_0939924 Ga0436362_0939924_2109_3161 347
12 3300009177 Ga0105248_10104651 Ga0105248_101046512 348
13 3300005842 Ga0068858_100044635 Ga0068858_1000446354 350
14 3300009177 Ga0105248_10163169 Ga0105248_101631692 350
15 3300025941 Ga0207711_10115203 Ga0207711_101152032 350
16 3300026035 Ga0207703_10003892 Ga0207703_100038926 350
17 3300047471 Ga0495684_0202392 Ga0495684_0202392_229_1290 350
18 3300005617 Ga0068859_100152248 Ga0068859_1001522482 351
19 3300005840 Ga0068870_10117342 Ga0068870_101173422 351
20 3300006358 Ga0068871_100036457 Ga0068871_1000364574 351
21 3300006931 Ga0097620_100152248 Ga0097620_1001522482 351
22 3300009176 Ga0105242_10089541 Ga0105242_100895412 351
23 3300046535 Ga0495586_0164560 Ga0495586_0164560_164_1228 351
24 3300028381 Ga0268264_10384147 Ga0268264_103841472 353
25 3300005841 Ga0068863_100030915 Ga0068863_10003091510 354
26 3300026088 Ga0207641_10006040 Ga0207641_100060408 354
27 3300035170 Ga0373943_0125195 Ga0373943_0125195_270_1349 355
28 3300049592 Ga0501076_0330091 Ga0501076_0330091_146_1240 355
29 3300009177 Ga0105248_10053088 Ga0105248_100530882 356
30 3300011119 Ga0105246_10131066 Ga0105246_101310662 356
31 3300045051 Ga0451576_0379817 Ga0451576_0379817_393_1466 356
32 3300046516 Ga0495628_0310390 Ga0495628_0310390_72_1148 356
33 3300047319 Ga0495674_0015176 Ga0495674_0015176_486_1562 356
34 3300035695 Ga0373927_0003324 Ga0373927_0003324_2815_3912 358
35 3300005985 Ga0081539_10047153 Ga0081539_100471532 359
36 3300025941 Ga0207711_10092661 Ga0207711_100926612 359
37 3300035172 Ga0373955_0017093 Ga0373955_0017093_1146_2237 360
38 3300035724 Ga0373933_0030543 Ga0373933_0030543_239_1330 360
39 3300013102 Ga0157371_10247169 Ga0157371_102471691 361
40 3300032004 Ga0307414_10399703 Ga0307414_103997031 361
41 3300005329 Ga0070683_100055177 Ga0070683_1000551772 362
42 3300005329 Ga0070683_100066975 Ga0070683_1000669753 362
43 3300005334 Ga0068869_100094378 Ga0068869_1000943782 362
44 3300005354 Ga0070675_100297087 Ga0070675_1002970872 362
45 3300005435 Ga0070714_100026980 Ga0070714_1000269805 362
46 3300005457 Ga0070662_100057334 Ga0070662_1000573341 362
47 3300005458 Ga0070681_10151504 Ga0070681_101515041 362
48 3300005535 Ga0070684_100026226 Ga0070684_1000262266 362
49 3300005535 Ga0070684_100118269 Ga0070684_1001182692 362
50 3300005539 Ga0068853_100049785 Ga0068853_1000497853 362
51 3300005547 Ga0070693_100031058 Ga0070693_1000310581 362
52 3300005563 Ga0068855_100007949 Ga0068855_1000079499 362
53 3300005563 Ga0068855_100068162 Ga0068855_1000681623 362
54 3300005577 Ga0068857_100012995 Ga0068857_1000129958 362
55 3300005614 Ga0068856_100028630 Ga0068856_1000286304 362
56 3300005842 Ga0068858_100005450 Ga0068858_1000054508 362
57 3300006358 Ga0068871_100092301 Ga0068871_1000923013 362
58 3300009093 Ga0105240_10007579 Ga0105240_100075797 362
59 3300009093 Ga0105240_10074075 Ga0105240_100740753 362
60 3300009093 Ga0105240_10093169 Ga0105240_100931693 362
61 3300009093 Ga0105240_10174390 Ga0105240_101743902 362
62 3300009098 Ga0105245_10015442 Ga0105245_100154427 362
63 3300009098 Ga0105245_10016312 Ga0105245_100163123 362
