F431111

General Info

Members Datasets Scaffolds Average Seq Length
388 248 776 116

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_11362606|Ga0105237_113626061
Length 138
Sequence VLWIFFGHCKGSWCIFFAVSTGADVAEEKSEVLQGTLDLMILKTLQALGPVHGFGIARRIEQLSEDVLTLNEGTVYTSLLRLQQKRWISSEWGVSENNRRARFYSITKRGIKQLAIETENWERIAGVIGRVLALEAKV

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
148 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
149 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
165 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
166 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
167 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
168 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
245 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
246 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 1.55
Rhizosphere 95.1
Stem 0
Stem Tuber 0
Unclassified 26.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_11362606 3300009545 Viruses 716
2 rootH2_10005756 3300003320 Bacteria 9202
3 Ga0070683_101063237 3300005329 Unclassified 777
4 Ga0070690_100011121 3300005330 Bacteria 5256
5 Ga0070670_100019473 3300005331 Bacteria 5825
6 Ga0068869_100187409 3300005334 Unclassified 1625
7 Ga0068869_101535492 3300005334 Bacteria 592
8 Ga0070666_10034661 3300005335 Bacteria 3345
9 Ga0070666_10301895 3300005335 Bacteria 1140
10 Ga0070680_100144647 3300005336 Bacteria 1994
11 Ga0070682_100005560 3300005337 Bacteria 7020
12 Ga0068868_100263361 3300005338 Bacteria 1454
13 Ga0068868_101613269 3300005338 Unclassified 610
14 Ga0070660_100020745 3300005339 Bacteria 4835
15 Ga0070687_100862779 3300005343 Bacteria 646
16 Ga0070661_100000859 3300005344 Bacteria 21828
17 Ga0070692_10009894 3300005345 Bacteria 4318
18 Ga0070669_100419003 3300005353 Bacteria 1099
19 Ga0070675_100117955 3300005354 Bacteria 2253
20 Ga0070671_100144985 3300005355 Bacteria 2004
21 Ga0070673_100016771 3300005364 Bacteria 5191
22 Ga0070688_100945530 3300005365 Unclassified 682
23 Ga0070659_100039240 3300005366 Unclassified 3696
24 Ga0070667_100381086 3300005367 Bacteria 1281
25 Ga0070667_100398106 3300005367 Bacteria 1253
26 Ga0070709_10665997 3300005434 Bacteria 807
27 Ga0070709_10698614 3300005434 Bacteria 789
28 Ga0070714_100454180 3300005435 Unclassified 1217
29 Ga0070714_100488491 3300005435 Unclassified 1173
30 Ga0070714_100720076 3300005435 Unclassified 964
31 Ga0070713_100591095 3300005436 Bacteria 1054
32 Ga0070713_100857403 3300005436 Bacteria 872
33 Ga0070713_101014587 3300005436 Bacteria 801
34 Ga0070713_101190019 3300005436 Unclassified 738
35 Ga0070713_101299274 3300005436 Bacteria 705
36 Ga0070710_10054251 3300005437 Bacteria 2261
37 Ga0070710_10057257 3300005437 Bacteria 2209
38 Ga0070710_10515534 3300005437 Unclassified 821
39 Ga0070711_101334713 3300005439 Bacteria 623
40 Ga0070711_101849740 3300005439 Bacteria 530
41 Ga0070705_100113992 3300005440 Bacteria 1733
42 Ga0070708_102204000 3300005445 Bacteria 509
43 Ga0070663_100095856 3300005455 Bacteria 2206
44 Ga0070663_100340674 3300005455 Bacteria 1211
45 Ga0070663_100639716 3300005455 Unclassified 898
46 Ga0070678_101147818 3300005456 Bacteria 719
47 Ga0070678_101390942 3300005456 Bacteria 655
48 Ga0070662_100290888 3300005457 Unclassified 1325
49 Ga0070662_101142943 3300005457 Unclassified 669
50 Ga0070681_10003214 3300005458 Bacteria 15226
51 Ga0068867_100358598 3300005459 Unclassified 1219
52 Ga0070698_100026358 3300005471 Bacteria 6050
53 Ga0070679_100003963 3300005530 Bacteria 13632
54 Ga0070679_100156562 3300005530 Unclassified 2253
55 Ga0070684_100105196 3300005535 Unclassified 2525
56 Ga0068853_100377590 3300005539 Bacteria 1323
57 Ga0070686_100270261 3300005544 Unclassified 1250
58 Ga0070695_100027905 3300005545 Bacteria 3500
