F431048

General Info

Members Datasets Scaffolds Average Seq Length
388 278 327 277

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10047610|Ga0070681_100476102
Length 333
Sequence MHAYVCYWHKADIAVSGRYPKGNIAAARKMSDNDPKRTWLGFGALPCLHSALRSTEIVMKRSAICAATLAALSISALATLAQPKSGVDKLYILNCGEGVAGDISRWSPGVNVGKSMDFVDNCYLIHHTQGWLLWDTGVTDAIATMPDGQAPSDPRMTHWRRPKTLASQLEQLGVKPADIKYLAVSHTHPDHIGNVELFPQAMLLVQKAEYEWPNPLGVGRFKPEHPVSKLEGDHDVFGDGSVTILATPGHTPGHQSLLVKLPKTGALVLSGDAVHFKSNWENRGVPSGNTDKDKTLASMQRISEVLAKEKAQLWINHDKAQRDSLKMAPAYYD

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
5 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
6 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
7 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
8 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
9 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
10 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
11 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
12 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
13 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
14 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
15 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
16 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
17 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
18 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
19 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
20 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
21 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
22 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
23 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
24 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
25 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
26 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
27 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
28 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
29 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
30 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
31 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
32 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
33 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
34 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
35 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
36 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
37 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
38 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
39 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
40 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
41 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
42 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
43 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
44 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
45 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
46 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
47 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
48 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
49 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
50 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
51 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
52 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
53 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
54 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
55 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
56 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
57 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
58 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
59 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
