F431185

General Info

Members Datasets Scaffolds Average Seq Length
388 194 776 169

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1671184|Ga0436365_1671184_279_896
Length 205
Sequence MFQEDTFEAMRFRMASQQRLLFWLFRGSFLSRISAAFRSFFSLLFSGVLPEDVALAFGFVKTTPAPVAPPVETVKVKVSDGALQILSILQRDSRLIDFLMEDIAGFSDDQIGAAVRSLHSDCKATLARHVTLSPVIDGVEGTYQQLDISKSPDPNRFKLIGNVPASGKVQGGTLRHRGWKAVAVELPVLGKQDASIIAPAELEVE

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
111 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
115 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
116 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
118 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
188 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 2.58
Rhizosphere 89.95
Stem 0
Stem Tuber 0
Unclassified 18.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1671184 3300039437 Bacteria 1051
2 Ga0070658_10028952 3300005327 Bacteria 4447
3 Ga0070658_10386059 3300005327 Bacteria 1202
4 Ga0070666_10210473 3300005335 Bacteria 1369
5 Ga0070680_100011368 3300005336 Bacteria 6885
6 Ga0070682_100124601 3300005337 Bacteria 1735
7 Ga0070660_100033071 3300005339 Bacteria 3895
8 Ga0070660_100040817 3300005339 Bacteria 3534
9 Ga0070691_10155754 3300005341 Bacteria 1174
10 Ga0070687_100623411 3300005343 Unclassified 744
11 Ga0070661_100556475 3300005344 Bacteria 923
12 Ga0070661_100562132 3300005344 Bacteria 919
13 Ga0070661_100742723 3300005344 Bacteria 802
14 Ga0070692_10096885 3300005345 Bacteria 1612
15 Ga0070674_100368611 3300005356 Bacteria 1165
16 Ga0070659_100150846 3300005366 Bacteria 1896
17 Ga0070709_10154068 3300005434 Bacteria 1591
18 Ga0070713_101621155 3300005436 Unclassified 628
19 Ga0070711_100143164 3300005439 Unclassified 1795
20 Ga0070711_100453061 3300005439 Bacteria 1051
21 Ga0070663_100270286 3300005455 Unclassified 1351
22 Ga0070663_100375268 3300005455 Bacteria 1157
23 Ga0070681_10197984 3300005458 Unclassified 1928
24 Ga0070679_100145949 3300005530 Bacteria 2344
25 Ga0070679_100518225 3300005530 Bacteria 1136
26 Ga0070679_100603732 3300005530 Unclassified 1041
27 Ga0070684_100000003 3300005535 Bacteria 248527
28 Ga0070684_100313326 3300005535 Bacteria 1441
29 Ga0070684_100414975 3300005535 Bacteria 1242
30 Ga0068853_100027285 3300005539 Bacteria 4797
31 Ga0068853_100278766 3300005539 Bacteria 1541
32 Ga0070686_100753128 3300005544 Bacteria 781
33 Ga0070665_100624953 3300005548 Bacteria 1090
34 Ga0068855_100013771 3300005563 Bacteria 9749
35 Ga0068855_100014239 3300005563 Bacteria 9581
36 Ga0068855_100153699 3300005563 Bacteria 2615
37 Ga0068855_100611611 3300005563 Bacteria 1174
38 Ga0068855_100635721 3300005563 Bacteria 1148
39 Ga0070664_100053970 3300005564 Bacteria 3409
40 Ga0070664_100868042 3300005564 Bacteria 845
41 Ga0070664_101503399 3300005564 Unclassified 637
42 Ga0068857_100003455 3300005577 Bacteria 13177
43 Ga0068857_100943940 3300005577 Unclassified 828
44 Ga0068854_100810143 3300005578 Unclassified 817
45 Ga0068856_100005743 3300005614 Bacteria 12227
46 Ga0068856_100055629 3300005614 Bacteria 3905
47 Ga0068856_100059971 3300005614 Bacteria 3759
48 Ga0068856_100103917 3300005614 Unclassified 2834
49 Ga0068852_100091701 3300005616 Bacteria 2720
50 Ga0068852_100606729 3300005616 Bacteria 1099
51 Ga0068859_100642162 3300005617 Bacteria 1154
52 Ga0068864_100471395 3300005618 Unclassified 1204
53 Ga0068864_101794273 3300005618 Unclassified 619
54 Ga0068864_101880166 3300005618 Bacteria 604
55 Ga0068863_100280950 3300005841 Bacteria 1613
56 Ga0068863_100389725 3300005841 Unclassified 1361
57 Ga0068863_100393764 3300005841 Bacteria 1354
58 Ga0068863_100586841 3300005841 Bacteria 1102
59 Ga0068863_100606226 3300005841 Unclassified 1084
60 Ga0068863_101663950 3300005841 Bacteria 648