59 Ga0070693_100004762 3300005547 Bacteria 6459
60 Ga0070704_101706060 3300005549 Bacteria 582
61 Ga0068855_100032259 3300005563 Bacteria 6254
62 Ga0068855_100721439 3300005563 Unclassified 1065
63 Ga0068855_101546102 3300005563 Bacteria 680
64 Ga0068855_101810607 3300005563 Bacteria 620
65 Ga0070664_100058266 3300005564 Unclassified 3285
66 Ga0068857_100002459 3300005577 Bacteria 15135
67 Ga0068857_100045996 3300005577 Unclassified 3872
68 Ga0068856_100022963 3300005614 Bacteria 6064
69 Ga0070702_100000247 3300005615 Bacteria 18409
70 Ga0068852_100134149 3300005616 Bacteria 2284
71 Ga0068859_100026619 3300005617 Bacteria 5799
72 Ga0068859_100536476 3300005617 Bacteria 1265
73 Ga0068859_102617943 3300005617 Unclassified 555
74 Ga0068864_100015104 3300005618 Bacteria 6420
75 Ga0068863_100973586 3300005841 Unclassified 850
76 Ga0068863_101894533 3300005841 Bacteria 606
77 Ga0068858_100186464 3300005842 Unclassified 1959
78 Ga0068860_100052632 3300005843 Bacteria 3872
79 Ga0068860_100191224 3300005843 Bacteria 1981
80 Ga0070717_10035974 3300006028 Bacteria 4013
81 Ga0070715_10198822 3300006163 Bacteria 1017
82 Ga0070716_100053019 3300006173 Unclassified 2311
83 Ga0070716_100270343 3300006173 Bacteria 1168
84 Ga0070712_100030603 3300006175 Unclassified 3619
85 Ga0070712_100048098 3300006175 Bacteria 2955
86 Ga0070712_100435323 3300006175 Bacteria 1089
87 Ga0070712_101140246 3300006175 Bacteria 677
88 Ga0070712_101225494 3300006175 Unclassified 653
89 Ga0097621_100113349 3300006237 Bacteria 2294
90 Ga0068871_100273294 3300006358 Bacteria 1477
91 Ga0075433_11662558 3300006852 Bacteria 550
92 Ga0075434_100315844 3300006871 Bacteria 1583
93 Ga0075434_101531168 3300006871 Bacteria 676
94 Ga0075436_100576285 3300006914 Bacteria 828
95 Ga0097620_100026619 3300006931 Bacteria 5799
96 Ga0097620_100536461 3300006931 Bacteria 1265
97 Ga0097620_102617302 3300006931 Unclassified 555
98 Ga0105240_10224874 3300009093 Unclassified 2184
99 Ga0105245_10093523 3300009098 Unclassified 2770
100 Ga0105245_11133371 3300009098 Bacteria 829
101 Ga0114129_10178129 3300009147 Bacteria 2894
102 Ga0105243_10003268 3300009148 Bacteria 13199
103 Ga0105243_11413250 3300009148 Bacteria 717
104 Ga0105241_10010727 3300009174 Bacteria 6725
105 Ga0105241_11236564 3300009174 Unclassified 709
106 Ga0105242_10024847 3300009176 Bacteria 4735
107 Ga0105242_10073254 3300009176 Bacteria 2847
108 Ga0105248_10012690 3300009177 Bacteria 9298
109 Ga0105248_10042146 3300009177 Bacteria 5119
110 Ga0105248_10406269 3300009177 Bacteria 1533
111 Ga0105248_11468716 3300009177 Unclassified 772
112 Ga0105237_11171565 3300009545 Bacteria 775
113 Ga0105237_11511945 3300009545 Unclassified 678
114 Ga0105237_12142539 3300009545 Bacteria 568
115 Ga0105249_10305920 3300009553 Bacteria 1596
116 Ga0105249_12512295 3300009553 Unclassified 588
117 Ga0099796_10294506 3300010159 Bacteria 686
118 Ga0105239_10031304 3300010375 Bacteria 5851
119 Ga0105239_12995736 3300010375 Unclassified 551
120 Ga0105246_10016754 3300011119 Bacteria 4647
121 Ga0105246_11702701 3300011119 Bacteria 599
122 Ga0157373_10031938 3300013100 Unclassified 3791
123 Ga0157371_10024019 3300013102 Bacteria 4453
124 Ga0157370_10119590 3300013104 Bacteria 2459
125 Ga0157369_10007961 3300013105 Bacteria 12179
126 Ga0157369_10583816 3300013105 Bacteria 1154
127 Ga0157369_10745087 3300013105 Bacteria 1008
128 Ga0157369_10951516 3300013105 Unclassified 880
129 Ga0157369_11602822 3300013105 Bacteria 662
130 Ga0157369_11750726 3300013105 Bacteria 631
131 Ga0157374_10031451 3300013296 Bacteria 4824
132 Ga0157374_12633793 3300013296 Bacteria 531
133 Ga0157378_10577314 3300013297 Unclassified 1133
134 Ga0157378_12343960 3300013297 Unclassified 585