136 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
137 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
149 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
170 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
171 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
172 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
184 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
187 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
194 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
195 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
209 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
241 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
257 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
260 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
261 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
262 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
263 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
264 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
265 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
266 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
267 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
271 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
272 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
273 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
274 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
275 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
276 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
277 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
278 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.28
Metatranscriptomes 0
Isolates 15.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.15
Nodule 14.69
Rhizoplane 4.12
Rhizosphere 72.94
Stem 0
Stem Tuber 0
Unclassified 3.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1001499 3300003354 Bacteria 11594
2 Ga0065712_10119854 3300005290 Bacteria 1686
3 Ga0065715_10157406 3300005293 Bacteria 1583
4 Ga0068869_100054814 3300005334 Bacteria 2904
5 Ga0070680_100166369 3300005336 Bacteria 1854
6 Ga0070680_100248781 3300005336 Bacteria 1503
7 Ga0070682_100408684 3300005337 Bacteria 1029
8 Ga0070660_100061963 3300005339 Bacteria 2905
9 Ga0070669_100098342 3300005353 Bacteria 2204
10 Ga0070671_100040168 3300005355 Bacteria 3885
11 Ga0070659_100008288 3300005366 Bacteria 7587
12 Ga0070667_100297714 3300005367 Bacteria 1452
13 Ga0070714_100090364 3300005435 Bacteria 2682
14 Ga0070714_100312230 3300005435 Bacteria 1468
15 Ga0070714_100331723 3300005435 Bacteria 1425
16 Ga0070713_100008031 3300005436 Bacteria 7459
17 Ga0070708_100372500 3300005445 Bacteria 1346
18 Ga0070678_100145943 3300005456 Bacteria 1899
19 Ga0070681_10047610 3300005458 Bacteria 4286
20 Ga0070698_100408332 3300005471 Bacteria 1292
21 Ga0070679_100027125 3300005530 Bacteria 5633
22 Ga0070684_100180328 3300005535 Bacteria 1920
23 Ga0068853_100032644 3300005539 Bacteria 4412
24 Ga0070695_100106482 3300005545 Bacteria 1896
25 Ga0070693_100042253 3300005547 Bacteria 2568
26 Ga0068864_100103942 3300005618 Bacteria 2522
27 Ga0068858_100651742 3300005842 Bacteria 1023
28 Ga0068860_100486136 3300005843 Bacteria 1231
29 Ga0068860_100605200 3300005843 Bacteria 1101
30 Ga0081455_10017410 3300005937 Bacteria 6893
31 Ga0081455_10024337 3300005937 Bacteria 5608
32 Ga0081455_10058862 3300005937 Bacteria 3248
33 Ga0075365_10196476 3300006038 Bacteria 1413
34 Ga0075365_10210431 3300006038 Bacteria 1363
35 Ga0075364_10048945 3300006051 Bacteria 2755
36 Ga0070716_100278607 3300006173 Bacteria 1153
37 Ga0075367_10336406 3300006178 Bacteria 952
38 Ga0075369_10073933 3300006186 Bacteria 1503
39 Ga0075366_10054878 3300006195 Bacteria 2366