61 Ga0081455_10028628 3300005937 Bacteria 5089
62 Ga0070717_10050586 3300006028 Bacteria 3416
63 Ga0070717_10086440 3300006028 Bacteria 2639
64 Ga0070717_10420654 3300006028 Bacteria 1202
65 Ga0070717_10557546 3300006028 Bacteria 1038
66 Ga0070712_101339028 3300006175 Bacteria 624
67 Ga0097621_100024484 3300006237 Bacteria 4715
68 Ga0097621_100029971 3300006237 Bacteria 4302
69 Ga0097621_100073209 3300006237 Bacteria 2836
70 Ga0097621_100103532 3300006237 Bacteria 2398
71 Ga0097621_100281896 3300006237 Bacteria 1463
72 Ga0097621_100341272 3300006237 Bacteria 1330
73 Ga0068871_100034948 3300006358 Bacteria 3991
74 Ga0068871_100089922 3300006358 Bacteria 2556
75 Ga0068871_100092000 3300006358 Bacteria 2529
76 Ga0068871_100105651 3300006358 Bacteria 2363
77 Ga0097620_100642140 3300006931 Bacteria 1154
78 Ga0105240_10005568 3300009093 Bacteria 18724
79 Ga0105240_10140114 3300009093 Bacteria 2892
80 Ga0105240_10414898 3300009093 Unclassified 1514
81 Ga0105240_10455417 3300009093 Bacteria 1431
82 Ga0111539_10956953 3300009094 Bacteria 996
83 Ga0105245_10011946 3300009098 Bacteria 7549
84 Ga0105245_10587077 3300009098 Bacteria 1139
85 Ga0105247_10228309 3300009101 Bacteria 1263
86 Ga0105241_10001262 3300009174 Bacteria 19295
87 Ga0105241_11536914 3300009174 Bacteria 642
88 Ga0105242_10005085 3300009176 Bacteria 10157
89 Ga0105242_10026637 3300009176 Unclassified 4583
90 Ga0105242_10073332 3300009176 Bacteria 2845
91 Ga0105242_10546162 3300009176 Bacteria 1110
92 Ga0105248_10064404 3300009177 Bacteria 4116
93 Ga0105248_10078189 3300009177 Bacteria 3720
94 Ga0105248_10169588 3300009177 Bacteria 2460
95 Ga0105248_10409501 3300009177 Bacteria 1527
96 Ga0105248_10731471 3300009177 Bacteria 1116
97 Ga0105248_10872357 3300009177 Bacteria 1016
98 Ga0105237_10007531 3300009545 Bacteria 11895
99 Ga0105237_10045921 3300009545 Bacteria 4395
100 Ga0105237_10381093 3300009545 Bacteria 1415
101 Ga0105238_10000394 3300009551 Bacteria 46531
102 Ga0105238_10104005 3300009551 Bacteria 2821
103 Ga0105238_10218728 3300009551 Bacteria 1881
104 Ga0105238_10972611 3300009551 Unclassified 869
105 Ga0105238_11318439 3300009551 Bacteria 748
106 Ga0105249_11601901 3300009553 Bacteria 724
107 Ga0105239_10014670 3300010375 Bacteria 8689
108 Ga0105239_10127574 3300010375 Bacteria 2828
109 Ga0105239_10172691 3300010375 Bacteria 2417
110 Ga0105239_10369496 3300010375 Bacteria 1621
111 Ga0105239_10389950 3300010375 Bacteria 1575
112 Ga0105239_10647260 3300010375 Unclassified 1207
113 Ga0105246_10198390 3300011119 Bacteria 1558
114 Ga0105246_10939668 3300011119 Unclassified 778
115 Ga0105246_11282504 3300011119 Bacteria 678
116 Ga0157373_10084848 3300013100 Unclassified 2232
117 Ga0157371_10838484 3300013102 Unclassified 694
118 Ga0157370_10019673 3300013104 Bacteria 6761
119 Ga0157370_10050178 3300013104 Bacteria 3989
120 Ga0157370_10108335 3300013104 Bacteria 2598
121 Ga0157369_10006606 3300013105 Bacteria 13416
122 Ga0157369_10032651 3300013105 Bacteria 5722
123 Ga0157369_10300713 3300013105 Unclassified 1669
124 Ga0157374_10075769 3300013296 Bacteria 3179
125 Ga0157374_10147517 3300013296 Bacteria 2286
126 Ga0157374_10155458 3300013296 Bacteria 2225
127 Ga0157374_10195487 3300013296 Bacteria 1979
128 Ga0157374_10621642 3300013296 Bacteria 1091
129 Ga0157374_10790659 3300013296 Bacteria 964
130 Ga0157378_10040038 3300013297 Bacteria 4156
131 Ga0157378_10093520 3300013297 Bacteria 2737
132 Ga0157378_11455496 3300013297 Bacteria 729
133 Ga0163162_10008263 3300013306 Bacteria 10158
134 Ga0157372_10089665 3300013307 Bacteria 3494
135 Ga0157372_10146918 3300013307 Bacteria 2719
136 Ga0157372_10251157 3300013307 Bacteria 2053
137 Ga0157372_10296135 3300013307 Bacteria 1882
138 Ga0157372_10359799 3300013307 Bacteria 1696