135 Ga0163162_10025637 3300013306 Bacteria 5828
136 Ga0163162_10230737 3300013306 Bacteria 1981
137 Ga0163162_10672234 3300013306 Bacteria 1158
138 Ga0163162_10920380 3300013306 Bacteria 987
139 Ga0163162_11758720 3300013306 Bacteria 708
140 Ga0163162_11834349 3300013306 Bacteria 694
141 Ga0157372_10010440 3300013307 Bacteria 9878
142 Ga0157372_10202985 3300013307 Bacteria 2297
143 Ga0157372_12396675 3300013307 Bacteria 606
144 Ga0157375_10016631 3300013308 Bacteria 6615
145 Ga0163163_10051696 3300014325 Bacteria 4051
146 Ga0157377_10041538 3300014745 Unclassified 2552
147 Ga0157379_10211790 3300014968 Bacteria 1754
148 Ga0157379_10680413 3300014968 Bacteria 965
149 Ga0157379_10928532 3300014968 Unclassified 827
150 Ga0157379_11967785 3300014968 Unclassified 577
151 Ga0157376_10002782 3300014969 Bacteria 11945
152 Ga0157376_10326486 3300014969 Bacteria 1460
153 Ga0157376_10380723 3300014969 Bacteria 1359
154 Ga0157376_10862732 3300014969 Bacteria 921
155 Ga0157376_12122663 3300014969 Bacteria 600
156 Ga0163161_10843225 3300017792 Bacteria 773
157 Ga0163161_10992251 3300017792 Bacteria 716
158 Ga0213874_10122221 3300021377 Unclassified 886
159 Ga0213875_10016134 3300021388 Bacteria 3623
160 Ga0207697_10133335 3300025315 Bacteria 1074
161 Ga0207692_10138163 3300025898 Unclassified 1383
162 Ga0207692_10165070 3300025898 Unclassified 1279
163 Ga0207710_10013871 3300025900 Unclassified 3393
164 Ga0207680_10171262 3300025903 Bacteria 1462
165 Ga0207680_10519785 3300025903 Bacteria 849
166 Ga0207647_10074548 3300025904 Bacteria 2043
167 Ga0207685_10407372 3300025905 Bacteria 698
168 Ga0207685_10604694 3300025905 Unclassified 589
169 Ga0207699_10205854 3300025906 Bacteria 1336
170 Ga0207705_11230515 3300025909 Unclassified 574
171 Ga0207654_10000011 3300025911 Bacteria 245470
172 Ga0207654_10005037 3300025911 Bacteria 6672
173 Ga0207654_10046593 3300025911 Bacteria 2473
174 Ga0207654_10871066 3300025911 Unclassified 652
175 Ga0207707_10246181 3300025912 Bacteria 1553
176 Ga0207695_10862619 3300025913 Bacteria 785
177 Ga0207671_10179979 3300025914 Unclassified 1645
178 Ga0207671_11429972 3300025914 Unclassified 535
179 Ga0207693_10024132 3300025915 Bacteria 4828
180 Ga0207693_10049702 3300025915 Unclassified 3293
181 Ga0207693_10075567 3300025915 Unclassified 2638
182 Ga0207663_10707440 3300025916 Bacteria 798
183 Ga0207660_10449329 3300025917 Unclassified 1042
184 Ga0207662_10386643 3300025918 Bacteria 946
185 Ga0207657_10119209 3300025919 Unclassified 2172
186 Ga0207649_10010502 3300025920 Bacteria 5089
187 Ga0207652_10015278 3300025921 Bacteria 6232
188 Ga0207652_10080909 3300025921 Bacteria 2841
189 Ga0207681_10399946 3300025923 Bacteria 1109
190 Ga0207650_10001542 3300025925 Bacteria 16500
191 Ga0207659_10001037 3300025926 Bacteria 16441
192 Ga0207687_10010547 3300025927 Bacteria 6037
193 Ga0207687_11137770 3300025927 Bacteria 671
194 Ga0207700_10061271 3300025928 Bacteria 2853
195 Ga0207700_10071794 3300025928 Unclassified 2667
196 Ga0207700_10654521 3300025928 Bacteria 937
197 Ga0207700_10655858 3300025928 Bacteria 936
198 Ga0207664_10345776 3300025929 Bacteria 1316
199 Ga0207664_11196469 3300025929 Bacteria 678
200 Ga0207644_10115942 3300025931 Bacteria 2032
201 Ga0207690_10013808 3300025932 Bacteria 4865
202 Ga0207706_10022859 3300025933 Bacteria 5611
203 Ga0207706_10994232 3300025933 Bacteria 705
204 Ga0207686_10152745 3300025934 Bacteria 1609
205 Ga0207686_10937301 3300025934 Unclassified 700
206 Ga0207709_10011856 3300025935 Bacteria 4808
207 Ga0207670_10117577 3300025936 Bacteria 1927
208 Ga0207665_10079408 3300025939 Unclassified 2255
209 Ga0207665_10571285 3300025939 Unclassified 880
210 Ga0207665_10690253 3300025939 Bacteria 802
211 Ga0207711_10020946 3300025941 Bacteria 5459