40 Ga0075366_10060848 3300006195 Bacteria 2244
41 Ga0097621_100285033 3300006237 Bacteria 1455
42 Ga0075428_100133693 3300006844 Bacteria 2697
43 Ga0075428_100171035 3300006844 Bacteria 2355
44 Ga0075431_100086837 3300006847 Bacteria 3228
45 Ga0075431_100091035 3300006847 Bacteria 3148
46 Ga0075431_100301179 3300006847 Bacteria 1620
47 Ga0075433_10092315 3300006852 Bacteria 2678
48 Ga0075434_100018900 3300006871 Bacteria 6660
49 Ga0075434_100023828 3300006871 Bacteria 5973
50 Ga0099825_1028742 3300006941 Bacteria 2666
51 Ga0099794_10096802 3300007265 Bacteria 1469
52 Ga0099794_10129669 3300007265 Unclassified 1273
53 Ga0099795_10000552 3300007788 Bacteria 7043
54 Ga0105240_10093060 3300009093 Bacteria 3680
55 Ga0111539_10030732 3300009094 Bacteria 6529
56 Ga0105245_10095701 3300009098 Bacteria 2740
57 Ga0105247_10019663 3300009101 Bacteria 4055
58 Ga0105247_10111291 3300009101 Bacteria 1763
59 Ga0114129_10049269 3300009147 Bacteria 5919
60 Ga0114129_10101620 3300009147 Bacteria 3978
61 Ga0114129_10583151 3300009147 Bacteria 1451
62 Ga0105241_10164781 3300009174 Bacteria 1825
63 Ga0105248_10718900 3300009177 Bacteria 1127
64 Ga0099796_10002587 3300010159 Bacteria 4010
65 Ga0105239_10651472 3300010375 Bacteria 1203
66 Ga0105246_10031494 3300011119 Bacteria 3510
67 Ga0157378_10022273 3300013297 Bacteria 5577
68 Ga0157378_10068071 3300013297 Bacteria 3192
69 Ga0157378_10315993 3300013297 Bacteria 1516
70 Ga0157375_10055997 3300013308 Bacteria 3890
71 Ga0157375_10092363 3300013308 Bacteria 3090
72 Ga0157375_10144336 3300013308 Bacteria 2510
73 Ga0157375_10452051 3300013308 Bacteria 1450
74 Ga0163163_10009773 3300014325 Bacteria 8593
75 Ga0163163_10053273 3300014325 Bacteria 3993
76 Ga0163163_10487661 3300014325 Bacteria 1294
77 Ga0182008_10014072 3300014497 Bacteria 4196
78 Ga0157379_10009331 3300014968 Bacteria 8545
79 Ga0157376_10470897 3300014969 Bacteria 1229
80 Ga0182006_1029933 3300015261 Bacteria 2203
81 Ga0209758_1002747 3300025297 Bacteria 17262
82 Ga0207426_1001142 3300025302 Bacteria 23965
83 Ga0207710_10061779 3300025900 Bacteria 1701
84 Ga0207707_10092383 3300025912 Bacteria 2645
85 Ga0207693_10420285 3300025915 Bacteria 1045
86 Ga0207660_10137116 3300025917 Bacteria 1868
87 Ga0207660_10522435 3300025917 Bacteria 964
88 Ga0207657_10081484 3300025919 Bacteria 2718
89 Ga0207657_10396793 3300025919 Bacteria 1085
90 Ga0207649_10107854 3300025920 Bacteria 1855
91 Ga0207652_10296625 3300025921 Bacteria 1459
92 Ga0207650_10288323 3300025925 Unclassified 1338
93 Ga0207700_10192172 3300025928 Bacteria 1716
94 Ga0207700_10193475 3300025928 Bacteria 1710
95 Ga0207700_10625401 3300025928 Bacteria 959
96 Ga0207664_10656338 3300025929 Bacteria 943
97 Ga0207644_10024884 3300025931 Bacteria 4113
98 Ga0207690_10052598 3300025932 Bacteria 2729
99 Ga0207706_10214029 3300025933 Bacteria 1688
100 Ga0207711_10519706 3300025941 Bacteria 1110
101 Ga0207689_10084188 3300025942 Bacteria 2614
102 Ga0207661_10195941 3300025944 Bacteria 1774
103 Ga0207703_10089220 3300026035 Bacteria 2589
104 Ga0207639_10741358 3300026041 Bacteria 913
105 Ga0207678_10046846 3300026067 Bacteria 3739
106 Ga0207641_10392117 3300026088 Bacteria 1332
107 Ga0207676_10089921 3300026095 Bacteria 2518
108 Ga0207675_100250125 3300026118 Bacteria 1715
109 Ga0207675_100379056 3300026118 Bacteria 1391
110 Ga0207683_10042216 3300026121 Bacteria 3983
111 Ga0207683_10508044 3300026121 Bacteria 1113
112 Ga0209389_1000068 3300027296 Bacteria 98954
113 Ga0209700_100117 3300027363 Bacteria 115595
114 Ga0209179_1002863 3300027512 Bacteria 2403
115 Ga0268264_10529645 3300028381 Bacteria 1153
116 Ga0265318_10055986 3300028577 Bacteria 1475
117 Ga0265338_10172093 3300028800 Bacteria 1660
118 Ga0265340_10024347 3300031247 Bacteria 3076