139 Ga0157375_10030910 3300013308 Bacteria 5055
140 Ga0157375_10255354 3300013308 Bacteria 1914
141 Ga0163163_10005148 3300014325 Bacteria 11271
142 Ga0163163_10012516 3300014325 Bacteria 7735
143 Ga0157380_10521493 3300014326 Unclassified 1159
144 Ga0157379_10278310 3300014968 Bacteria 1522
145 Ga0157376_10261315 3300014969 Bacteria 1622
146 Ga0157376_10600442 3300014969 Bacteria 1095
147 Ga0157376_11167196 3300014969 Bacteria 797
148 Ga0157376_11255132 3300014969 Unclassified 770
149 Ga0213875_10008246 3300021388 Bacteria 5344
150 Ga0213875_10010439 3300021388 Bacteria 4646
151 Ga0213875_10043446 3300021388 Bacteria 2111
152 Ga0224712_10281191 3300022467 Bacteria 774
153 Ga0207692_10548235 3300025898 Unclassified 738
154 Ga0207680_10281736 3300025903 Bacteria 1155
155 Ga0207685_10156537 3300025905 Unclassified 1036
156 Ga0207699_10156727 3300025906 Unclassified 1512
157 Ga0207699_10401063 3300025906 Bacteria 977
158 Ga0207705_10024720 3300025909 Bacteria 4287
159 Ga0207654_10172506 3300025911 Bacteria 1405
160 Ga0207654_10217321 3300025911 Bacteria 1266
161 Ga0207707_10106288 3300025912 Unclassified 2453
162 Ga0207695_10013738 3300025913 Bacteria 9634
163 Ga0207671_10774809 3300025914 Bacteria 761
164 Ga0207663_10084430 3300025916 Unclassified 2089
165 Ga0207663_10656253 3300025916 Bacteria 828
166 Ga0207660_10065356 3300025917 Unclassified 2629
167 Ga0207657_10003464 3300025919 Bacteria 16835
168 Ga0207657_10056971 3300025919 Bacteria 3370
169 Ga0207649_10069046 3300025920 Bacteria 2249
170 Ga0207652_10169764 3300025921 Unclassified 1957
171 Ga0207681_11264830 3300025923 Unclassified 620
172 Ga0207694_10050693 3300025924 Bacteria 3216
173 Ga0207694_10074887 3300025924 Bacteria 2649
174 Ga0207694_10079739 3300025924 Bacteria 2568
175 Ga0207694_10454742 3300025924 Bacteria 1069
176 Ga0207694_10710287 3300025924 Bacteria 848
177 Ga0207659_10614776 3300025926 Bacteria 927
178 Ga0207659_10807285 3300025926 Unclassified 806
179 Ga0207687_10287633 3300025927 Bacteria 1320
180 Ga0207687_10926949 3300025927 Bacteria 746
181 Ga0207700_10013908 3300025928 Bacteria 5258
182 Ga0207700_10377993 3300025928 Unclassified 1238
183 Ga0207644_10043044 3300025931 Bacteria 3203
184 Ga0207690_10168666 3300025932 Bacteria 1638
185 Ga0207686_10146272 3300025934 Unclassified 1640
186 Ga0207704_10670746 3300025938 Unclassified 856
187 Ga0207711_10038016 3300025941 Unclassified 4092
188 Ga0207711_10183041 3300025941 Unclassified 1906
189 Ga0207711_10289970 3300025941 Bacteria 1508
190 Ga0207661_10000019 3300025944 Bacteria 235900
191 Ga0207661_10031761 3300025944 Unclassified 4084
192 Ga0207661_10470994 3300025944 Bacteria 1146
193 Ga0207679_10123384 3300025945 Bacteria 2066
194 Ga0207679_10156051 3300025945 Bacteria 1864
195 Ga0207667_10026697 3300025949 Bacteria 6304
196 Ga0207667_10028972 3300025949 Bacteria 6010
197 Ga0207667_10036620 3300025949 Bacteria 5256
198 Ga0207667_10103301 3300025949 Bacteria 2940
199 Ga0207667_10404280 3300025949 Bacteria 1390
200 Ga0207667_10597246 3300025949 Bacteria 1113
201 Ga0207640_10076127 3300025981 Bacteria 2276
202 Ga0207640_10233399 3300025981 Unclassified 1417
203 Ga0207640_10570965 3300025981 Unclassified 953
204 Ga0207658_10570695 3300025986 Unclassified 1014
205 Ga0207677_10600473 3300026023 Bacteria 966
206 Ga0207703_10041316 3300026035 Bacteria 3694
207 Ga0207703_10082368 3300026035 Bacteria 2685
208 Ga0207703_10241512 3300026035 Bacteria 1624
209 Ga0207703_11489767 3300026035 Bacteria 651
210 Ga0207639_10123441 3300026041 Bacteria 2132
211 Ga0207639_10510664 3300026041 Bacteria 1099
212 Ga0207639_10698120 3300026041 Bacteria 941
213 Ga0207678_10380354 3300026067 Bacteria 1220
214 Ga0207702_10028834 3300026078 Bacteria 4616
215 Ga0207702_10032051 3300026078 Bacteria 4384