212 Ga0207711_10065112 3300025941 Bacteria 3150
213 Ga0207711_10280867 3300025941 Bacteria 1533
214 Ga0207689_10185136 3300025942 Bacteria 1718
215 Ga0207689_10560271 3300025942 Bacteria 960
216 Ga0207689_11507648 3300025942 Unclassified 561
217 Ga0207661_10032519 3300025944 Bacteria 4041
218 Ga0207661_10330335 3300025944 Unclassified 1372
219 Ga0207679_10000195 3300025945 Bacteria 48538
220 Ga0207667_10004901 3300025949 Bacteria 16347
221 Ga0207667_10848340 3300025949 Unclassified 908
222 Ga0207667_11117569 3300025949 Bacteria 771
223 Ga0207651_11122762 3300025960 Unclassified 705
224 Ga0207712_11188291 3300025961 Bacteria 680
225 Ga0207658_10569332 3300025986 Bacteria 1015
226 Ga0207677_10397267 3300026023 Bacteria 1168
227 Ga0207677_10803658 3300026023 Unclassified 842
228 Ga0207703_10118250 3300026035 Bacteria 2272
229 Ga0207678_10629327 3300026067 Bacteria 942
230 Ga0207702_10014045 3300026078 Bacteria 6648
231 Ga0207641_10098164 3300026088 Bacteria 2575
232 Ga0207648_10045072 3300026089 Bacteria 3869
233 Ga0207676_10001606 3300026095 Bacteria 16641
234 Ga0207674_10026440 3300026116 Bacteria 6163
235 Ga0207674_10087141 3300026116 Bacteria 3116
236 Ga0207683_11137694 3300026121 Bacteria 724
237 Ga0207683_11759412 3300026121 Bacteria 569
238 Ga0207698_10013236 3300026142 Bacteria 5435
239 Ga0268264_10040169 3300028381 Bacteria 3866
240 Ga0265338_10373041 3300028800 Bacteria 1022
241 Ga0265765_1060933 3300030879 Bacteria 533
242 Ga0265760_10008693 3300031090 Bacteria 2901
243 Ga0265760_10016345 3300031090 Bacteria 2129
244 Ga0265339_10000035 3300031249 Bacteria 124977
245 Ga0265331_10034027 3300031250 Unclassified 2516
246 Ga0265342_10000769 3300031712 Bacteria 32678
247 Ga0316212_1034362 3300033547 Bacteria 714
248 Ga0373934_0003021 3300035086 Bacteria 6148
249 Ga0373923_0039887 3300035111 Bacteria 1930
250 Ga0373953_0019436 3300035117 Bacteria 2527
251 Ga0373954_0006533 3300035118 Bacteria 5082
252 Ga0373956_0003720 3300035119 Bacteria 6150
253 Ga0373956_0434701 3300035119 Unclassified 626
254 Ga0373957_0104854 3300035120 Bacteria 1134
255 Ga0373943_0039045 3300035170 Bacteria 2285
256 Ga0373955_0012746 3300035172 Bacteria 4049
257 Ga0373935_0376257 3300035692 Unclassified 1016
258 Ga0373927_0427573 3300035695 Bacteria 874
259 Ga0373933_0000693 3300035724 Bacteria 20752
260 Ga0373933_0856560 3300035724 Unclassified 598
261 Ga0373937_0007258 3300036401 Bacteria 9589
262 Ga0373937_0159806 3300036401 Unclassified 2113
263 Ga0436364_0051079 3300037853 Bacteria 8799
264 Ga0436364_1530723 3300037853 Unclassified 833
265 Ga0436365_0816253 3300039437 Unclassified 668
266 Ga0436361_0739624 3300039447 Bacteria 1367
267 Ga0436363_0076091 3300039450 Bacteria 1425
268 Ga0436362_0018213 3300039453 Bacteria 703
269 Ga0439431_0117547 3300041997 Unclassified 740
270 Ga0439434_0147091 3300042435 Bacteria 779
271 Ga0439464_0091390 3300042439 Bacteria 918
272 Ga0466969_0045086 3300044656 Bacteria 2190
273 Ga0466966_0282436 3300044684 Bacteria 998
274 Ga0466961_0644962 3300044693 Unclassified 636
275 Ga0451576_0091895 3300045051 Bacteria 3157
276 Ga0466967_0391040 3300045976 Unclassified 1352
277 Ga0495592_0043537 3300046454 Bacteria 3359
278 Ga0495592_0808816 3300046454 Unclassified 556
279 Ga0495590_0118244 3300046457 Bacteria 949
280 Ga0495629_0023596 3300046459 Unclassified 4382
281 Ga0495651_0034940 3300046462 Bacteria 3917
282 Ga0495653_0101786 3300046463 Bacteria 2080
283 Ga0495650_0000006 3300046471 Bacteria 721347
284 Ga0495580_0042332 3300046472 Unclassified 3245
285 Ga0495580_0138304 3300046472 Bacteria 1689
286 Ga0495582_0020902 3300046473 Unclassified 3584
287 Ga0495664_0927639 3300046477 Unclassified 508
288 Ga0495606_0323143 3300046507 Unclassified 828