64 3300009098 Ga0105245_10094173 Ga0105245_100941732 362
65 3300009174 Ga0105241_10137400 Ga0105241_101374001 362
66 3300009176 Ga0105242_10194971 Ga0105242_101949712 362
67 3300009177 Ga0105248_10009985 Ga0105248_100099853 362
68 3300009177 Ga0105248_10011881 Ga0105248_100118816 362
69 3300009545 Ga0105237_10026222 Ga0105237_100262223 362
70 3300009551 Ga0105238_10004308 Ga0105238_100043081 362
71 3300009551 Ga0105238_10005668 Ga0105238_100056684 362
72 3300009551 Ga0105238_10081878 Ga0105238_100818782 362
73 3300009553 Ga0105249_10033810 Ga0105249_100338106 362
74 3300010375 Ga0105239_10005269 Ga0105239_100052693 362
75 3300013104 Ga0157370_10026396 Ga0157370_100263964 362
76 3300013105 Ga0157369_10009438 Ga0157369_100094382 362
77 3300013296 Ga0157374_10120583 Ga0157374_101205833 362
78 3300013296 Ga0157374_10343374 Ga0157374_103433742 362
79 3300013297 Ga0157378_10014423 Ga0157378_100144233 362
80 3300013307 Ga0157372_10039605 Ga0157372_100396056 362
81 3300013307 Ga0157372_10102343 Ga0157372_101023432 362
82 3300013308 Ga0157375_10003180 Ga0157375_100031807 362
83 3300013308 Ga0157375_10202021 Ga0157375_102020212 362
84 3300025911 Ga0207654_10089210 Ga0207654_100892101 362
85 3300025913 Ga0207695_10023293 Ga0207695_100232933 362
86 3300025913 Ga0207695_10079612 Ga0207695_100796123 362
87 3300025914 Ga0207671_10019382 Ga0207671_100193824 362
88 3300025924 Ga0207694_10028156 Ga0207694_100281564 362
89 3300025924 Ga0207694_10119326 Ga0207694_101193262 362
90 3300025927 Ga0207687_10008471 Ga0207687_100084715 362
91 3300025927 Ga0207687_10010832 Ga0207687_100108326 362
92 3300025928 Ga0207700_10112884 Ga0207700_101128841 362
93 3300025933 Ga0207706_10081529 Ga0207706_100815291 362
94 3300025934 Ga0207686_10163767 Ga0207686_101637672 362
95 3300025941 Ga0207711_10001299 Ga0207711_1000129918 362
96 3300025941 Ga0207711_10406638 Ga0207711_104066382 362
97 3300025942 Ga0207689_10056771 Ga0207689_100567712 362
98 3300025944 Ga0207661_10036786 Ga0207661_100367862 362
99 3300025949 Ga0207667_10019558 Ga0207667_100195586 362
100 3300025949 Ga0207667_10027938 Ga0207667_100279386 362
101 3300025961 Ga0207712_10017603 Ga0207712_100176031 362
102 3300026035 Ga0207703_10025920 Ga0207703_100259205 362
103 3300026041 Ga0207639_10019880 Ga0207639_100198805 362
104 3300026078 Ga0207702_10009870 Ga0207702_100098706 362
105 3300026078 Ga0207702_10037991 Ga0207702_100379911 362
106 3300026116 Ga0207674_10091043 Ga0207674_100910432 362
107 3300026142 Ga0207698_10034337 Ga0207698_100343372 362
108 3300035111 Ga0373923_0038598 Ga0373923_0038598_581_1678 362
109 3300035118 Ga0373954_0022168 Ga0373954_0022168_129_1226 362
110 3300035119 Ga0373956_0018233 Ga0373956_0018233_1859_2956 362
111 3300035172 Ga0373955_0013824 Ga0373955_0013824_2541_3638 362
112 3300035172 Ga0373955_0014221 Ga0373955_0014221_81_1178 362
113 3300036401 Ga0373937_0010730 Ga0373937_0010730_1563_2660 362
114 3300036401 Ga0373937_0284318 Ga0373937_0284318_80_1177 362
115 3300046459 Ga0495629_0095757 Ga0495629_0095757_370_1467 362
116 3300046462 Ga0495651_0199024 Ga0495651_0199024_79_1176 362