119 Ga0265331_10017599 3300031250 Bacteria 3722
120 Ga0265316_10051396 3300031344 Bacteria 3238
121 Ga0265314_10004388 3300031711 Bacteria 13117
122 Ga0307516_10372319 3300031730 Bacteria 1091
123 Ga0307410_10354936 3300031852 Bacteria 1173
124 Ga0307407_10338683 3300031903 Bacteria 1061
125 Ga0373926_0006884 3300035083 Bacteria 3778
126 Ga0373926_0025848 3300035083 Bacteria 2051
127 Ga0373929_0019382 3300035085 Unclassified 1362
128 Ga0373944_0002106 3300035089 Bacteria 5056
129 Ga0373923_0027400 3300035111 Unclassified 2274
130 Ga0373923_0047552 3300035111 Bacteria 1788
131 Ga0373932_0037223 3300035112 Bacteria 1386
132 Ga0373936_0018834 3300035113 Bacteria 2670
133 Ga0373945_0005789 3300035116 Archaea 3967
134 Ga0373945_0069712 3300035116 Bacteria 1328
135 Ga0373953_0007482 3300035117 Bacteria 3661
136 Ga0373954_0029685 3300035118 Bacteria 2519
137 Ga0373954_0031677 3300035118 Bacteria 2442
138 Ga0373943_0031571 3300035170 Bacteria 2513
139 Ga0373946_0006769 3300035171 Bacteria 4165
140 Ga0373946_0051092 3300035171 Bacteria 1729
141 Ga0373955_0095104 3300035172 Bacteria 1703
142 Ga0373961_0059648 3300035241 Bacteria 1154
143 Ga0373924_0050803 3300035410 Bacteria 1718
144 Ga0373931_0106166 3300035691 Bacteria 1587
145 Ga0373931_0195766 3300035691 Bacteria 1205
146 Ga0373935_0015880 3300035692 Bacteria 4557
147 Ga0373935_0021957 3300035692 Bacteria 3908
148 Ga0373935_0058579 3300035692 Bacteria 2461
149 Ga0373935_0264290 3300035692 Bacteria 1207
150 Ga0373927_0025306 3300035695 Unclassified 3879
151 Ga0373927_0025899 3300035695 Bacteria 3834
152 Ga0373927_0027167 3300035695 Bacteria 3738
153 Ga0373927_0076568 3300035695 Bacteria 2166
154 Ga0373927_0146661 3300035695 Bacteria 1545
155 Ga0373947_0020329 3300035725 Bacteria 3832
156 Ga0373947_0044280 3300035725 Unclassified 2659
157 Ga0373947_0054006 3300035725 Bacteria 2424
158 Ga0373947_0118274 3300035725 Bacteria 1682
159 Ga0373947_0260334 3300035725 Bacteria 1149
160 Ga0373937_0019937 3300036401 Bacteria 6006
161 Ga0373937_0272570 3300036401 Bacteria 1597
162 Ga0373925_0070124 3300037068 Bacteria 2649
163 Ga0395898_0067994 3300037466 Bacteria 3448
164 Ga0451802_0899642 3300041460 Bacteria 1373
165 Ga0451807_1188679 3300041486 Bacteria 1113
166 Ga0451833_1280534 3300041491 Bacteria 1512
167 Ga0439434_0076664 3300042435 Bacteria 1057
168 Ga0466963_0031195 3300044694 Bacteria 3444
169 Ga0466963_0308959 3300044694 Bacteria 1112
170 Ga0453684_0114683 3300044712 Bacteria 3266
171 Ga0466957_0256964 3300044842 Bacteria 1163
172 Ga0466967_0075849 3300045976 Bacteria 3023
173 Ga0466967_0250231 3300045976 Bacteria 1693
174 Ga0466967_0267652 3300045976 Bacteria 1637
175 Ga0495592_0068107 3300046454 Bacteria 2599
176 Ga0495592_0117294 3300046454 Unclassified 1877
177 Ga0495629_0070617 3300046459 Bacteria 2436
178 Ga0495651_0000580 3300046462 Bacteria 28404
179 Ga0495651_0000793 3300046462 Bacteria 24515
180 Ga0495651_0034225 3300046462 Bacteria 3960
181 Ga0495651_0043029 3300046462 Unclassified 3504
182 Ga0495653_0034006 3300046463 Bacteria 4035
183 Ga0495580_0029872 3300046472 Bacteria 3952
184 Ga0495580_0047173 3300046472 Unclassified 3054
185 Ga0495582_0002201 3300046473 Bacteria 10913
186 Ga0495582_0017513 3300046473 Unclassified 3920
187 Ga0495582_0203390 3300046473 Bacteria 1131
188 Ga0495639_0032790 3300046475 Bacteria 2318
189 Ga0495639_0075116 3300046475 Bacteria 1566
190 Ga0495662_0007346 3300046476 Bacteria 5447
191 Ga0495664_0002978 3300046477 Archaea 9150
192 Ga0495664_0067966 3300046477 Bacteria 2126
193 Ga0495664_0256948 3300046477 Unclassified 1056
194 Ga0495584_0076462 3300046491 Bacteria 1684
195 Ga0495585_0017268 3300046492 Bacteria 4172
196 Ga0495585_0128438 3300046492 Bacteria 1336