289 Ga0495608_0133854 3300046511 Bacteria 1585
290 Ga0495628_1195806 3300046516 Bacteria 516
291 Ga0495652_0101670 3300046529 Bacteria 2330
292 Ga0495652_0188009 3300046529 Bacteria 1579
293 Ga0495665_0579477 3300046531 Bacteria 562
294 Ga0495640_0527957 3300046533 Unclassified 717
295 Ga0495587_0017130 3300046536 Bacteria 4505
296 Ga0495645_0021024 3300046543 Bacteria 4716
297 Ga0495634_0773087 3300046642 Bacteria 549
298 Ga0495625_0014908 3300046660 Bacteria 6181
299 Ga0495625_0213957 3300046660 Unclassified 1266
300 Ga0495635_0131681 3300046663 Bacteria 1705
301 Ga0495657_0172250 3300046675 Bacteria 1332
302 Ga0495599_0301433 3300046678 Bacteria 967
303 Ga0495623_0590174 3300046679 Unclassified 578
304 Ga0495646_0115978 3300046680 Unclassified 1520
305 Ga0495658_0059552 3300046683 Bacteria 2187
306 Ga0495658_0998389 3300046683 Bacteria 534
307 Ga0495649_0075731 3300046694 Unclassified 1802
308 Ga0495604_0001629 3300047317 Bacteria 18510
309 Ga0495604_0017522 3300047317 Bacteria 5736
310 Ga0495674_0025362 3300047319 Bacteria 5437
311 Ga0495674_0079532 3300047319 Bacteria 2815
312 Ga0495684_0018074 3300047471 Bacteria 5433
313 Ga0495686_0035668 3300047472 Bacteria 3196
314 Ga0495686_0442408 3300047472 Bacteria 692
315 Ga0495593_0250911 3300047673 Bacteria 886
316 Ga0495602_0003635 3300048088 Bacteria 15976
317 Ga0496100_0816587 3300048903 Unclassified 731
318 Ga0496104_1498742 3300048907 Unclassified 577
319 Ga0496109_0314779 3300048912 Bacteria 1477
320 Ga0496112_0679854 3300048915 Bacteria 958
321 Ga0496112_1777453 3300048915 Unclassified 529
322 Ga0496114_0083833 3300048917 Bacteria 2698
323 Ga0496126_0001475 3300048929 Bacteria 36589
324 Ga0496126_0089348 3300048929 Unclassified 2712
325 Ga0501031_0001778 3300049568 Bacteria 13523
326 Ga0501032_0003645 3300049569 Bacteria 11717
327 Ga0501032_0003708 3300049569 Bacteria 11595
328 Ga0501033_0002402 3300049570 Bacteria 15944
329 Ga0501033_0022514 3300049570 Bacteria 4754
330 Ga0501034_0020896 3300049571 Bacteria 6683
331 Ga0501034_0030745 3300049571 Bacteria 5457
332 Ga0501034_0220773 3300049571 Unclassified 1848
333 Ga0501036_0000411 3300049572 Bacteria 30265
334 Ga0501036_0008820 3300049572 Bacteria 8278
335 Ga0501037_0010327 3300049573 Bacteria 6851
336 Ga0501037_0049694 3300049573 Bacteria 3070
337 Ga0501038_0008535 3300049574 Bacteria 9412
338 Ga0501038_0018924 3300049574 Bacteria 6215
339 Ga0501039_0002813 3300049575 Bacteria 13004
340 Ga0501039_0028784 3300049575 Bacteria 4278
341 Ga0501043_0000343 3300049579 Bacteria 42161
342 Ga0501043_0007026 3300049579 Bacteria 8959
343 Ga0501046_0000199 3300049580 Bacteria 62001
344 Ga0501046_0009204 3300049580 Bacteria 8552
345 Ga0501046_0361739 3300049580 Unclassified 1052
346 Ga0501047_0000766 3300049581 Bacteria 33631
347 Ga0501047_0023929 3300049581 Bacteria 5864
348 Ga0501047_0038101 3300049581 Unclassified 4650
349 Ga0501048_0014659 3300049582 Bacteria 5801
350 Ga0501048_0110494 3300049582 Bacteria 1941
351 Ga0501067_0008651 3300049583 Bacteria 5641
352 Ga0501068_0004466 3300049584 Bacteria 7611
353 Ga0501068_0077795 3300049584 Bacteria 2032
354 Ga0501069_0010975 3300049585 Bacteria 4804
355 Ga0501070_0021982 3300049586 Bacteria 5345
356 Ga0501070_0039387 3300049586 Bacteria 3942
357 Ga0501072_0003108 3300049588 Bacteria 12494
358 Ga0501073_0014973 3300049589 Bacteria 5626
359 Ga0501073_0156953 3300049589 Unclassified 1576
360 Ga0501074_0111156 3300049590 Bacteria 1961
361 Ga0501074_0233371 3300049590 Unclassified 1309
362 Ga0501076_0025458 3300049592 Bacteria 4579
363 Ga0501077_0004262 3300049593 Bacteria 8646
364 Ga0501216_029140 3300049660 Unclassified 1010
365 Ga0501079_0004737 3300049741 Bacteria 10075
366 Ga0501079_0038684 3300049741 Bacteria 3679