117 3300046463 Ga0495653_0120614 Ga0495653_0120614_179_1276 362
118 3300046536 Ga0495587_0005962 Ga0495587_0005962_5610_6719 362
119 3300046689 Ga0495613_0102930 Ga0495613_0102930_877_1974 362
120 3300048088 Ga0495602_0060028 Ga0495602_0060028_587_1696 362
121 3300048907 Ga0496104_0088641 Ga0496104_0088641_1535_2644 362
122 3300005329 Ga0070683_100003054 Ga0070683_1000030546 363
123 3300005336 Ga0070680_100020882 Ga0070680_1000208824 363
124 3300005339 Ga0070660_100053045 Ga0070660_1000530452 363
125 3300005341 Ga0070691_10007443 Ga0070691_100074433 363
126 3300005530 Ga0070679_100002635 Ga0070679_10000263514 363
127 3300005535 Ga0070684_100001036 Ga0070684_10000103610 363
128 3300005577 Ga0068857_100002269 Ga0068857_1000022699 363
129 3300005614 Ga0068856_100011785 Ga0068856_1000117857 363
130 3300006237 Ga0097621_100236834 Ga0097621_1002368341 363
131 3300009174 Ga0105241_10008615 Ga0105241_100086154 363
132 3300009545 Ga0105237_10020803 Ga0105237_100208036 363
133 3300009551 Ga0105238_10002267 Ga0105238_1000226710 363
134 3300010375 Ga0105239_10025779 Ga0105239_100257792 363
135 3300013102 Ga0157371_10058349 Ga0157371_100583494 363
136 3300013104 Ga0157370_10004190 Ga0157370_100041908 363
137 3300013105 Ga0157369_10005839 Ga0157369_100058395 363
138 3300013307 Ga0157372_10013955 Ga0157372_100139551 363
139 3300014325 Ga0163163_10024938 Ga0163163_100249386 363
140 3300025912 Ga0207707_10001544 Ga0207707_1000154410 363
141 3300025913 Ga0207695_10000768 Ga0207695_1000076849 363
142 3300025916 Ga0207663_10128355 Ga0207663_101283552 363
143 3300025917 Ga0207660_10014513 Ga0207660_100145134 363
144 3300025919 Ga0207657_10027446 Ga0207657_100274465 363
145 3300025920 Ga0207649_10029806 Ga0207649_100298063 363
146 3300025924 Ga0207694_10001566 Ga0207694_1000156610 363
147 3300025928 Ga0207700_10166481 Ga0207700_101664812 363
148 3300025944 Ga0207661_10035402 Ga0207661_100354022 363
149 3300025949 Ga0207667_10000367 Ga0207667_1000036721 363
150 3300025949 Ga0207667_10000368 Ga0207667_1000036821 363
151 3300026078 Ga0207702_10000616 Ga0207702_1000061634 363
152 3300026116 Ga0207674_10000072 Ga0207674_100000725 363
153 3300026142 Ga0207698_10026225 Ga0207698_100262253 363
154 3300031595 Ga0265313_10002739 Ga0265313_1000273913 363
155 3300046531 Ga0495665_0159801 Ga0495665_0159801_64_1164 363
156 3300005335 Ga0070666_10012638 Ga0070666_100126389 364
157 3300005336 Ga0070680_100129853 Ga0070680_1001298532 364
158 3300005338 Ga0068868_100003385 Ga0068868_10000338510 364
159 3300005367 Ga0070667_100027308 Ga0070667_1000273087 364
160 3300005458 Ga0070681_10019992 Ga0070681_100199922 364
161 3300005458 Ga0070681_10105088 Ga0070681_101050882 364
162 3300005530 Ga0070679_100116561 Ga0070679_1001165612 364
163 3300005535 Ga0070684_100039843 Ga0070684_1000398435 364
164 3300005548 Ga0070665_100008755 Ga0070665_1000087555 364
165 3300005548 Ga0070665_100355902 Ga0070665_1003559022 364
166 3300005563 Ga0068855_100001548 Ga0068855_1000015488 364
167 3300005563 Ga0068855_100091651 Ga0068855_1000916514 364
168 3300005563 Ga0068855_100184985 Ga0068855_1001849852 364
