F431254

General Info

Members Datasets Scaffolds Average Seq Length
388 195 776 287

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0148816|Ga0501067_0148816_211_1227
Length 338
Sequence MSLARVILRSSRGFWLSRYACAYVPRNRTVRLAVLGSSVQRAAPSGFPSSRSSALKRRIVVGLLVLASLVLITVSFRSSALDGVQGTGATVLRPFEVAADRIARPFADTIGWFRGLVDAKNENEKLRAQNEALRRQLILDEGAIHQNVELKKALDYKGPPSAADFDRVHTSVVANPQGAIEESVVIGAGSADGVQRNSVVVEPLGGPDGSGALVGTVDRVTAHESRVTLLTDSQSAVTATDVTNPQVIGAVRRGGGSSDVLVLDRVPKRPYVRIGDTIVTAGSLGEGPLKSKFPRGIPIGTVSSRSSTDANLFQNIQLKPLVDFSSIQSVVVLVPKGH

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
101 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
102 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
103 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
104 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
105 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
156 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 1.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.4
Rhizosphere 85.05
Stem 0
Stem Tuber 0
Unclassified 12.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0148816 3300049583 Unclassified 1304
2 Ga0070658_10022642 3300005327 Bacteria 5042
3 Ga0070658_10149827 3300005327 Bacteria 1953
4 Ga0070683_100051135 3300005329 Bacteria 3826
5 Ga0070683_100093333 3300005329 Unclassified 2827
6 Ga0070683_100562953 3300005329 Bacteria 1090
7 Ga0070680_100006006 3300005336 Bacteria 9210
8 Ga0070682_100084980 3300005337 Unclassified 2057
9 Ga0068868_100316181 3300005338 Bacteria 1329
10 Ga0070660_100007783 3300005339 Bacteria 7472
11 Ga0070660_100035242 3300005339 Bacteria 3787
12 Ga0070660_100069733 3300005339 Bacteria 2742
13 Ga0070660_100125791 3300005339 Bacteria 2048
14 Ga0070660_100168549 3300005339 Bacteria 1768
15 Ga0070661_100012269 3300005344 Bacteria 5991
16 Ga0070661_100058848 3300005344 Bacteria 2816
17 Ga0070671_100034542 3300005355 Bacteria 4185
18 Ga0070659_100022213 3300005366 Bacteria 4840
19 Ga0070659_100079790 3300005366 Bacteria 2612
20 Ga0070659_100274179 3300005366 Bacteria 1402
21 Ga0070709_10106892 3300005434 Unclassified 1874
22 Ga0070709_10141318 3300005434 Bacteria 1654
23 Ga0070714_100052992 3300005435 Unclassified 3461
24 Ga0070714_100160768 3300005435 Bacteria 2032
25 Ga0070714_100375951 3300005435 Bacteria 1338
26 Ga0070713_100198683 3300005436 Bacteria 1810
27 Ga0070713_100213312 3300005436 Unclassified 1749
28 Ga0070713_100370967 3300005436 Bacteria 1332
29 Ga0070710_10069035 3300005437 Bacteria 2032
30 Ga0070711_100007224 3300005439 Bacteria 6748
31 Ga0070705_100008622 3300005440 Bacteria 5050
32 Ga0070705_100012223 3300005440 Unclassified 4358
33 Ga0070694_100021003 3300005444 Unclassified 4168
34 Ga0070694_100335484 3300005444 Bacteria 1167
35 Ga0070708_100045295 3300005445 Bacteria 3875
36 Ga0070708_100055599 3300005445 Bacteria 3520
37 Ga0070708_100069383 3300005445 Bacteria 3169
38 Ga0070663_100155138 3300005455 Bacteria 1759
39 Ga0070678_100060278 3300005456 Bacteria 2792
40 Ga0070681_10001709 3300005458 Bacteria 19668
41 Ga0070681_10035195 3300005458 Bacteria 5030
42 Ga0070681_10039287 3300005458 Bacteria 4744
43 Ga0070681_10051005 3300005458 Bacteria 4127
44 Ga0070681_10064995 3300005458 Bacteria 3618
45 Ga0070681_10219073 3300005458 Unclassified 1818
46 Ga0070681_10587840 3300005458 Bacteria 1027
47 Ga0070706_100053032 3300005467 Bacteria 3743
48 Ga0070698_100008318 3300005471 Bacteria 11217
49 Ga0070698_100127982 3300005471 Bacteria 2496
50 Ga0070698_100384894 3300005471 Bacteria 1335
51 Ga0070679_100037512 3300005530 Bacteria 4815
52 Ga0070679_100048841 3300005530 Bacteria 4215
53 Ga0070679_100382365 3300005530 Unclassified 1354
54 Ga0070684_100151143 3300005535 Bacteria 2103
55 Ga0070684_100205961 3300005535 Unclassified 1792
56 Ga0070697_100221486 3300005536 Bacteria 1612