367 Ga0501080_0003290 3300049742 Bacteria 14280
368 Ga0501080_0028694 3300049742 Bacteria 5180
369 Ga0501080_0069891 3300049742 Bacteria 3266
370 Ga0501081_0102558 3300049743 Bacteria 2024
371 Ga0501081_0880012 3300049743 Unclassified 675
372 Ga0501083_0034356 3300049744 Unclassified 3467
373 Ga0501273_013508 3300049770 Unclassified 1042
374 Ga0501035_0015973 3300049822 Bacteria 6929
375 Ga0501035_0030360 3300049822 Bacteria 4927
376 Ga0501035_0192867 3300049822 Bacteria 1751
377 Ga0501044_0001413 3300049823 Bacteria 28159
378 Ga0501044_0050250 3300049823 Bacteria 4303
379 Ga0501045_0083552 3300049824 Unclassified 2356
380 nmdc:mga05p37_672816_c1 3300050507 Unclassified 1155
381 nmdc:mga0n895_420469_c1 3300050512 Bacteria 1351
382 nmdc:mga0a205_786366_c1 3300050515 Unclassified 799
383 Ga0500595_000036 3300053119 Bacteria 103200
384 Ga0500568_0000196 3300053139 Bacteria 52926
385 Ga0500573_0559655 3300053140 Unclassified 504
386 Ga0501084_0052580 3300054114 Bacteria 3407
387 Ga0501084_0343274 3300054114 Bacteria 1261
388 Ga0501082_0099131 3300060353 Bacteria 2519
389 Ga0105237_11362606
390 rootH2_10005756
391 Ga0070683_101063237
392 Ga0070690_100011121
393 Ga0070670_100019473
394 Ga0068869_100187409
395 Ga0068869_101535492
396 Ga0070666_10034661
397 Ga0070666_10301895
398 Ga0070680_100144647
399 Ga0070682_100005560
400 Ga0068868_100263361
401 Ga0068868_101613269
402 Ga0070660_100020745
403 Ga0070687_100862779
404 Ga0070661_100000859
405 Ga0070692_10009894
406 Ga0070669_100419003
407 Ga0070675_100117955
408 Ga0070671_100144985
409 Ga0070673_100016771
410 Ga0070688_100945530
411 Ga0070659_100039240
412 Ga0070667_100381086
413 Ga0070667_100398106
414 Ga0070709_10665997
415 Ga0070709_10698614
416 Ga0070714_100454180
417 Ga0070714_100488491
418 Ga0070714_100720076
419 Ga0070713_100591095
420 Ga0070713_100857403
421 Ga0070713_101014587
422 Ga0070713_101190019
423 Ga0070713_101299274
424 Ga0070710_10054251
425 Ga0070710_10057257
426 Ga0070710_10515534
427 Ga0070711_101334713
428 Ga0070711_101849740
429 Ga0070705_100113992
430 Ga0070708_102204000
431 Ga0070663_100095856
432 Ga0070663_100340674
433 Ga0070663_100639716
434 Ga0070678_101147818
435 Ga0070678_101390942
436 Ga0070662_100290888
437 Ga0070662_101142943
438 Ga0070681_10003214
439 Ga0068867_100358598
440 Ga0070698_100026358
441 Ga0070679_100003963
442 Ga0070679_100156562
443 Ga0070684_100105196
444 Ga0068853_100377590
445 Ga0070686_100270261
446 Ga0070695_100027905
447 Ga0070693_100004762
448 Ga0070704_101706060
449 Ga0068855_100032259
450 Ga0068855_100721439
451 Ga0068855_101546102
452 Ga0068855_101810607
453 Ga0070664_100058266
454 Ga0068857_100002459
455 Ga0068857_100045996
456 Ga0068856_100022963
457 Ga0070702_100000247
458 Ga0068852_100134149
459 Ga0068859_100026619
460 Ga0068859_100536476
461 Ga0068859_102617943
462 Ga0068864_100015104
463 Ga0068863_100973586
464 Ga0068863_101894533
465 Ga0068858_100186464
466 Ga0068860_100052632
467 Ga0068860_100191224
468 Ga0070717_10035974
469 Ga0070715_10198822
470 Ga0070716_100053019
471 Ga0070716_100270343
472 Ga0070712_100030603
473 Ga0070712_100048098
474 Ga0070712_100435323
475 Ga0070712_101140246
476 Ga0070712_101225494
477 Ga0097621_100113349
478 Ga0068871_100273294
479 Ga0075433_11662558
480 Ga0075434_100315844
481 Ga0075434_101531168
482 Ga0075436_100576285
483 Ga0097620_100026619
484 Ga0097620_100536461
485 Ga0097620_102617302
486 Ga0105240_10224874
487 Ga0105245_10093523
488 Ga0105245_11133371
489 Ga0114129_10178129
490 Ga0105243_10003268
491 Ga0105243_11413250
492 Ga0105241_10010727
493 Ga0105241_11236564
494 Ga0105242_10024847
495 Ga0105242_10073254
496 Ga0105248_10012690
497 Ga0105248_10042146
498 Ga0105248_10406269
499 Ga0105248_11468716
500 Ga0105237_11171565
501 Ga0105237_11511945