216 Ga0207702_10045054 3300026078 Bacteria 3711
217 Ga0207702_10055836 3300026078 Bacteria 3350
218 Ga0207641_10156436 3300026088 Unclassified 2068
219 Ga0207641_10165113 3300026088 Unclassified 2016
220 Ga0207641_10990090 3300026088 Unclassified 837
221 Ga0207648_10193334 3300026089 Bacteria 1804
222 Ga0207676_10725655 3300026095 Unclassified 965
223 Ga0207674_10000823 3300026116 Bacteria 40325
224 Ga0207674_10333106 3300026116 Bacteria 1468
225 Ga0207698_10240296 3300026142 Bacteria 1650
226 Ga0268266_10039150 3300028379 Bacteria 4037
227 Ga0268266_11131559 3300028379 Unclassified 757
228 Ga0268264_11283888 3300028381 Bacteria 742
229 Ga0265338_10357164 3300028800 Unclassified 1049
230 Ga0265760_10029372 3300031090 Bacteria 1616
231 Ga0265760_10105408 3300031090 Bacteria 894
232 Ga0265332_10026050 3300031238 Bacteria 2566
233 Ga0265325_10003158 3300031241 Bacteria 10833
234 Ga0265325_10062464 3300031241 Bacteria 1887
235 Ga0265325_10214357 3300031241 Bacteria 883
236 Ga0265316_10011871 3300031344 Bacteria 7835
237 Ga0265316_10141534 3300031344 Unclassified 1806
238 Ga0265316_10362108 3300031344 Bacteria 1048
239 Ga0265313_10051800 3300031595 Bacteria 1962
240 Ga0265314_10053067 3300031711 Bacteria 2814
241 Ga0265342_10279261 3300031712 Bacteria 884
242 Ga0265342_10408126 3300031712 Unclassified 701
243 Ga0373926_0037051 3300035083 Bacteria 1734
244 Ga0373944_0157727 3300035089 Bacteria 803
245 Ga0373923_0053617 3300035111 Bacteria 1696
246 Ga0373923_0098104 3300035111 Unclassified 1289
247 Ga0373923_0447785 3300035111 Bacteria 626
248 Ga0373945_0229573 3300035116 Bacteria 778
249 Ga0373953_0562815 3300035117 Unclassified 507
250 Ga0373943_0005196 3300035170 Bacteria 5858
251 Ga0373943_0271532 3300035170 Bacteria 957
252 Ga0373946_0073249 3300035171 Bacteria 1484
253 Ga0373955_0042742 3300035172 Bacteria 2435
254 Ga0373955_0362983 3300035172 Bacteria 878
255 Ga0373955_0714371 3300035172 Unclassified 615
256 Ga0373924_0184203 3300035410 Bacteria 919
257 Ga0373935_0253535 3300035692 Bacteria 1232
258 Ga0373935_0374645 3300035692 Bacteria 1018
259 Ga0373927_0000309 3300035695 Bacteria 38392
260 Ga0373927_0560634 3300035695 Unclassified 755
261 Ga0373933_0536837 3300035724 Bacteria 767
262 Ga0373947_0054866 3300035725 Bacteria 2406
263 Ga0373947_0119988 3300035725 Bacteria 1669
264 Ga0373947_0358404 3300035725 Bacteria 979
265 Ga0373947_0535082 3300035725 Bacteria 797
266 Ga0373937_0090307 3300036401 Bacteria 2837
267 Ga0373937_0114011 3300036401 Bacteria 2516
268 Ga0373937_0233909 3300036401 Bacteria 1731
269 Ga0373937_0849218 3300036401 Bacteria 861
270 Ga0373937_1151089 3300036401 Bacteria 724
271 Ga0373925_0007049 3300037068 Bacteria 8213
272 Ga0373925_0341017 3300037068 Bacteria 1215
273 Ga0373925_0787383 3300037068 Unclassified 784
274 Ga0373925_0796536 3300037068 Unclassified 779
275 Ga0395900_0053177 3300037418 Bacteria 4168
276 Ga0395898_0104678 3300037466 Bacteria 2714
277 Ga0395905_0325912 3300037471 Bacteria 1426
278 Ga0436364_0276676 3300037853 Bacteria 2145
279 Ga0436364_0403656 3300037853 Bacteria 3558
280 Ga0436364_0648150 3300037853 Bacteria 867
281 Ga0436364_0682357 3300037853 Bacteria 3392
282 Ga0436364_0696479 3300037853 Bacteria 1275
283 Ga0436364_0776554 3300037853 Unclassified 854
284 Ga0436364_0909827 3300037853 Unclassified 805
285 Ga0436364_1125725 3300037853 Bacteria 6525
286 Ga0436364_1296268 3300037853 Bacteria 1904
287 Ga0436364_1322907 3300037853 Bacteria 6819
288 Ga0436364_1497381 3300037853 Bacteria 2966
289 Ga0436364_1515263 3300037853 Bacteria 11597
290 Ga0436364_1523939 3300037853 Bacteria 3445
291 Ga0436364_1556058 3300037853 Bacteria 18341
292 Ga0395901_0384691 3300038443 Bacteria 1444
293 Ga0436365_0415802 3300039437 Bacteria 855