197 Ga0495608_0018180 3300046511 Bacteria 4853
198 Ga0495608_0042120 3300046511 Bacteria 3054
199 Ga0495608_0110767 3300046511 Bacteria 1765
200 Ga0495618_0016203 3300046514 Bacteria 4556
201 Ga0495618_0032167 3300046514 Bacteria 3285
202 Ga0495618_0054958 3300046514 Bacteria 2520
203 Ga0495620_0080753 3300046515 Bacteria 1316
204 Ga0495628_0000589 3300046516 Bacteria 33428
205 Ga0495628_0028066 3300046516 Bacteria 4577
206 Ga0495628_0126899 3300046516 Bacteria 1954
207 Ga0495630_0037053 3300046517 Bacteria 3645
208 Ga0495630_0113796 3300046517 Bacteria 2050
209 Ga0495637_0084268 3300046520 Bacteria 1263
210 Ga0495644_0000706 3300046523 Bacteria 13835
211 Ga0495666_0013735 3300046526 Bacteria 4037
212 Ga0495666_0026305 3300046526 Bacteria 2869
213 Ga0495652_0005017 3300046529 Bacteria 12540
214 Ga0495652_0023800 3300046529 Bacteria 5427
215 Ga0495652_0028160 3300046529 Archaea 4948
216 Ga0495665_0011500 3300046531 Bacteria 4792
217 Ga0495665_0037887 3300046531 Unclassified 2572
218 Ga0495640_0013318 3300046533 Archaea 6249
219 Ga0495640_0082567 3300046533 Bacteria 2133
220 Ga0495640_0155802 3300046533 Bacteria 1466
221 Ga0495586_0008181 3300046535 Bacteria 5573
222 Ga0495587_0000591 3300046536 Bacteria 24874
223 Ga0495587_0026350 3300046536 Unclassified 3546
224 Ga0495645_0002944 3300046543 Bacteria 11535
225 Ga0495633_0011814 3300046558 Bacteria 4683
226 Ga0495633_0207833 3300046558 Bacteria 898
227 Ga0495667_0000907 3300046559 Bacteria 19119
228 Ga0495667_0026081 3300046559 Bacteria 3936
229 Ga0495667_0039622 3300046559 Bacteria 3132
230 Ga0495667_0071416 3300046559 Unclassified 2264
231 Ga0495656_0035426 3300046615 Bacteria 2050
232 Ga0495634_0014795 3300046642 Archaea 5613
233 Ga0495634_0077169 3300046642 Bacteria 2186
234 Ga0495611_0040385 3300046648 Bacteria 2080
235 Ga0495611_0142692 3300046648 Bacteria 1118
236 Ga0495635_0004075 3300046663 Bacteria 10142
237 Ga0495635_0044748 3300046663 Bacteria 3053
238 Ga0495635_0070394 3300046663 Bacteria 2398
239 Ga0495659_0022078 3300046664 Bacteria 2149
240 Ga0495588_0025544 3300046674 Bacteria 2944
241 Ga0495657_0108837 3300046675 Bacteria 1758
242 Ga0495599_0017684 3300046678 Bacteria 4435
243 Ga0495623_0028213 3300046679 Bacteria 3611
244 Ga0495646_0059936 3300046680 Bacteria 2271
245 Ga0495647_0005716 3300046681 Bacteria 4089
246 Ga0495658_0020752 3300046683 Bacteria 3453
247 Ga0495658_0054103 3300046683 Bacteria 2282
248 Ga0495658_0197252 3300046683 Bacteria 1253
249 Ga0495613_0148740 3300046689 Unclassified 1671
250 Ga0495624_0019841 3300046690 Bacteria 4479
251 Ga0495624_0021693 3300046690 Bacteria 4256
252 Ga0495624_0049385 3300046690 Bacteria 2668
253 Ga0495670_0211999 3300046691 Bacteria 1027
254 Ga0495600_0002070 3300046809 Bacteria 11320
255 Ga0495600_0018346 3300046809 Bacteria 4458
256 Ga0495600_0018889 3300046809 Bacteria 4398
257 Ga0495581_0081497 3300047315 Bacteria 1873
258 Ga0495604_0000323 3300047317 Bacteria 42953
259 Ga0495674_0034824 3300047319 Bacteria 4549
260 Ga0495674_0041878 3300047319 Bacteria 4088
261 Ga0495676_0058521 3300047321 Unclassified 3032
262 Ga0495676_0102013 3300047321 Bacteria 2121
263 Ga0495676_0376873 3300047321 Bacteria 944
264 Ga0495680_0000568 3300047322 Bacteria 41591
265 Ga0495680_0014178 3300047322 Bacteria 6918
266 Ga0495675_0002003 3300047444 Bacteria 12168
267 Ga0495675_0006860 3300047444 Bacteria 6991
268 Ga0495675_0008074 3300047444 Bacteria 6515
269 Ga0495684_0001043 3300047471 Bacteria 22412
270 Ga0495684_0014410 3300047471 Bacteria 6082
271 Ga0495684_0198358 3300047471 Unclassified 1480
272 Ga0495593_0023711 3300047673 Bacteria 3407
273 Ga0495593_0080322 3300047673 Bacteria 1687
274 Ga0495593_0112757 3300047673 Unclassified 1387
275 Ga0495614_0009303 3300048089 Bacteria 4347