502 Ga0105237_12142539
503 Ga0105249_10305920
504 Ga0105249_12512295
505 Ga0099796_10294506
506 Ga0105239_10031304
507 Ga0105239_12995736
508 Ga0105246_10016754
509 Ga0105246_11702701
510 Ga0157373_10031938
511 Ga0157371_10024019
512 Ga0157370_10119590
513 Ga0157369_10007961
514 Ga0157369_10583816
515 Ga0157369_10745087
516 Ga0157369_10951516
517 Ga0157369_11602822
518 Ga0157369_11750726
519 Ga0157374_10031451
520 Ga0157374_12633793
521 Ga0157378_10577314
522 Ga0157378_12343960
523 Ga0163162_10025637
524 Ga0163162_10230737
525 Ga0163162_10672234
526 Ga0163162_10920380
527 Ga0163162_11758720
528 Ga0163162_11834349
529 Ga0157372_10010440
530 Ga0157372_10202985
531 Ga0157372_12396675
532 Ga0157375_10016631
533 Ga0163163_10051696
534 Ga0157377_10041538
535 Ga0157379_10211790
536 Ga0157379_10680413
537 Ga0157379_10928532
538 Ga0157379_11967785
539 Ga0157376_10002782
540 Ga0157376_10326486
541 Ga0157376_10380723
542 Ga0157376_10862732
543 Ga0157376_12122663
544 Ga0163161_10843225
545 Ga0163161_10992251
546 Ga0213874_10122221
547 Ga0213875_10016134
548 Ga0207697_10133335
549 Ga0207692_10138163
550 Ga0207692_10165070
551 Ga0207710_10013871
552 Ga0207680_10171262
553 Ga0207680_10519785
554 Ga0207647_10074548
555 Ga0207685_10407372
556 Ga0207685_10604694
557 Ga0207699_10205854
558 Ga0207705_11230515
559 Ga0207654_10000011
560 Ga0207654_10005037
561 Ga0207654_10046593
562 Ga0207654_10871066
563 Ga0207707_10246181
564 Ga0207695_10862619
565 Ga0207671_10179979
566 Ga0207671_11429972
567 Ga0207693_10024132
568 Ga0207693_10049702
569 Ga0207693_10075567
570 Ga0207663_10707440
571 Ga0207660_10449329
572 Ga0207662_10386643
573 Ga0207657_10119209
574 Ga0207649_10010502
575 Ga0207652_10015278
576 Ga0207652_10080909
577 Ga0207681_10399946
578 Ga0207650_10001542
579 Ga0207659_10001037
580 Ga0207687_10010547
581 Ga0207687_11137770
582 Ga0207700_10061271
583 Ga0207700_10071794
584 Ga0207700_10654521
585 Ga0207700_10655858
586 Ga0207664_10345776
587 Ga0207664_11196469
588 Ga0207644_10115942
589 Ga0207690_10013808
590 Ga0207706_10022859
591 Ga0207706_10994232
592 Ga0207686_10152745
593 Ga0207686_10937301
594 Ga0207709_10011856
595 Ga0207670_10117577
596 Ga0207665_10079408
597 Ga0207665_10571285
598 Ga0207665_10690253
599 Ga0207711_10020946
600 Ga0207711_10065112
601 Ga0207711_10280867
602 Ga0207689_10185136
603 Ga0207689_10560271
604 Ga0207689_11507648
605 Ga0207661_10032519
606 Ga0207661_10330335
607 Ga0207679_10000195
608 Ga0207667_10004901
609 Ga0207667_10848340
610 Ga0207667_11117569
611 Ga0207651_11122762
612 Ga0207712_11188291
613 Ga0207658_10569332
614 Ga0207677_10397267
615 Ga0207677_10803658
616 Ga0207703_10118250
617 Ga0207678_10629327
618 Ga0207702_10014045
619 Ga0207641_10098164
620 Ga0207648_10045072
621 Ga0207676_10001606
622 Ga0207674_10026440
623 Ga0207674_10087141
624 Ga0207683_11137694
625 Ga0207683_11759412
626 Ga0207698_10013236
627 Ga0268264_10040169
628 Ga0265338_10373041
629 Ga0265765_1060933
630 Ga0265760_10008693
631 Ga0265760_10016345
632 Ga0265339_10000035
633 Ga0265331_10034027
634 Ga0265342_10000769
635 Ga0316212_1034362
636 Ga0373934_0003021
637 Ga0373923_0039887
638 Ga0373953_0019436
639 Ga0373954_0006533
640 Ga0373956_0003720
641 Ga0373956_0434701
642 Ga0373957_0104854
643 Ga0373943_0039045
644 Ga0373955_0012746
645 Ga0373935_0376257
646 Ga0373927_0427573
647 Ga0373933_0000693
648 Ga0373933_0856560
649 Ga0373937_0007258
650 Ga0373937_0159806
651 Ga0436364_0051079
652 Ga0436364_1530723
653 Ga0436365_0816253
654 Ga0436361_0739624
655 Ga0436363_0076091
656 Ga0436362_0018213
657 Ga0439431_0117547
658 Ga0439434_0147091
659 Ga0439464_0091390
660 Ga0466969_0045086
661 Ga0466966_0282436
662 Ga0466961_0644962
663 Ga0451576_0091895
664 Ga0466967_0391040
665 Ga0495592_0043537