294 Ga0436365_0843912 3300039437 Unclassified 764
295 Ga0436365_0915848 3300039437 Bacteria 5452
296 Ga0436365_0921004 3300039437 Unclassified 2339
297 Ga0436365_1021718 3300039437 Bacteria 3028
298 Ga0436365_1158595 3300039437 Bacteria 4067
299 Ga0436365_1671027 3300039437 Bacteria 6106
300 Ga0436363_0567159 3300039450 Bacteria 1346
301 Ga0436363_1263661 3300039450 Bacteria 5354
302 Ga0436363_1567935 3300039450 Unclassified 687
303 Ga0466966_0102220 3300044684 Bacteria 1772
304 Ga0453684_0114078 3300044712 Bacteria 3277
305 Ga0453684_0311420 3300044712 Bacteria 1786
306 Ga0466960_0067620 3300044901 Unclassified 1770
307 Ga0466959_0073484 3300045049 Bacteria 2474
308 Ga0466959_0280947 3300045049 Bacteria 1143
309 Ga0451576_0097313 3300045051 Unclassified 3061
310 Ga0466958_0506829 3300045836 Bacteria 783
311 Ga0466967_0703845 3300045976 Bacteria 1001
312 Ga0495592_0309122 3300046454 Bacteria 1025
313 Ga0495651_0184638 3300046462 Bacteria 1473
314 Ga0495653_0473190 3300046463 Bacteria 785
315 Ga0495580_0041493 3300046472 Bacteria 3282
316 Ga0495580_0081837 3300046472 Bacteria 2250
317 Ga0495580_0135088 3300046472 Bacteria 1710
318 Ga0495580_0146330 3300046472 Unclassified 1638
319 Ga0495580_0154576 3300046472 Unclassified 1589
320 Ga0495580_0179908 3300046472 Unclassified 1460
321 Ga0495582_0071829 3300046473 Bacteria 1915
322 Ga0495582_0230903 3300046473 Bacteria 1059
323 Ga0495664_0080195 3300046477 Bacteria 1956
324 Ga0495594_0046499 3300046499 Bacteria 2384
325 Ga0495594_0262710 3300046499 Bacteria 983
326 Ga0495628_0257918 3300046516 Bacteria 1300
327 Ga0495666_0061949 3300046526 Bacteria 1787
328 Ga0495665_0031777 3300046531 Bacteria 2825
329 Ga0495665_0231734 3300046531 Bacteria 953
330 Ga0495640_0248617 3300046533 Bacteria 1114
331 Ga0495586_0412812 3300046535 Bacteria 777
332 Ga0495645_0279657 3300046543 Bacteria 1098
333 Ga0495667_0134736 3300046559 Bacteria 1592
334 Ga0495634_0497720 3300046642 Bacteria 715
335 Ga0495635_0043017 3300046663 Bacteria 3118
336 Ga0495635_0183046 3300046663 Bacteria 1424
337 Ga0495588_0287835 3300046674 Unclassified 866
338 Ga0495599_0449613 3300046678 Unclassified 763
339 Ga0495623_0087902 3300046679 Bacteria 1914
340 Ga0495647_0339143 3300046681 Bacteria 683
341 Ga0495658_0110490 3300046683 Bacteria 1652
342 Ga0495624_0205131 3300046690 Bacteria 1197
343 Ga0495604_0024469 3300047317 Bacteria 4818
344 Ga0495604_0376206 3300047317 Bacteria 939
345 Ga0495604_0640215 3300047317 Bacteria 679
346 Ga0495636_0383138 3300047318 Bacteria 668
347 Ga0495674_0111130 3300047319 Bacteria 2323
348 Ga0495674_0949138 3300047319 Bacteria 661
349 Ga0495680_0304746 3300047322 Bacteria 1118
350 Ga0495680_0345404 3300047322 Bacteria 1037
351 Ga0495675_0193689 3300047444 Bacteria 1240
352 Ga0495684_0013693 3300047471 Bacteria 6246
353 Ga0495684_0218149 3300047471 Bacteria 1400
354 Ga0495593_0467706 3300047673 Bacteria 631
355 Ga0495602_0145943 3300048088 Bacteria 1867
356 Ga0495602_0204010 3300048088 Bacteria 1506
357 Ga0495602_0348234 3300048088 Bacteria 1070
358 Ga0496104_0428340 3300048907 Unclassified 1235
359 Ga0496104_0438130 3300048907 Bacteria 1219
360 Ga0496104_0548411 3300048907 Unclassified 1067
361 Ga0496105_0478727 3300048908 Bacteria 980
362 Ga0496108_0910603 3300048911 Unclassified 754
363 Ga0496109_0525338 3300048912 Unclassified 1117
364 Ga0496112_0015009 3300048915 Bacteria 7212
365 Ga0496112_0393570 3300048915 Bacteria 1326
366 Ga0496114_0290229 3300048917 Bacteria 1443
367 Ga0496115_0026922 3300048918 Bacteria 4493
368 Ga0501034_0036284 3300049571 Bacteria 4994
369 Ga0501037_0033462 3300049573 Bacteria 3796
370 Ga0501038_0078724 3300049574 Bacteria 2781
371 Ga0501043_0028461 3300049579 Bacteria 4387
372 Ga0501047_0036803 3300049581 Bacteria 4731
373 Ga0501047_0134427 3300049581 Bacteria 2353