57 Ga0070697_100331716 3300005536 Bacteria 1311
58 Ga0070695_100058351 3300005545 Bacteria 2495
59 Ga0070695_100306066 3300005545 Unclassified 1176
60 Ga0070665_100042352 3300005548 Bacteria 4576
61 Ga0070704_100078794 3300005549 Bacteria 2418
62 Ga0070704_100081194 3300005549 Bacteria 2387
63 Ga0068855_100018680 3300005563 Bacteria 8338
64 Ga0068855_100065446 3300005563 Bacteria 4238
65 Ga0068855_100084390 3300005563 Bacteria 3677
66 Ga0068855_100392666 3300005563 Bacteria 1522
67 Ga0068857_100131799 3300005577 Bacteria 2255
68 Ga0070702_100084784 3300005615 Bacteria 1906
69 Ga0068860_100337800 3300005843 Bacteria 1481
70 Ga0070717_10024637 3300006028 Bacteria 4780
71 Ga0070717_10142858 3300006028 Bacteria 2065
72 Ga0070717_10244568 3300006028 Bacteria 1583
73 Ga0070716_100224937 3300006173 Unclassified 1263
74 Ga0070712_100001232 3300006175 Bacteria 15466
75 Ga0070712_100003593 3300006175 Bacteria 9556
76 Ga0070712_100004988 3300006175 Bacteria 8213
77 Ga0070712_100015474 3300006175 Bacteria 4916
78 Ga0070712_100236713 3300006175 Bacteria 1453
79 Ga0075433_10007794 3300006852 Bacteria 8512
80 Ga0075434_100032367 3300006871 Bacteria 5157
81 Ga0075434_100116537 3300006871 Bacteria 2684
82 Ga0075436_100040706 3300006914 Bacteria 3206
83 Ga0075435_100003263 3300007076 Bacteria 10990
84 Ga0105240_10032835 3300009093 Bacteria 6714
85 Ga0105240_10035837 3300009093 Bacteria 6389
86 Ga0105240_10133776 3300009093 Bacteria 2971
87 Ga0105245_10079113 3300009098 Unclassified 3001
88 Ga0105245_10371140 3300009098 Bacteria 1422
89 Ga0114129_10008533 3300009147 Bacteria 14608
90 Ga0105243_10154378 3300009148 Bacteria 1972
91 Ga0105243_10253031 3300009148 Bacteria 1573
92 Ga0105241_10092889 3300009174 Unclassified 2383
93 Ga0105242_10122133 3300009176 Bacteria 2237
94 Ga0105242_10128518 3300009176 Bacteria 2184
95 Ga0105242_10403879 3300009176 Bacteria 1276
96 Ga0105248_10497570 3300009177 Unclassified 1374
97 Ga0105237_10031939 3300009545 Bacteria 5332
98 Ga0105237_10077071 3300009545 Bacteria 3324
99 Ga0105237_10313734 3300009545 Bacteria 1571
100 Ga0105238_10049779 3300009551 Bacteria 4219
101 Ga0105238_10061645 3300009551 Bacteria 3752
102 Ga0157373_10010996 3300013100 Bacteria 6664
103 Ga0157373_10128796 3300013100 Unclassified 1780
104 Ga0157371_10244860 3300013102 Unclassified 1290
105 Ga0157370_10127681 3300013104 Bacteria 2373
106 Ga0157369_10001378 3300013105 Bacteria 29916
107 Ga0157369_10005226 3300013105 Bacteria 15146
108 Ga0157369_10026867 3300013105 Bacteria 6383
109 Ga0157369_10046321 3300013105 Bacteria 4726
110 Ga0157369_10330227 3300013105 Bacteria 1585
111 Ga0157374_10063811 3300013296 Bacteria 3455
112 Ga0157374_10164832 3300013296 Bacteria 2159
113 Ga0157374_10381461 3300013296 Bacteria 1404
114 Ga0163162_10356529 3300013306 Bacteria 1595
115 Ga0157372_10024197 3300013307 Bacteria 6592
116 Ga0157372_10127906 3300013307 Bacteria 2921
117 Ga0157372_10875707 3300013307 Bacteria 1042
118 Ga0182008_10024536 3300014497 Bacteria 3069
119 Ga0157377_10088829 3300014745 Bacteria 1821
120 Ga0206356_10173385 3300020070 Bacteria 1039
121 Ga0206356_10886706 3300020070 Unclassified 2790
122 Ga0206356_11233123 3300020070 Bacteria 2664
123 Ga0206356_11690673 3300020070 Bacteria 1281
124 Ga0206353_10196820 3300020082 Bacteria 3041
125 Ga0207653_10011391 3300025885 Bacteria 2775
126 Ga0207692_10057935 3300025898 Bacteria 1994
127 Ga0207699_10056803 3300025906 Bacteria 2335
128 Ga0207705_10043788 3300025909 Bacteria 3215
129 Ga0207705_10402628 3300025909 Bacteria 1059
130 Ga0207684_10049740 3300025910 Bacteria 3556
131 Ga0207684_10085080 3300025910 Bacteria 2694
132 Ga0207684_10289403 3300025910 Bacteria 1413
133 Ga0207707_10002693 3300025912 Bacteria 15869
134 Ga0207707_10013337 3300025912 Bacteria 7163
135 Ga0207707_10219323 3300025912 Unclassified 1656
136 Ga0207695_10136140 3300025913 Unclassified 2409