666 Ga0495592_0808816
667 Ga0495590_0118244
668 Ga0495629_0023596
669 Ga0495651_0034940
670 Ga0495653_0101786
671 Ga0495650_0000006
672 Ga0495580_0042332
673 Ga0495580_0138304
674 Ga0495582_0020902
675 Ga0495664_0927639
676 Ga0495606_0323143
677 Ga0495608_0133854
678 Ga0495628_1195806
679 Ga0495652_0101670
680 Ga0495652_0188009
681 Ga0495665_0579477
682 Ga0495640_0527957
683 Ga0495587_0017130
684 Ga0495645_0021024
685 Ga0495634_0773087
686 Ga0495625_0014908
687 Ga0495625_0213957
688 Ga0495635_0131681
689 Ga0495657_0172250
690 Ga0495599_0301433
691 Ga0495623_0590174
692 Ga0495646_0115978
693 Ga0495658_0059552
694 Ga0495658_0998389
695 Ga0495649_0075731
696 Ga0495604_0001629
697 Ga0495604_0017522
698 Ga0495674_0025362
699 Ga0495674_0079532
700 Ga0495684_0018074
701 Ga0495686_0035668
702 Ga0495686_0442408
703 Ga0495593_0250911
704 Ga0495602_0003635
705 Ga0496100_0816587
706 Ga0496104_1498742
707 Ga0496109_0314779
708 Ga0496112_0679854
709 Ga0496112_1777453
710 Ga0496114_0083833
711 Ga0496126_0001475
712 Ga0496126_0089348
713 Ga0501031_0001778
714 Ga0501032_0003645
715 Ga0501032_0003708
716 Ga0501033_0002402
717 Ga0501033_0022514
718 Ga0501034_0020896
719 Ga0501034_0030745
720 Ga0501034_0220773
721 Ga0501036_0000411
722 Ga0501036_0008820
723 Ga0501037_0010327
724 Ga0501037_0049694
725 Ga0501038_0008535
726 Ga0501038_0018924
727 Ga0501039_0002813
728 Ga0501039_0028784
729 Ga0501043_0000343
730 Ga0501043_0007026
731 Ga0501046_0000199
732 Ga0501046_0009204
733 Ga0501046_0361739
734 Ga0501047_0000766
735 Ga0501047_0023929
736 Ga0501047_0038101
737 Ga0501048_0014659
738 Ga0501048_0110494
739 Ga0501067_0008651
740 Ga0501068_0004466
741 Ga0501068_0077795
742 Ga0501069_0010975
743 Ga0501070_0021982
744 Ga0501070_0039387
745 Ga0501072_0003108
746 Ga0501073_0014973
747 Ga0501073_0156953
748 Ga0501074_0111156
749 Ga0501074_0233371
750 Ga0501076_0025458
751 Ga0501077_0004262
752 Ga0501216_029140
753 Ga0501079_0004737
754 Ga0501079_0038684
755 Ga0501080_0003290
756 Ga0501080_0028694
757 Ga0501080_0069891
758 Ga0501081_0102558
759 Ga0501081_0880012
760 Ga0501083_0034356
761 Ga0501273_013508
762 Ga0501035_0015973
763 Ga0501035_0030360
764 Ga0501035_0192867
765 Ga0501044_0001413
766 Ga0501044_0050250
767 Ga0501045_0083552
768 nmdc:mga05p37_672816_c1
769 nmdc:mga0n895_420469_c1
770 nmdc:mga0a205_786366_c1
771 Ga0500595_000036
772 Ga0500568_0000196
773 Ga0500573_0559655
774 Ga0501084_0052580
775 Ga0501084_0343274
776 Ga0501082_0099131

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

41

116

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9339 29 125
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9319 29 125
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9289 28 128
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9253 30 126
3elk-assembly1.cif.gz_B crystal structure of putative transcriptional regulator ta0346 from thermoplasma acidophilum 0.8954 29 130
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9319 29 125 1.10.10.10
af_Q9C106_1_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8983 32 102 1.10.10.10
af_P32349_45_122_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8956 32 100 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8924 29 129 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8805 32 110 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V9QX45-F1-model_v4 PadR family transcriptional regulator 0.9991 22 99
AF-A0A3N5LS61-F1-model_v4 PadR family transcriptional regulator 0.9876 29 127
AF-A0A2Z5G063-F1-model_v4 Transcriptional regulator, PadR family 0.9853 24 128
AF-A0A2V8EA09-F1-model_v4 PadR family transcriptional regulator 0.9848 29 108
AF-W0RR40-F1-model_v4 Transcriptional regulator, PadR-family 0.9837 29 130

Map