169 3300005841 Ga0068863_100155842 Ga0068863_1001558422 364
170 3300005842 Ga0068858_100003289 Ga0068858_1000032898 364
171 3300005843 Ga0068860_100015158 Ga0068860_10001515811 364
172 3300006237 Ga0097621_100050841 Ga0097621_1000508412 364
173 3300006358 Ga0068871_100031865 Ga0068871_1000318654 364
174 3300006358 Ga0068871_100033807 Ga0068871_1000338073 364
175 3300009093 Ga0105240_10003336 Ga0105240_100033365 364
176 3300009098 Ga0105245_10063227 Ga0105245_100632273 364
177 3300009174 Ga0105241_10110889 Ga0105241_101108892 364
178 3300009176 Ga0105242_10043160 Ga0105242_100431602 364
179 3300009176 Ga0105242_10110810 Ga0105242_101108104 364
180 3300009545 Ga0105237_10136636 Ga0105237_101366362 364
181 3300009551 Ga0105238_10015535 Ga0105238_100155355 364
182 3300009551 Ga0105238_10054542 Ga0105238_100545423 364
183 3300010375 Ga0105239_10041145 Ga0105239_100411455 364
184 3300011119 Ga0105246_10190681 Ga0105246_101906812 364
185 3300013105 Ga0157369_10171981 Ga0157369_101719812 364
186 3300013306 Ga0163162_10015993 Ga0163162_100159938 364
187 3300014325 Ga0163163_10015983 Ga0163163_100159836 364
188 3300014325 Ga0163163_10031168 Ga0163163_100311687 364
189 3300025903 Ga0207680_10005305 Ga0207680_100053055 364
190 3300025912 Ga0207707_10014678 Ga0207707_100146782 364
191 3300025914 Ga0207671_10103804 Ga0207671_101038041 364
192 3300025917 Ga0207660_10114015 Ga0207660_101140151 364
193 3300025919 Ga0207657_10000858 Ga0207657_1000085810 364
194 3300025921 Ga0207652_10300263 Ga0207652_103002632 364
195 3300025924 Ga0207694_10005586 Ga0207694_100055862 364
196 3300025924 Ga0207694_10016523 Ga0207694_100165234 364
197 3300025927 Ga0207687_10010590 Ga0207687_100105909 364
198 3300025934 Ga0207686_10021239 Ga0207686_100212394 364
199 3300025934 Ga0207686_10147265 Ga0207686_101472652 364
200 3300025935 Ga0207709_10255156 Ga0207709_102551561 364
201 3300025939 Ga0207665_10076322 Ga0207665_100763223 364
202 3300025949 Ga0207667_10081318 Ga0207667_100813182 364
203 3300025949 Ga0207667_10103141 Ga0207667_101031412 364
204 3300025986 Ga0207658_10099857 Ga0207658_100998571 364
205 3300026035 Ga0207703_10065833 Ga0207703_100658333 364
206 3300026078 Ga0207702_10122476 Ga0207702_101224761 364
207 3300026088 Ga0207641_10061565 Ga0207641_100615653 364
208 3300026089 Ga0207648_10005760 Ga0207648_100057604 364
209 3300026095 Ga0207676_10104194 Ga0207676_101041944 364
210 3300026116 Ga0207674_10017375 Ga0207674_100173755 364
211 3300026116 Ga0207674_10024656 Ga0207674_100246566 364
212 3300026116 Ga0207674_10025948 Ga0207674_100259485 364
213 3300028379 Ga0268266_10021693 Ga0268266_100216936 364
214 3300028381 Ga0268264_10004756 Ga0268264_1000475611 364
215 3300028800 Ga0265338_10103889 Ga0265338_101038893 364
216 3300031711 Ga0265314_10012068 Ga0265314_100120684 364
217 3300035692 Ga0373935_0040736 Ga0373935_0040736_10_1110 364
218 3300035725 Ga0373947_0032145 Ga0373947_0032145_1788_2888 364
219 3300047319 Ga0495674_0141504 Ga0495674_0141504_725_1825 364
220 3300048918 Ga0496115_0021853 Ga0496115_0021853_1600_2703 364
221 3300053078 Ga0495612_0061985 Ga0495612_0061985_205_1305 364