137 Ga0207671_10135512 3300025914 Unclassified 1893
138 Ga0207693_10005497 3300025915 Bacteria 10553
139 Ga0207693_10048637 3300025915 Bacteria 3330
140 Ga0207693_10120138 3300025915 Bacteria 2064
141 Ga0207693_10217334 3300025915 Bacteria 1502
142 Ga0207663_10005881 3300025916 Bacteria 6221
143 Ga0207663_10036137 3300025916 Bacteria 2970
144 Ga0207660_10023020 3300025917 Bacteria 4204
145 Ga0207660_10075076 3300025917 Bacteria 2468
146 Ga0207657_10007423 3300025919 Bacteria 11245
147 Ga0207657_10009113 3300025919 Bacteria 10011
148 Ga0207657_10051949 3300025919 Bacteria 3561
149 Ga0207657_10164785 3300025919 Bacteria 1799
150 Ga0207652_10027330 3300025921 Bacteria 4753
151 Ga0207652_10112889 3300025921 Bacteria 2412
152 Ga0207646_10087288 3300025922 Bacteria 2791
153 Ga0207646_10111077 3300025922 Bacteria 2460
154 Ga0207646_10155903 3300025922 Unclassified 2060
155 Ga0207694_10295732 3300025924 Unclassified 1332
156 Ga0207700_10111881 3300025928 Bacteria 2199
157 Ga0207700_10185728 3300025928 Bacteria 1744
158 Ga0207664_10101695 3300025929 Bacteria 2375
159 Ga0207664_10129259 3300025929 Bacteria 2124
160 Ga0207690_10019596 3300025932 Bacteria 4169
161 Ga0207706_10093974 3300025933 Bacteria 2637
162 Ga0207709_10045675 3300025935 Bacteria 2654
163 Ga0207665_10082066 3300025939 Bacteria 2221
164 Ga0207665_10222981 3300025939 Unclassified 1382
165 Ga0207689_10096291 3300025942 Bacteria 2431
166 Ga0207661_10071703 3300025944 Bacteria 2832
167 Ga0207661_10094564 3300025944 Bacteria 2497
168 Ga0207667_10117660 3300025949 Bacteria 2739
169 Ga0207667_10208791 3300025949 Bacteria 2002
170 Ga0207667_10338211 3300025949 Bacteria 1536
171 Ga0207667_10410118 3300025949 Bacteria 1379
172 Ga0207667_10531001 3300025949 Bacteria 1191
173 Ga0207678_10092771 3300026067 Bacteria 2580
174 Ga0207708_10306458 3300026075 Bacteria 1293
175 Ga0207674_10148730 3300026116 Bacteria 2300
176 Ga0207683_10079570 3300026121 Bacteria 2906
177 Ga0207698_10268240 3300026142 Bacteria 1572
178 Ga0207698_10331031 3300026142 Bacteria 1430
179 Ga0265318_10045979 3300028577 Bacteria 1649
180 Ga0265338_10003592 3300028800 Bacteria 21643
181 Ga0265325_10039891 3300031241 Bacteria 2469
182 Ga0265331_10020491 3300031250 Bacteria 3393
183 Ga0265316_10003289 3300031344 Bacteria 16397
184 Ga0265313_10003727 3300031595 Bacteria 12126
185 Ga0265314_10007156 3300031711 Bacteria 9715
186 Ga0265342_10033916 3300031712 Bacteria 3135
187 Ga0307405_10026138 3300031731 Bacteria 3364
188 Ga0307416_100090677 3300032002 Bacteria 2622
189 Ga0373948_0004444 3300034817 Bacteria 2218
190 Ga0373959_0001133 3300034820 Unclassified 4319
191 Ga0373944_0032975 3300035089 Bacteria 1567
192 Ga0373949_0008287 3300035090 Bacteria 2276
193 Ga0373951_0048121 3300035091 Bacteria 1043
194 Ga0373932_0009258 3300035112 Bacteria 2365
195 Ga0373936_0013193 3300035113 Bacteria 3152
196 Ga0373943_0004051 3300035170 Bacteria 6655
197 Ga0373943_0015512 3300035170 Bacteria 3462
198 Ga0373961_0016670 3300035241 Bacteria 1895
199 Ga0373931_0002303 3300035691 Bacteria 8436
200 Ga0373933_0059574 3300035724 Unclassified 2300
201 Ga0373947_0000994 3300035725 Bacteria 17318
202 Ga0373947_0001247 3300035725 Bacteria 15666
203 Ga0373937_0021142 3300036401 Bacteria 5840
204 Ga0373925_0009046 3300037068 Bacteria 7250
205 Ga0373925_0039876 3300037068 Bacteria 3475
206 Ga0395899_0058804 3300037312 Bacteria 2834
207 Ga0395899_0061228 3300037312 Bacteria 2772
208 Ga0395899_0166735 3300037312 Unclassified 1553
209 Ga0395900_0008250 3300037418 Bacteria 10725
210 Ga0395900_0023739 3300037418 Bacteria 6273
211 Ga0395900_0083383 3300037418 Bacteria 3284
212 Ga0395900_0114351 3300037418 Bacteria 2769
213 Ga0395898_0002754 3300037466 Bacteria 20249
214 Ga0395898_0034205 3300037466 Bacteria 5067
215 Ga0395898_0050991 3300037466 Bacteria 4047