374 Ga0501048_0074176 3300049582 Bacteria 2401
375 Ga0501048_0321268 3300049582 Bacteria 1103
376 Ga0501073_0042031 3300049589 Bacteria 3228
377 Ga0501073_0281312 3300049589 Bacteria 1148
378 Ga0501074_0122980 3300049590 Bacteria 1856
379 Ga0501249_048217 3300049679 Bacteria 975
380 Ga0501270_013625 3300049767 Bacteria 1131
381 Ga0501035_0040176 3300049822 Bacteria 4229
382 Ga0501044_0000391 3300049823 Bacteria 54344
383 Ga0501044_0001179 3300049823 Bacteria 30978
384 Ga0501044_0035052 3300049823 Bacteria 5257
385 Ga0495619_0523539 3300053085 Bacteria 814
386 Ga0500568_0001432 3300053139 Bacteria 15454
387 Ga0501082_0000052 3300060353 Bacteria 83141
388 Ga0466962_0371869 3300061719 Bacteria 713
389 Ga0436365_1671184
390 Ga0070658_10028952
391 Ga0070658_10386059
392 Ga0070666_10210473
393 Ga0070680_100011368
394 Ga0070682_100124601
395 Ga0070660_100033071
396 Ga0070660_100040817
397 Ga0070691_10155754
398 Ga0070687_100623411
399 Ga0070661_100556475
400 Ga0070661_100562132
401 Ga0070661_100742723
402 Ga0070692_10096885
403 Ga0070674_100368611
404 Ga0070659_100150846
405 Ga0070709_10154068
406 Ga0070713_101621155
407 Ga0070711_100143164
408 Ga0070711_100453061
409 Ga0070663_100270286
410 Ga0070663_100375268
411 Ga0070681_10197984
412 Ga0070679_100145949
413 Ga0070679_100518225
414 Ga0070679_100603732
415 Ga0070684_100000003
416 Ga0070684_100313326
417 Ga0070684_100414975
418 Ga0068853_100027285
419 Ga0068853_100278766
420 Ga0070686_100753128
421 Ga0070665_100624953
422 Ga0068855_100013771
423 Ga0068855_100014239
424 Ga0068855_100153699
425 Ga0068855_100611611
426 Ga0068855_100635721
427 Ga0070664_100053970
428 Ga0070664_100868042
429 Ga0070664_101503399
430 Ga0068857_100003455
431 Ga0068857_100943940
432 Ga0068854_100810143
433 Ga0068856_100005743
434 Ga0068856_100055629
435 Ga0068856_100059971
436 Ga0068856_100103917
437 Ga0068852_100091701
438 Ga0068852_100606729
439 Ga0068859_100642162
440 Ga0068864_100471395
441 Ga0068864_101794273
442 Ga0068864_101880166
443 Ga0068863_100280950
444 Ga0068863_100389725
445 Ga0068863_100393764
446 Ga0068863_100586841
447 Ga0068863_100606226
448 Ga0068863_101663950
449 Ga0081455_10028628
450 Ga0070717_10050586
451 Ga0070717_10086440
452 Ga0070717_10420654
453 Ga0070717_10557546
454 Ga0070712_101339028
455 Ga0097621_100024484
456 Ga0097621_100029971
457 Ga0097621_100073209
458 Ga0097621_100103532
459 Ga0097621_100281896
460 Ga0097621_100341272
461 Ga0068871_100034948
462 Ga0068871_100089922
463 Ga0068871_100092000
464 Ga0068871_100105651
465 Ga0097620_100642140
466 Ga0105240_10005568
467 Ga0105240_10140114
468 Ga0105240_10414898
469 Ga0105240_10455417
470 Ga0111539_10956953
471 Ga0105245_10011946
472 Ga0105245_10587077
473 Ga0105247_10228309
474 Ga0105241_10001262
475 Ga0105241_11536914
476 Ga0105242_10005085
477 Ga0105242_10026637
478 Ga0105242_10073332
479 Ga0105242_10546162
480 Ga0105248_10064404
481 Ga0105248_10078189
482 Ga0105248_10169588
483 Ga0105248_10409501
484 Ga0105248_10731471
485 Ga0105248_10872357
486 Ga0105237_10007531
487 Ga0105237_10045921
488 Ga0105237_10381093
489 Ga0105238_10000394
490 Ga0105238_10104005
491 Ga0105238_10218728
492 Ga0105238_10972611
493 Ga0105238_11318439
494 Ga0105249_11601901
495 Ga0105239_10014670
496 Ga0105239_10127574
497 Ga0105239_10172691
498 Ga0105239_10369496
499 Ga0105239_10389950
500 Ga0105239_10647260
501 Ga0105246_10198390
502 Ga0105246_10939668
503 Ga0105246_11282504
504 Ga0157373_10084848
505 Ga0157371_10838484
506 Ga0157370_10019673
507 Ga0157370_10050178
508 Ga0157370_10108335
509 Ga0157369_10006606
510 Ga0157369_10032651
511 Ga0157369_10300713
512 Ga0157374_10075769
513 Ga0157374_10147517
514 Ga0157374_10155458
515 Ga0157374_10195487
516 Ga0157374_10621642
517 Ga0157374_10790659