222 3300005330 Ga0070690_100061512 Ga0070690_1000615122 365
223 3300005340 Ga0070689_100202771 Ga0070689_1002027712 365
224 3300009098 Ga0105245_10021302 Ga0105245_100213022 365
225 3300013296 Ga0157374_10049698 Ga0157374_100496982 365
226 3300025927 Ga0207687_10088548 Ga0207687_100885482 365
227 3300025934 Ga0207686_10006270 Ga0207686_100062705 365
228 3300025936 Ga0207670_10163595 Ga0207670_101635952 365
229 3300037068 Ga0373925_0084262 Ga0373925_0084262_940_2052 365
230 3300046529 Ga0495652_0049466 Ga0495652_0049466_1488_2600 365
231 3300046678 Ga0495599_0007048 Ga0495599_0007048_4936_6048 365
232 3300047318 Ga0495636_0023050 Ga0495636_0023050_670_1785 365
233 3300053139 Ga0500568_0000290 Ga0500568_0000290_21688_22812 365
234 3300005458 Ga0070681_10109158 Ga0070681_101091583 366
235 3300005530 Ga0070679_100191948 Ga0070679_1001919482 366
236 3300009093 Ga0105240_10004172 Ga0105240_100041724 366
237 3300009545 Ga0105237_10001745 Ga0105237_1000174513 366
238 3300025912 Ga0207707_10094594 Ga0207707_100945943 366
239 3300025913 Ga0207695_10088213 Ga0207695_100882133 366
240 3300025914 Ga0207671_10055255 Ga0207671_100552553 366
241 3300005327 Ga0070658_10124826 Ga0070658_101248262 367
242 3300009098 Ga0105245_10245932 Ga0105245_102459322 368
243 3300006028 Ga0070717_10065940 Ga0070717_100659403 370
244 3300005434 Ga0070709_10086901 Ga0070709_100869012 373
245 3300009093 Ga0105240_10061377 Ga0105240_100613773 375
246 3300031241 Ga0265325_10004900 Ga0265325_100049009 377
247 3300009093 Ga0105240_10043843 Ga0105240_100438435 378
248 3300009093 Ga0105240_10129786 Ga0105240_101297863 378
249 3300025913 Ga0207695_10027315 Ga0207695_100273153 378
250 3300025913 Ga0207695_10082739 Ga0207695_100827393 378
251 3300025924 Ga0207694_10217376 Ga0207694_102173761 378
252 3300031344 Ga0265316_10060827 Ga0265316_100608272 378
253 3300039437 Ga0436365_0576096 Ga0436365_0576096_2743_3888 378
254 3300005436 Ga0070713_100003823 Ga0070713_1000038239 379
255 3300005548 Ga0070665_100179049 Ga0070665_1001790492 379
256 3300005563 Ga0068855_100138670 Ga0068855_1001386703 379
257 3300006028 Ga0070717_10012119 Ga0070717_100121194 379
258 3300006028 Ga0070717_10104464 Ga0070717_101044642 379
259 3300010375 Ga0105239_10417695 Ga0105239_104176952 379
260 3300021388 Ga0213875_10017731 Ga0213875_100177313 379
261 3300021388 Ga0213875_10038749 Ga0213875_100387492 379
262 3300025913 Ga0207695_10080956 Ga0207695_100809561 379
263 3300025916 Ga0207663_10059411 Ga0207663_100594112 379
264 3300025928 Ga0207700_10005928 Ga0207700_100059284 379
265 3300025929 Ga0207664_10008790 Ga0207664_100087902 379
266 3300025939 Ga0207665_10118828 Ga0207665_101188282 379
267 3300031250 Ga0265331_10036823 Ga0265331_100368232 379
268 3300031344 Ga0265316_10003410 Ga0265316_1000341016 379
269 3300031712 Ga0265342_10013718 Ga0265342_100137185 379
270 3300035086 Ga0373934_0020957 Ga0373934_0020957_30_1181 379
271 3300035111 Ga0373923_0003325 Ga0373923_0003325_776_1927 379
272 3300035118 Ga0373954_0001445 Ga0373954_0001445_6974_8125 379
273 3300035119 Ga0373956_0007996 Ga0373956_0007996_1269_2420 379