216 Ga0395898_0099884 3300037466 Bacteria 2787
217 Ga0395905_0006211 3300037471 Bacteria 12058
218 Ga0395905_0055040 3300037471 Bacteria 3724
219 Ga0395905_0293986 3300037471 Unclassified 1511
220 Ga0436364_0486127 3300037853 Bacteria 2565
221 Ga0395901_0000391 3300038443 Bacteria 52295
222 Ga0395901_0004254 3300038443 Bacteria 14441
223 Ga0395901_0012807 3300038443 Bacteria 8505
224 Ga0436365_1250681 3300039437 Bacteria 2528
225 Ga0436365_1368665 3300039437 Unclassified 966
226 Ga0436365_1657686 3300039437 Bacteria 6865
227 Ga0436363_0141420 3300039450 Bacteria 3420
228 Ga0436362_0386219 3300039453 Bacteria 1902
229 Ga0451853_2786277 3300041512 Unclassified 1395
230 Ga0466966_0010915 3300044684 Bacteria 6032
231 Ga0466966_0078279 3300044684 Bacteria 2062
232 Ga0466961_0002155 3300044693 Bacteria 12245
233 Ga0466963_0000468 3300044694 Bacteria 18789
234 Ga0466963_0002921 3300044694 Bacteria 9653
235 Ga0466963_0013638 3300044694 Bacteria 4995
236 Ga0466963_0028518 3300044694 Bacteria 3585
237 Ga0466963_0052195 3300044694 Bacteria 2712
238 Ga0466963_0086760 3300044694 Bacteria 2127
239 Ga0466964_0010484 3300044706 Bacteria 3496
240 Ga0466971_0000500 3300044719 Bacteria 15356
241 Ga0466968_0006668 3300044735 Bacteria 4362
242 Ga0466968_0145245 3300044735 Bacteria 1087
243 Ga0466968_0172558 3300044735 Bacteria 1003
244 Ga0466970_0043351 3300044765 Bacteria 2394
245 Ga0466957_0000044 3300044842 Bacteria 46388
246 Ga0466957_0221376 3300044842 Bacteria 1250
247 Ga0466959_0024196 3300045049 Bacteria 4498
248 Ga0466959_0030514 3300045049 Bacteria 3991
249 Ga0466959_0161753 3300045049 Bacteria 1574
250 Ga0466958_0000364 3300045836 Bacteria 18311
251 Ga0466958_0004140 3300045836 Bacteria 7613
252 Ga0466958_0031487 3300045836 Bacteria 3153
253 Ga0466958_0053146 3300045836 Bacteria 2456
254 Ga0466967_0002274 3300045976 Bacteria 11850
255 Ga0466967_0017193 3300045976 Bacteria 5733
256 Ga0466967_0023479 3300045976 Bacteria 5054
257 Ga0466967_0033825 3300045976 Bacteria 4332
258 Ga0466967_0069219 3300045976 Bacteria 3153
259 Ga0466967_0076093 3300045976 Bacteria 3018
260 Ga0466967_0090940 3300045976 Bacteria 2773
261 Ga0466967_0103617 3300045976 Bacteria 2604
262 Ga0466967_0121560 3300045976 Unclassified 2413
263 Ga0466967_0178876 3300045976 Bacteria 1999
264 Ga0466967_0183360 3300045976 Bacteria 1975
265 Ga0466967_0270397 3300045976 Unclassified 1628
266 Ga0466967_0315801 3300045976 Unclassified 1506
267 Ga0466967_0411299 3300045976 Unclassified 1317
268 Ga0495592_0022080 3300046454 Bacteria 4842
269 Ga0495629_0007444 3300046459 Bacteria 8064
270 Ga0495641_0000612 3300046461 Bacteria 30028
271 Ga0495651_0023580 3300046462 Bacteria 4784
272 Ga0495651_0190779 3300046462 Bacteria 1442
273 Ga0495653_0064491 3300046463 Bacteria 2760
274 Ga0495653_0069820 3300046463 Bacteria 2630
275 Ga0495582_0000390 3300046473 Bacteria 23853
276 Ga0495639_0007714 3300046475 Bacteria 4627
277 Ga0495662_0000620 3300046476 Bacteria 16478
278 Ga0495664_0049549 3300046477 Bacteria 2493
279 Ga0495596_0169369 3300046500 Unclassified 849
280 Ga0495608_0007427 3300046511 Bacteria 7743
281 Ga0495608_0069204 3300046511 Bacteria 2306
282 Ga0495630_0123617 3300046517 Bacteria 1963
283 Ga0495630_0188723 3300046517 Bacteria 1572
284 Ga0495630_0436584 3300046517 Bacteria 1003
285 Ga0495652_0067096 3300046529 Bacteria 3008
286 Ga0495652_0099038 3300046529 Bacteria 2368
287 Ga0495652_0256093 3300046529 Unclassified 1294
288 Ga0495665_0003370 3300046531 Bacteria 8671
289 Ga0495665_0131630 3300046531 Bacteria 1309
290 Ga0495640_0190829 3300046533 Unclassified 1302
291 Ga0495640_0195934 3300046533 Bacteria 1282
292 Ga0495645_0043776 3300046543 Bacteria 3266
293 Ga0495667_0135820 3300046559 Bacteria 1585
294 Ga0495635_0357498 3300046663 Unclassified 974
295 Ga0495588_0051300 3300046674 Bacteria 2125