518 Ga0157378_10040038
519 Ga0157378_10093520
520 Ga0157378_11455496
521 Ga0163162_10008263
522 Ga0157372_10089665
523 Ga0157372_10146918
524 Ga0157372_10251157
525 Ga0157372_10296135
526 Ga0157372_10359799
527 Ga0157375_10030910
528 Ga0157375_10255354
529 Ga0163163_10005148
530 Ga0163163_10012516
531 Ga0157380_10521493
532 Ga0157379_10278310
533 Ga0157376_10261315
534 Ga0157376_10600442
535 Ga0157376_11167196
536 Ga0157376_11255132
537 Ga0213875_10008246
538 Ga0213875_10010439
539 Ga0213875_10043446
540 Ga0224712_10281191
541 Ga0207692_10548235
542 Ga0207680_10281736
543 Ga0207685_10156537
544 Ga0207699_10156727
545 Ga0207699_10401063
546 Ga0207705_10024720
547 Ga0207654_10172506
548 Ga0207654_10217321
549 Ga0207707_10106288
550 Ga0207695_10013738
551 Ga0207671_10774809
552 Ga0207663_10084430
553 Ga0207663_10656253
554 Ga0207660_10065356
555 Ga0207657_10003464
556 Ga0207657_10056971
557 Ga0207649_10069046
558 Ga0207652_10169764
559 Ga0207681_11264830
560 Ga0207694_10050693
561 Ga0207694_10074887
562 Ga0207694_10079739
563 Ga0207694_10454742
564 Ga0207694_10710287
565 Ga0207659_10614776
566 Ga0207659_10807285
567 Ga0207687_10287633
568 Ga0207687_10926949
569 Ga0207700_10013908
570 Ga0207700_10377993
571 Ga0207644_10043044
572 Ga0207690_10168666
573 Ga0207686_10146272
574 Ga0207704_10670746
575 Ga0207711_10038016
576 Ga0207711_10183041
577 Ga0207711_10289970
578 Ga0207661_10000019
579 Ga0207661_10031761
580 Ga0207661_10470994
581 Ga0207679_10123384
582 Ga0207679_10156051
583 Ga0207667_10026697
584 Ga0207667_10028972
585 Ga0207667_10036620
586 Ga0207667_10103301
587 Ga0207667_10404280
588 Ga0207667_10597246
589 Ga0207640_10076127
590 Ga0207640_10233399
591 Ga0207640_10570965
592 Ga0207658_10570695
593 Ga0207677_10600473
594 Ga0207703_10041316
595 Ga0207703_10082368
596 Ga0207703_10241512
597 Ga0207703_11489767
598 Ga0207639_10123441
599 Ga0207639_10510664
600 Ga0207639_10698120
601 Ga0207678_10380354
602 Ga0207702_10028834
603 Ga0207702_10032051
604 Ga0207702_10045054
605 Ga0207702_10055836
606 Ga0207641_10156436
607 Ga0207641_10165113
608 Ga0207641_10990090
609 Ga0207648_10193334
610 Ga0207676_10725655
611 Ga0207674_10000823
612 Ga0207674_10333106
613 Ga0207698_10240296
614 Ga0268266_10039150
615 Ga0268266_11131559
616 Ga0268264_11283888
617 Ga0265338_10357164
618 Ga0265760_10029372
619 Ga0265760_10105408
620 Ga0265332_10026050
621 Ga0265325_10003158
622 Ga0265325_10062464
623 Ga0265325_10214357
624 Ga0265316_10011871
625 Ga0265316_10141534
626 Ga0265316_10362108
627 Ga0265313_10051800
628 Ga0265314_10053067
629 Ga0265342_10279261
630 Ga0265342_10408126
631 Ga0373926_0037051
632 Ga0373944_0157727
633 Ga0373923_0053617
634 Ga0373923_0098104
635 Ga0373923_0447785
636 Ga0373945_0229573
637 Ga0373953_0562815
638 Ga0373943_0005196
639 Ga0373943_0271532
640 Ga0373946_0073249
641 Ga0373955_0042742
642 Ga0373955_0362983
643 Ga0373955_0714371
644 Ga0373924_0184203
645 Ga0373935_0253535
646 Ga0373935_0374645
647 Ga0373927_0000309
648 Ga0373927_0560634
649 Ga0373933_0536837
650 Ga0373947_0054866
651 Ga0373947_0119988
652 Ga0373947_0358404
653 Ga0373947_0535082
654 Ga0373937_0090307
655 Ga0373937_0114011
656 Ga0373937_0233909
657 Ga0373937_0849218
658 Ga0373937_1151089
659 Ga0373925_0007049
660 Ga0373925_0341017
661 Ga0373925_0787383
662 Ga0373925_0796536
663 Ga0395900_0053177
664 Ga0395898_0104678
665 Ga0395905_0325912
666 Ga0436364_0276676
667 Ga0436364_0403656
668 Ga0436364_0648150
669 Ga0436364_0682357
670 Ga0436364_0696479
671 Ga0436364_0776554
672 Ga0436364_0909827
673 Ga0436364_1125725
674 Ga0436364_1296268
675 Ga0436364_1322907
676 Ga0436364_1497381
677 Ga0436364_1515263
678 Ga0436364_1523939
679 Ga0436364_1556058
680 Ga0395901_0384691
681 Ga0436365_0415802
682 Ga0436365_0843912