274 3300035172 Ga0373955_0114787 Ga0373955_0114787_13_1179 379
275 3300035695 Ga0373927_0003146 Ga0373927_0003146_4656_5807 379
276 3300035724 Ga0373933_0142118 Ga0373933_0142118_340_1491 379
277 3300035725 Ga0373947_0010809 Ga0373947_0010809_216_1367 379
278 3300036401 Ga0373937_0053624 Ga0373937_0053624_2333_3484 379
279 3300037853 Ga0436364_0060658 Ga0436364_0060658_623_1774 379
280 3300037853 Ga0436364_0869193 Ga0436364_0869193_1512_2663 379
281 3300046472 Ga0495580_0007134 Ga0495580_0007134_5707_6858 379
282 3300046472 Ga0495580_0084625 Ga0495580_0084625_509_1663 379
283 3300046511 Ga0495608_0050234 Ga0495608_0050234_1528_2679 379
284 3300046559 Ga0495667_0018657 Ga0495667_0018657_1930_3081 379
285 3300047319 Ga0495674_0025759 Ga0495674_0025759_1921_3072 379
286 3300047471 Ga0495684_0043699 Ga0495684_0043699_93_1244 379
287 3300048088 Ga0495602_0071334 Ga0495602_0071334_246_1397 379
288 3300049568 Ga0501031_0005523 Ga0501031_0005523_906_2072 379
289 3300049569 Ga0501032_0000837 Ga0501032_0000837_21557_22723 379
290 3300049570 Ga0501033_0004077 Ga0501033_0004077_6647_7813 379
291 3300049571 Ga0501034_0023564 Ga0501034_0023564_4420_5586 379
292 3300049572 Ga0501036_0000824 Ga0501036_0000824_19983_21149 379
293 3300049573 Ga0501037_0006399 Ga0501037_0006399_5371_6537 379
294 3300049574 Ga0501038_0042968 Ga0501038_0042968_2082_3248 379
295 3300049580 Ga0501046_0000591 Ga0501046_0000591_16860_18026 379
296 3300049581 Ga0501047_0019177 Ga0501047_0019177_363_1529 379
297 3300049582 Ga0501048_0011743 Ga0501048_0011743_5015_6181 379
298 3300049583 Ga0501067_0018164 Ga0501067_0018164_686_1852 379
299 3300049584 Ga0501068_0002241 Ga0501068_0002241_6824_7990 379
300 3300049585 Ga0501069_0000329 Ga0501069_0000329_18765_19931 379
301 3300049586 Ga0501070_0009595 Ga0501070_0009595_363_1529 379
302 3300049588 Ga0501072_0001356 Ga0501072_0001356_15290_16456 379
303 3300049589 Ga0501073_0000929 Ga0501073_0000929_5076_6242 379
304 3300049590 Ga0501074_0017526 Ga0501074_0017526_2210_3376 379
305 3300049741 Ga0501079_0004585 Ga0501079_0004585_1823_2989 379
306 3300049742 Ga0501080_0000466 Ga0501080_0000466_15638_16804 379
307 3300049744 Ga0501083_0017121 Ga0501083_0017121_686_1852 379
308 3300049822 Ga0501035_0166553 Ga0501035_0166553_363_1529 379
309 3300049823 Ga0501044_0007260 Ga0501044_0007260_3846_5012 379
310 3300054114 Ga0501084_0005349 Ga0501084_0005349_7310_8476 379
311 3300005329 Ga0070683_100000137 Ga0070683_1000001377 380
312 3300005331 Ga0070670_100167929 Ga0070670_1001679292 380
313 3300005436 Ga0070713_100030486 Ga0070713_1000304862 380
314 3300005535 Ga0070684_100000899 Ga0070684_1000008999 380
315 3300005535 Ga0070684_100017919 Ga0070684_1000179195 380
316 3300005616 Ga0068852_100110897 Ga0068852_1001108972 380
317 3300005617 Ga0068859_100127581 Ga0068859_1001275812 380
318 3300005618 Ga0068864_100101441 Ga0068864_1001014412 380
319 3300005618 Ga0068864_100127511 Ga0068864_1001275112 380
320 3300005841 Ga0068863_100029809 Ga0068863_1000298095 380
321 3300006931 Ga0097620_100127584 Ga0097620_1001275842 380
322 3300009093 Ga0105240_10005788 Ga0105240_1000578813 380