296 Ga0495657_0011898 3300046675 Bacteria 6483
297 Ga0495599_0042471 3300046678 Bacteria 2853
298 Ga0495647_0000934 3300046681 Bacteria 8776
299 Ga0495658_0000533 3300046683 Bacteria 20754
300 Ga0495658_0005205 3300046683 Bacteria 6397
301 Ga0495658_0086678 3300046683 Bacteria 1848
302 Ga0495613_0004198 3300046689 Bacteria 10784
303 Ga0495624_0030114 3300046690 Bacteria 3537
304 Ga0495581_0008754 3300047315 Bacteria 5858
305 Ga0495604_0032689 3300047317 Bacteria 4122
306 Ga0495604_0076242 3300047317 Bacteria 2522
307 Ga0495674_0013479 3300047319 Bacteria 7687
308 Ga0495674_0048248 3300047319 Bacteria 3769
309 Ga0495676_0012717 3300047321 Bacteria 7570
310 Ga0495680_0016079 3300047322 Bacteria 6433
311 Ga0495680_0054684 3300047322 Bacteria 3099
312 Ga0495680_0157618 3300047322 Unclassified 1650
313 Ga0495684_0012093 3300047471 Bacteria 6659
314 Ga0495593_0025181 3300047673 Bacteria 3293
315 Ga0495602_0120810 3300048088 Bacteria 2108
316 Ga0495614_0002623 3300048089 Bacteria 7993
317 Ga0496100_0005561 3300048903 Bacteria 6802
318 Ga0496100_0143643 3300048903 Unclassified 1694
319 Ga0496101_0001237 3300048904 Bacteria 15272
320 Ga0496101_0011377 3300048904 Bacteria 5903
321 Ga0496101_0016212 3300048904 Bacteria 5029
322 Ga0496101_0030621 3300048904 Bacteria 3775
323 Ga0496101_0030913 3300048904 Bacteria 3759
324 Ga0496102_0157191 3300048905 Bacteria 2137
325 Ga0496102_0179053 3300048905 Bacteria 1997
326 Ga0496102_0194867 3300048905 Bacteria 1909
327 Ga0496102_0293993 3300048905 Bacteria 1531
328 Ga0496102_0479882 3300048905 Bacteria 1164
329 Ga0496103_0012476 3300048906 Bacteria 5039
330 Ga0496103_0021787 3300048906 Bacteria 3857
331 Ga0496103_0031794 3300048906 Bacteria 3219
332 Ga0496103_0126204 3300048906 Bacteria 1632
333 Ga0496104_0010932 3300048907 Bacteria 8120
334 Ga0496105_0071922 3300048908 Bacteria 2858
335 Ga0496105_0111786 3300048908 Bacteria 2254
336 Ga0496106_0006502 3300048909 Bacteria 8655
337 Ga0496106_0026161 3300048909 Bacteria 4341
338 Ga0496106_0035326 3300048909 Bacteria 3737
339 Ga0496106_0359556 3300048909 Viruses 1169
340 Ga0496107_0005792 3300048910 Bacteria 8456
341 Ga0496107_0006955 3300048910 Bacteria 7795
342 Ga0496108_0008642 3300048911 Bacteria 8263
343 Ga0496108_0108929 3300048911 Bacteria 2366
344 Ga0496108_0328294 3300048911 Bacteria 1334
345 Ga0496109_0003020 3300048912 Bacteria 14035
346 Ga0496109_0015224 3300048912 Bacteria 6696
347 Ga0496110_0023676 3300048913 Bacteria 5224
348 Ga0496110_0087718 3300048913 Bacteria 2779
349 Ga0496111_0014200 3300048914 Bacteria 5435
350 Ga0496111_0139366 3300048914 Bacteria 1797
351 Ga0496111_0235028 3300048914 Unclassified 1361
352 Ga0496111_0235950 3300048914 Bacteria 1358
353 Ga0496112_0013485 3300048915 Bacteria 7547
354 Ga0496112_0022766 3300048915 Bacteria 5977
355 Ga0496112_0103606 3300048915 Bacteria 2815
356 Ga0496112_0123375 3300048915 Bacteria 2561
357 Ga0496113_0137152 3300048916 Bacteria 1923
358 Ga0496113_0260972 3300048916 Unclassified 1384
359 Ga0496114_0005852 3300048917 Bacteria 9658
360 Ga0496114_0020517 3300048917 Bacteria 5363
361 Ga0496114_0028336 3300048917 Bacteria 4595
362 Ga0496114_0177813 3300048917 Unclassified 1857
363 Ga0496114_0397831 3300048917 Unclassified 1220
364 Ga0496115_0006179 3300048918 Bacteria 8758
365 Ga0496115_0008023 3300048918 Bacteria 7792
366 Ga0496115_0010548 3300048918 Bacteria 6909
367 Ga0496115_0038556 3300048918 Bacteria 3792
368 Ga0496115_0171458 3300048918 Unclassified 1794
369 Ga0501067_0000577 3300049583 Bacteria 19841
370 Ga0501067_0009039 3300049583 Bacteria 5518
371 Ga0501068_0093905 3300049584 Unclassified 1854
372 Ga0501069_0005801 3300049585 Bacteria 6429
373 Ga0501070_0000318 3300049586 Bacteria 43769
374 nmdc:mga05p37_17527_c1 3300050507 Bacteria 8645
375 nmdc:mga0n895_42338_c1 3300050512 Bacteria 4430