683 Ga0436365_0915848
684 Ga0436365_0921004
685 Ga0436365_1021718
686 Ga0436365_1158595
687 Ga0436365_1671027
688 Ga0436363_0567159
689 Ga0436363_1263661
690 Ga0436363_1567935
691 Ga0466966_0102220
692 Ga0453684_0114078
693 Ga0453684_0311420
694 Ga0466960_0067620
695 Ga0466959_0073484
696 Ga0466959_0280947
697 Ga0451576_0097313
698 Ga0466958_0506829
699 Ga0466967_0703845
700 Ga0495592_0309122
701 Ga0495651_0184638
702 Ga0495653_0473190
703 Ga0495580_0041493
704 Ga0495580_0081837
705 Ga0495580_0135088
706 Ga0495580_0146330
707 Ga0495580_0154576
708 Ga0495580_0179908
709 Ga0495582_0071829
710 Ga0495582_0230903
711 Ga0495664_0080195
712 Ga0495594_0046499
713 Ga0495594_0262710
714 Ga0495628_0257918
715 Ga0495666_0061949
716 Ga0495665_0031777
717 Ga0495665_0231734
718 Ga0495640_0248617
719 Ga0495586_0412812
720 Ga0495645_0279657
721 Ga0495667_0134736
722 Ga0495634_0497720
723 Ga0495635_0043017
724 Ga0495635_0183046
725 Ga0495588_0287835
726 Ga0495599_0449613
727 Ga0495623_0087902
728 Ga0495647_0339143
729 Ga0495658_0110490
730 Ga0495624_0205131
731 Ga0495604_0024469
732 Ga0495604_0376206
733 Ga0495604_0640215
734 Ga0495636_0383138
735 Ga0495674_0111130
736 Ga0495674_0949138
737 Ga0495680_0304746
738 Ga0495680_0345404
739 Ga0495675_0193689
740 Ga0495684_0013693
741 Ga0495684_0218149
742 Ga0495593_0467706
743 Ga0495602_0145943
744 Ga0495602_0204010
745 Ga0495602_0348234
746 Ga0496104_0428340
747 Ga0496104_0438130
748 Ga0496104_0548411
749 Ga0496105_0478727
750 Ga0496108_0910603
751 Ga0496109_0525338
752 Ga0496112_0015009
753 Ga0496112_0393570
754 Ga0496114_0290229
755 Ga0496115_0026922
756 Ga0501034_0036284
757 Ga0501037_0033462
758 Ga0501038_0078724
759 Ga0501043_0028461
760 Ga0501047_0036803
761 Ga0501047_0134427
762 Ga0501048_0074176
763 Ga0501048_0321268
764 Ga0501073_0042031
765 Ga0501073_0281312
766 Ga0501074_0122980
767 Ga0501249_048217
768 Ga0501270_013625
769 Ga0501035_0040176
770 Ga0501044_0000391
771 Ga0501044_0001179
772 Ga0501044_0035052
773 Ga0495619_0523539
774 Ga0500568_0001432
775 Ga0501082_0000052
776 Ga0466962_0371869

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10816

DUF2760

Domain of unknown function (DUF2760)

78

203

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b87-assembly3.cif.gz_C crystal structure of transmembrane protein tmhc2_e 0.6702 38 83
6b87-assembly2.cif.gz_B-3 crystal structure of transmembrane protein tmhc2_e 0.6459 38 83
2v95-assembly1.cif.gz_A structure of corticosteroid-binding globulin in complex with cortisol 0.4929 38 90
8bwy-assembly1.cif.gz_O in situ outer dynein arm from chlamydomonas reinhardtii in a pre-power stroke state 0.4446 38 119
8bx8-assembly1.cif.gz_N in situ outer dynein arm from chlamydomonas reinhardtii in the post-power stroke state 0.4072 38 122
ID Description Score Start End Superfamily
af_P07814_749_805_1.10.287.10 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.6438 41 84 1.10.287.10
af_A1L130_2_105_6.10.140.1740 Special;Helix non-globular;Helix Hairpins; 0.621 37 83 6.10.140.1740
af_Q9LWP7_122_249_1.20.140.50 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;alix/aip1 like domains 0.5693 39 83 1.20.140.50
af_A0A1D6MHE2_116_245_1.20.140.50 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;alix/aip1 like domains 0.5641 39 83 1.20.140.50
af_K7K2K1_122_247_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.5577 39 84 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A1V6G913-F1-model_v4 deleted 0.6774 35 156
AF-A0A3C0VGK2-F1-model_v4 DUF2760 domain-containing protein 0.6759 35 156
AF-A0A7C3DDR0-F1-model_v4 DUF2760 domain-containing protein 0.6721 4 105
AF-A0A1F9EYS8-F1-model_v4 DUF2760 domain-containing protein 0.6607 29 156
AF-A0A317JAQ0-F1-model_v4 DUF2760 domain-containing protein 0.6537 27 156

Map