323 3300009093 Ga0105240_10034438 Ga0105240_100344384 380
324 3300009094 Ga0111539_10306542 Ga0111539_103065422 380
325 3300009177 Ga0105248_10167787 Ga0105248_101677872 380
326 3300010375 Ga0105239_10238885 Ga0105239_102388852 380
327 3300014325 Ga0163163_10246489 Ga0163163_102464892 380
328 3300025928 Ga0207700_10264678 Ga0207700_102646782 380
329 3300025941 Ga0207711_10118596 Ga0207711_101185962 380
330 3300025944 Ga0207661_10000105 Ga0207661_1000010540 380
331 3300026088 Ga0207641_10231222 Ga0207641_102312221 380
332 3300026095 Ga0207676_10084268 Ga0207676_100842682 380
333 3300026121 Ga0207683_10135787 Ga0207683_101357872 380
334 3300028653 Ga0265323_10001175 Ga0265323_100011759 380
335 3300028666 Ga0265336_10032303 Ga0265336_100323031 380
336 3300028800 Ga0265338_10019100 Ga0265338_100191005 380
337 3300031238 Ga0265332_10046554 Ga0265332_100465542 380
338 3300031240 Ga0265320_10018891 Ga0265320_100188912 380
339 3300031249 Ga0265339_10021058 Ga0265339_100210585 380
340 3300031250 Ga0265331_10013628 Ga0265331_100136282 380
341 3300031250 Ga0265331_10121593 Ga0265331_101215931 380
342 3300031344 Ga0265316_10001734 Ga0265316_1000173420 380
343 3300031344 Ga0265316_10044410 Ga0265316_100444102 380
344 3300031344 Ga0265316_10057498 Ga0265316_100574982 380
345 3300031344 Ga0265316_10071978 Ga0265316_100719783 380
346 3300031344 Ga0265316_10102209 Ga0265316_101022092 380
347 3300031711 Ga0265314_10002749 Ga0265314_100027492 380
348 3300035725 Ga0373947_0098888 Ga0373947_0098888_121_1269 380
349 3300036401 Ga0373937_0068809 Ga0373937_0068809_1710_2858 380
350 3300037853 Ga0436364_0333119 Ga0436364_0333119_420_1565 380
351 3300037853 Ga0436364_0611476 Ga0436364_0611476_459_1604 380
352 3300046454 Ga0495592_0057591 Ga0495592_0057591_17_1165 380
353 3300046462 Ga0495651_0080353 Ga0495651_0080353_935_2083 380
354 3300046472 Ga0495580_0004526 Ga0495580_0004526_6582_7730 380
355 3300046472 Ga0495580_0040419 Ga0495580_0040419_2076_3221 380
356 3300046476 Ga0495662_0024609 Ga0495662_0024609_229_1377 380
357 3300046514 Ga0495618_0032230 Ga0495618_0032230_1751_2899 380
358 3300046516 Ga0495628_0054974 Ga0495628_0054974_1142_2290 380
359 3300046536 Ga0495587_0141743 Ga0495587_0141743_184_1332 380
360 3300046543 Ga0495645_0002427 Ga0495645_0002427_3716_4864 380
361 3300046543 Ga0495645_0028869 Ga0495645_0028869_2786_3934 380
362 3300046543 Ga0495645_0051518 Ga0495645_0051518_1306_2454 380
363 3300046543 Ga0495645_0149819 Ga0495645_0149819_182_1330 380
364 3300046559 Ga0495667_0030051 Ga0495667_0030051_1893_3041 380
365 3300046678 Ga0495599_0010035 Ga0495599_0010035_2528_3676 380
366 3300047317 Ga0495604_0036062 Ga0495604_0036062_127_1275 380
367 3300047317 Ga0495604_0065666 Ga0495604_0065666_51_1199 380
368 3300047319 Ga0495674_0038933 Ga0495674_0038933_2897_4045 380
369 3300047444 Ga0495675_0155892 Ga0495675_0155892_10_1158 380
370 3300047471 Ga0495684_0011188 Ga0495684_0011188_1525_2673 380
371 3300048088 Ga0495602_0049271 Ga0495602_0049271_2179_3327 380
372 3300048088 Ga0495602_0096962 Ga0495602_0096962_650_1798 380