376 nmdc:mga0n895_9591_c1 3300050512 Bacteria 8480
377 nmdc:mga0rr50_1279_c1 3300050513 Bacteria 13709
378 nmdc:mga0rr50_38267_c1 3300050513 Bacteria 3470
379 nmdc:mga0rr50_7911_c1 3300050513 Bacteria 6595
380 nmdc:mga08x19_30842_c1 3300050514 Bacteria 3370
381 nmdc:mga0a205_2100_c2 3300050515 Bacteria 11080
382 nmdc:mga0a205_9456_c1 3300050515 Bacteria 8914
383 Ga0495595_0001870 3300053084 Bacteria 8171
384 Ga0495619_0009671 3300053085 Bacteria 6080
385 Ga0495619_0023071 3300053085 Bacteria 3985
386 Ga0495619_0026768 3300053085 Bacteria 3712
387 Ga0466962_0001476 3300061719 Bacteria 10970
388 Ga0466962_0088281 3300061719 Unclassified 1485
389 Ga0501067_0148816
390 Ga0070658_10022642
391 Ga0070658_10149827
392 Ga0070683_100051135
393 Ga0070683_100093333
394 Ga0070683_100562953
395 Ga0070680_100006006
396 Ga0070682_100084980
397 Ga0068868_100316181
398 Ga0070660_100007783
399 Ga0070660_100035242
400 Ga0070660_100069733
401 Ga0070660_100125791
402 Ga0070660_100168549
403 Ga0070661_100012269
404 Ga0070661_100058848
405 Ga0070671_100034542
406 Ga0070659_100022213
407 Ga0070659_100079790
408 Ga0070659_100274179
409 Ga0070709_10106892
410 Ga0070709_10141318
411 Ga0070714_100052992
412 Ga0070714_100160768
413 Ga0070714_100375951
414 Ga0070713_100198683
415 Ga0070713_100213312
416 Ga0070713_100370967
417 Ga0070710_10069035
418 Ga0070711_100007224
419 Ga0070705_100008622
420 Ga0070705_100012223
421 Ga0070694_100021003
422 Ga0070694_100335484
423 Ga0070708_100045295
424 Ga0070708_100055599
425 Ga0070708_100069383
426 Ga0070663_100155138
427 Ga0070678_100060278
428 Ga0070681_10001709
429 Ga0070681_10035195
430 Ga0070681_10039287
431 Ga0070681_10051005
432 Ga0070681_10064995
433 Ga0070681_10219073
434 Ga0070681_10587840
435 Ga0070706_100053032
436 Ga0070698_100008318
437 Ga0070698_100127982
438 Ga0070698_100384894
439 Ga0070679_100037512
440 Ga0070679_100048841
441 Ga0070679_100382365
442 Ga0070684_100151143
443 Ga0070684_100205961
444 Ga0070697_100221486
445 Ga0070697_100331716
446 Ga0070695_100058351
447 Ga0070695_100306066
448 Ga0070665_100042352
449 Ga0070704_100078794
450 Ga0070704_100081194
451 Ga0068855_100018680
452 Ga0068855_100065446
453 Ga0068855_100084390
454 Ga0068855_100392666
455 Ga0068857_100131799
456 Ga0070702_100084784
457 Ga0068860_100337800
458 Ga0070717_10024637
459 Ga0070717_10142858
460 Ga0070717_10244568
461 Ga0070716_100224937
462 Ga0070712_100001232
463 Ga0070712_100003593
464 Ga0070712_100004988
465 Ga0070712_100015474
466 Ga0070712_100236713
467 Ga0075433_10007794
468 Ga0075434_100032367
469 Ga0075434_100116537
470 Ga0075436_100040706
471 Ga0075435_100003263
472 Ga0105240_10032835
473 Ga0105240_10035837
474 Ga0105240_10133776
475 Ga0105245_10079113
476 Ga0105245_10371140
477 Ga0114129_10008533
478 Ga0105243_10154378
479 Ga0105243_10253031
480 Ga0105241_10092889
481 Ga0105242_10122133
482 Ga0105242_10128518
483 Ga0105242_10403879
484 Ga0105248_10497570
485 Ga0105237_10031939
486 Ga0105237_10077071
487 Ga0105237_10313734
488 Ga0105238_10049779
489 Ga0105238_10061645
490 Ga0157373_10010996
491 Ga0157373_10128796
492 Ga0157371_10244860
493 Ga0157370_10127681
494 Ga0157369_10001378
495 Ga0157369_10005226
496 Ga0157369_10026867
497 Ga0157369_10046321
498 Ga0157369_10330227
499 Ga0157374_10063811
500 Ga0157374_10164832
501 Ga0157374_10381461
502 Ga0163162_10356529
503 Ga0157372_10024197
504 Ga0157372_10127906
505 Ga0157372_10875707
506 Ga0182008_10024536
507 Ga0157377_10088829
508 Ga0206356_10173385
509 Ga0206356_10886706
510 Ga0206356_11233123
511 Ga0206356_11690673
512 Ga0206353_10196820
513 Ga0207653_10011391
514 Ga0207692_10057935
515 Ga0207699_10056803
516 Ga0207705_10043788
517 Ga0207705_10402628
518 Ga0207684_10049740
519 Ga0207684_10085080
520 Ga0207684_10289403
521 Ga0207707_10002693
522 Ga0207707_10013337
523 Ga0207707_10219323
524 Ga0207695_10136140
525 Ga0207671_10135512
526 Ga0207693_10005497
527 Ga0207693_10048637
528 Ga0207693_10120138
529 Ga0207693_10217334
530 Ga0207663_10005881
531 Ga0207663_10036137
532 Ga0207660_10023020
533 Ga0207660_10075076
534 Ga0207657_10007423
535 Ga0207657_10009113
536 Ga0207657_10051949
537 Ga0207657_10164785
538 Ga0207652_10027330
539 Ga0207652_10112889
540 Ga0207646_10087288
541 Ga0207646_10111077
542 Ga0207646_10155903
543 Ga0207694_10295732
544 Ga0207700_10111881
545 Ga0207700_10185728
546 Ga0207664_10101695
547 Ga0207664_10129259
548 Ga0207690_10019596
549 Ga0207706_10093974
550 Ga0207709_10045675
551 Ga0207665_10082066
552 Ga0207665_10222981
553 Ga0207689_10096291
554 Ga0207661_10071703
555 Ga0207661_10094564
556 Ga0207667_10117660
557 Ga0207667_10208791
558 Ga0207667_10338211
559 Ga0207667_10410118
560 Ga0207667_10531001
561 Ga0207678_10092771
562 Ga0207708_10306458
563 Ga0207674_10148730
564 Ga0207683_10079570
565 Ga0207698_10268240
566 Ga0207698_10331031
567 Ga0265318_10045979
568 Ga0265338_10003592
569 Ga0265325_10039891
570 Ga0265331_10020491
571 Ga0265316_10003289
572 Ga0265313_10003727
573 Ga0265314_10007156
574 Ga0265342_10033916
575 Ga0307405_10026138
576 Ga0307416_100090677
577 Ga0373948_0004444
578 Ga0373959_0001133
579 Ga0373944_0032975
580 Ga0373949_0008287
581 Ga0373951_0048121
582 Ga0373932_0009258
583 Ga0373936_0013193
584 Ga0373943_0004051
585 Ga0373943_0015512
586 Ga0373961_0016670
587 Ga0373931_0002303
588 Ga0373933_0059574
589 Ga0373947_0000994
590 Ga0373947_0001247
591 Ga0373937_0021142
592 Ga0373925_0009046
593 Ga0373925_0039876
594 Ga0395899_0058804
595 Ga0395899_0061228
596 Ga0395899_0166735
597 Ga0395900_0008250
598 Ga0395900_0023739
599 Ga0395900_0083383
600 Ga0395900_0114351
601 Ga0395898_0002754
602 Ga0395898_0034205
603 Ga0395898_0050991
604 Ga0395898_0099884
605 Ga0395905_0006211
606 Ga0395905_0055040
607 Ga0395905_0293986
608 Ga0436364_0486127
609 Ga0395901_0000391
610 Ga0395901_0004254
611 Ga0395901_0012807
612 Ga0436365_1250681
613 Ga0436365_1368665
614 Ga0436365_1657686
615 Ga0436363_0141420
616 Ga0436362_0386219
617 Ga0451853_2786277
618 Ga0466966_0010915
619 Ga0466966_0078279
620 Ga0466961_0002155
621 Ga0466963_0000468
622 Ga0466963_0002921
623 Ga0466963_0013638
624 Ga0466963_0028518
625 Ga0466963_0052195
626 Ga0466963_0086760
627 Ga0466964_0010484
628 Ga0466971_0000500
629 Ga0466968_0006668
630 Ga0466968_0145245
631 Ga0466968_0172558
632 Ga0466970_0043351
633 Ga0466957_0000044
634 Ga0466957_0221376
635 Ga0466959_0024196
636 Ga0466959_0030514
637 Ga0466959_0161753
638 Ga0466958_0000364
639 Ga0466958_0004140
640 Ga0466958_0031487
641 Ga0466958_0053146
642 Ga0466967_0002274
643 Ga0466967_0017193
644 Ga0466967_0023479
645 Ga0466967_0033825
646 Ga0466967_0069219
647 Ga0466967_0076093
648 Ga0466967_0090940
649 Ga0466967_0103617
650 Ga0466967_0121560
651 Ga0466967_0178876
652 Ga0466967_0183360
653 Ga0466967_0270397
654 Ga0466967_0315801
655 Ga0466967_0411299
656 Ga0495592_0022080
657 Ga0495629_0007444
658 Ga0495641_0000612
659 Ga0495651_0023580
660 Ga0495651_0190779
661 Ga0495653_0064491
662 Ga0495653_0069820
663 Ga0495582_0000390
664 Ga0495639_0007714
665 Ga0495662_0000620
666 Ga0495664_0049549
667 Ga0495596_0169369
668 Ga0495608_0007427
669 Ga0495608_0069204
670 Ga0495630_0123617
671 Ga0495630_0188723
672 Ga0495630_0436584
673 Ga0495652_0067096
674 Ga0495652_0099038
675 Ga0495652_0256093
676 Ga0495665_0003370
677 Ga0495665_0131630
678 Ga0495640_0190829
679 Ga0495640_0195934
680 Ga0495645_0043776
681 Ga0495667_0135820
682 Ga0495635_0357498
683 Ga0495588_0051300
684 Ga0495657_0011898
685 Ga0495599_0042471
686 Ga0495647_0000934
687 Ga0495658_0000533
688 Ga0495658_0005205
689 Ga0495658_0086678
690 Ga0495613_0004198
691 Ga0495624_0030114
692 Ga0495581_0008754
693 Ga0495604_0032689
694 Ga0495604_0076242
695 Ga0495674_0013479