373 3300048918 Ga0496115_0161959 Ga0496115_0161959_478_1626 380
374 3300050511 nmdc:mga08y16_248517_c1 nmdc:mga08y16_248517_c1_510_1655 380
375 3300060353 Ga0501082_0001662 Ga0501082_0001662_11170_12318 380
376 3300005327 Ga0070658_10003165 Ga0070658_1000316514 381
377 3300005530 Ga0070679_100191338 Ga0070679_1001913382 381
378 3300005563 Ga0068855_100006192 Ga0068855_1000061929 381
379 3300005563 Ga0068855_100098109 Ga0068855_1000981093 381
380 3300009093 Ga0105240_10000651 Ga0105240_1000065127 381
381 3300013104 Ga0157370_10005656 Ga0157370_100056569 381
382 3300013104 Ga0157370_10213063 Ga0157370_102130632 381
383 3300013105 Ga0157369_10010656 Ga0157369_100106569 381
384 3300025913 Ga0207695_10001778 Ga0207695_1000177820 381
385 3300025929 Ga0207664_10062085 Ga0207664_100620853 381
386 3300025949 Ga0207667_10004819 Ga0207667_1000481910 381
387 3300031712 Ga0265342_10018691 Ga0265342_100186915 381
388 3300037853 Ga0436364_0557673 Ga0436364_0557673_371_1570 381
389 3300049581 Ga0501047_0088423 Ga0501047_0088423_1690_2835 381

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03787

RAMPs

RAMP superfamily

20

346

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6muu-assembly1.cif.gz_F cryo-em structure of csm-crrna binary complex in type iii-a crispr-cas system 0.7242 1 379
6muu-assembly1.cif.gz_F cryo-em structure of csm-crrna binary complex in type iii-a crispr-cas system 0.7221 1 379
7uzz-assembly1.cif.gz_E staphylococcus epidermidis rp62a crispr tall effector complex 0.7116 1 379
7uzz-assembly1.cif.gz_E staphylococcus epidermidis rp62a crispr tall effector complex 0.7055 1 379
6xn3-assembly1.cif.gz_J structure of the lactococcus lactis csm ctr_4:3 crispr-cas complex 0.7051 2 381
ID Description Score Start End Superfamily
af_I6XFF7_1_86_3.30.1230.10 Alpha Beta;2-Layer Sandwich;Hypothetical Cytosolic Protein; Chain: A;;YlxR-like 0.5515 189 219 3.30.1230.10
af_Q0JMY1_242_387_1.20.142.10 Mainly Alpha;Up-down Bundle;Poly(ADP-ribose) Polymerase; domain 1;Poly(ADP-ribose) polymerase, regulatory domain 0.4531 125 164 1.20.142.10
af_Q9VMJ4_227_343_3.30.505.10 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain 0.411 173 214 3.30.505.10
af_Q2G0X8_51_125_2.40.50.110 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.3971 184 212 2.40.50.110
af_A0A0G2K6M2_23_226_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.3896 187 208 2.40.10.10
ID Description Score Start End GO Terms
AF-Q02AM2-F1-model_v4 CRISPR system Cms protein Csm5 (CRISPR type III A-associated protein Csm5) 0.9729 1 381 GO:0003723
GO:0051607
AF-A0A2V8UY44-F1-model_v4 CRISPR system Cms protein Csm5 (CRISPR type III A-associated protein Csm5) 0.9704 1 310 GO:0003723
GO:0051607
AF-Q02AM2-F1-model_v4 CRISPR system Cms protein Csm5 (CRISPR type III A-associated protein Csm5) 0.9704 1 381 GO:0003723
GO:0051607
AF-A0A7V2MEZ6-F1-model_v4 Type III-A CRISPR-associated RAMP protein Csm5 0.9664 1 381 GO:0003723
AF-A0A7V2MEZ6-F1-model_v4 Type III-A CRISPR-associated RAMP protein Csm5 0.9639 1 381 GO:0003723

Feature Viewer

pLDDT pTM Quality
90.32 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map