696 Ga0495674_0048248
697 Ga0495676_0012717
698 Ga0495680_0016079
699 Ga0495680_0054684
700 Ga0495680_0157618
701 Ga0495684_0012093
702 Ga0495593_0025181
703 Ga0495602_0120810
704 Ga0495614_0002623
705 Ga0496100_0005561
706 Ga0496100_0143643
707 Ga0496101_0001237
708 Ga0496101_0011377
709 Ga0496101_0016212
710 Ga0496101_0030621
711 Ga0496101_0030913
712 Ga0496102_0157191
713 Ga0496102_0179053
714 Ga0496102_0194867
715 Ga0496102_0293993
716 Ga0496102_0479882
717 Ga0496103_0012476
718 Ga0496103_0021787
719 Ga0496103_0031794
720 Ga0496103_0126204
721 Ga0496104_0010932
722 Ga0496105_0071922
723 Ga0496105_0111786
724 Ga0496106_0006502
725 Ga0496106_0026161
726 Ga0496106_0035326
727 Ga0496106_0359556
728 Ga0496107_0005792
729 Ga0496107_0006955
730 Ga0496108_0008642
731 Ga0496108_0108929
732 Ga0496108_0328294
733 Ga0496109_0003020
734 Ga0496109_0015224
735 Ga0496110_0023676
736 Ga0496110_0087718
737 Ga0496111_0014200
738 Ga0496111_0139366
739 Ga0496111_0235028
740 Ga0496111_0235950
741 Ga0496112_0013485
742 Ga0496112_0022766
743 Ga0496112_0103606
744 Ga0496112_0123375
745 Ga0496113_0137152
746 Ga0496113_0260972
747 Ga0496114_0005852
748 Ga0496114_0020517
749 Ga0496114_0028336
750 Ga0496114_0177813
751 Ga0496114_0397831
752 Ga0496115_0006179
753 Ga0496115_0008023
754 Ga0496115_0010548
755 Ga0496115_0038556
756 Ga0496115_0171458
757 Ga0501067_0000577
758 Ga0501067_0009039
759 Ga0501068_0093905
760 Ga0501069_0005801
761 Ga0501070_0000318
762 nmdc:mga05p37_17527_c1
763 nmdc:mga0n895_42338_c1
764 nmdc:mga0n895_9591_c1
765 nmdc:mga0rr50_1279_c1
766 nmdc:mga0rr50_38267_c1
767 nmdc:mga0rr50_7911_c1
768 nmdc:mga08x19_30842_c1
769 nmdc:mga0a205_2100_c2
770 nmdc:mga0a205_9456_c1
771 Ga0495595_0001870
772 Ga0495619_0009671
773 Ga0495619_0023071
774 Ga0495619_0026768
775 Ga0466962_0001476
776 Ga0466962_0088281

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04085

MreC

rod shape-determining protein MreC

172

334

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zm0-assembly1.cif.gz_AAA crystal structure of mrec from pseudomonas aeruginosa 0.8927 143 309
6zm0-assembly1.cif.gz_AAA crystal structure of mrec from pseudomonas aeruginosa 0.8713 143 309
2qf5-assembly1.cif.gz_A high resolution structure of the major periplasmic domain from the cell shape-determining filament mrec (monoclinic form) 0.8231 142 313
2qf4-assembly2.cif.gz_B high resolution structure of the major periplasmic domain from the cell shape-determining filament mrec (orthorhombic form) 0.8172 141 313
6zlv-assembly1.cif.gz_A mrec 0.8156 120 310
ID Description Score Start End Superfamily
2j5uB02 Mainly Beta;Beta Barrel;Thrombin, subunit H;Rod shape-determining protein MreC, domain 1 0.8809 143 211 2.40.10.340
af_Q2FXS6_104_165_2.40.10.340 Mainly Beta;Beta Barrel;Thrombin, subunit H;Rod shape-determining protein MreC, domain 1 0.8559 142 206 2.40.10.340
2qf4A01 Mainly Beta;Beta Barrel;Thrombin, subunit H;Rod shape-determining protein MreC, domain 1 0.8519 142 207 2.40.10.340
2j5uB03 Mainly Beta;Beta Barrel;Thrombin, subunit H;Rod shape-determining protein MreC, domain 2 0.8156 214 297 2.40.10.350
2j5uB03 Mainly Beta;Beta Barrel;Thrombin, subunit H;Rod shape-determining protein MreC, domain 2 0.8063 214 297 2.40.10.350
ID Description Score Start End GO Terms
AF-A0A524IZK7-F1-model_v4 Rod shape-determining protein MreC 0.946 188 304 GO:0005886
GO:0008360
AF-A0A535X7T1-F1-model_v4 Cell shape-determining protein MreC (Cell shape protein MreC) 0.9261 162 314 GO:0005886
GO:0008360
AF-A0A3L7W5I2-F1-model_v4 Cell shape-determining protein MreC 0.9233 188 303 GO:0005886
GO:0008360
AF-A0A7W0N3Y0-F1-model_v4 Cell shape-determining protein MreC 0.9161 204 303 GO:0005886
GO:0008360
AF-A0A2M7U627-F1-model_v4 Cell shape-determining protein MreC (Cell shape protein MreC) 0.9139 142 310 GO:0005886
GO:0008360

Map