276 Ga0495614_0169714 3300048089 Bacteria 978
277 Ga0496102_0227248 3300048905 Bacteria 1760
278 Ga0496103_0157561 3300048906 Bacteria 1456
279 Ga0496106_0022083 3300048909 Bacteria 4727
280 Ga0496107_0147076 3300048910 Bacteria 1742
281 Ga0496108_0003418 3300048911 Bacteria 12745
282 Ga0496108_0185648 3300048911 Bacteria 1801
283 Ga0496109_0024786 3300048912 Bacteria 5336
284 Ga0496109_0106998 3300048912 Bacteria 2598
285 Ga0496110_0077526 3300048913 Bacteria 2957
286 Ga0496111_0070993 3300048914 Bacteria 2534
287 Ga0496113_0050217 3300048916 Bacteria 3109
288 Ga0496114_0391861 3300048917 Bacteria 1230
289 Ga0496115_0173778 3300048918 Bacteria 1781
290 Ga0496115_0377461 3300048918 Bacteria 1153
291 Ga0496117_0100169 3300048920 Bacteria 1836
292 Ga0496118_0072262 3300048921 Bacteria 2479
293 Ga0496125_0022725 3300048928 Bacteria 5814
294 Ga0501034_0036110 3300049571 Bacteria 5010
295 Ga0501072_0010447 3300049588 Bacteria 7072
296 Ga0501077_0105599 3300049593 Bacteria 1785
297 Ga0501083_0124984 3300049744 Bacteria 1686
298 Ga0501044_0025538 3300049823 Bacteria 6262
299 nmdc:mga00v17_10873_c1 3300050491 Bacteria 4986
300 nmdc:mga05p37_18617_c1 3300050507 Bacteria 8392
301 nmdc:mga05p37_209668_c1 3300050507 Bacteria 2356
302 nmdc:mga0qj67_404066_c1 3300050509 Bacteria 1102
303 nmdc:mga06r32_77570_c1 3300050510 Bacteria 3228
304 nmdc:mga08y16_30715_c1 3300050511 Bacteria 5650
305 nmdc:mga0n895_117835_c1 3300050512 Unclassified 2675
306 nmdc:mga0n895_41547_c1 3300050512 Bacteria 4472
307 nmdc:mga0n895_75203_c1 3300050512 Bacteria 3357
308 nmdc:mga0a205_89010_c1 3300050515 Bacteria 2984
309 Ga0495601_0001238 3300053077 Archaea 13999
310 Ga0495601_0319446 3300053077 Unclassified 1011
311 Ga0495612_0000681 3300053078 Archaea 13693
312 Ga0495612_0001828 3300053078 Bacteria 8724
313 Ga0495612_0021651 3300053078 Bacteria 2578
314 Ga0495595_0006505 3300053084 Bacteria 4766
315 Ga0495619_0006030 3300053085 Bacteria 7678
316 Ga0495619_0009081 3300053085 Archaea 6273
317 Ga0500578_0020943 3300053086 Bacteria 4204
318 Ga0500643_027913 3300053087 Bacteria 1749
319 Ga0500555_001480 3300053103 Bacteria 7139
320 Ga0500595_013032 3300053119 Bacteria 3193
321 Ga0500642_0000147 3300053130 Bacteria 30536
322 Ga0500568_0038390 3300053139 Bacteria 1938
323 Ga0500588_0034570 3300053146 Bacteria 1481
324 Ga0500634_0080870 3300053161 Bacteria 1675
325 Ga0500645_009740 3300053730 Bacteria 3216
326 Ga0501084_0219402 3300054114 Bacteria 1604
327 Ga0501082_0000025 3300060353 Bacteria 103262

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300060353 Ga0501082_0000025 Ga0501082_0000025_18697_19584 264
2 3300006844 Ga0075428_100133693 Ga0075428_1001336933 265
3 3300009147 Ga0114129_10101620 Ga0114129_101016203 265
4 3300050491 nmdc:mga00v17_10873_c1 nmdc:mga00v17_10873_c1_3171_4046 265
5 3300035695 Ga0373927_0146661 Ga0373927_0146661_94_903 266
6 3300007265 Ga0099794_10096802 Ga0099794_100968022 267
7 3300028577 Ga0265318_10055986 Ga0265318_100559862 268
8 3300028800 Ga0265338_10172093 Ga0265338_101720932 268
9 3300031344 Ga0265316_10051396 Ga0265316_100513964 268
10 3300007265 Ga0099794_10129669 Ga0099794_101296691 269
11 3300031711 Ga0265314_10004388 Ga0265314_1000438811 269
12 3300035083 Ga0373926_0025848 Ga0373926_0025848_540_1367 269
13 3300035089 Ga0373944_0002106 Ga0373944_0002106_883_1710 269
14 3300035111 Ga0373923_0047552 Ga0373923_0047552_638_1465 269
15 3300035113 Ga0373936_0018834 Ga0373936_0018834_105_932 269
16 3300035116 Ga0373945_0069712 Ga0373945_0069712_264_1091 269
17 3300035117 Ga0373953_0007482 Ga0373953_0007482_214_1041 269
18 3300035118 Ga0373954_0031677 Ga0373954_0031677_79_906 269
19 3300035170 Ga0373943_0031571 Ga0373943_0031571_1192_2019 269
20 3300035171 Ga0373946_0006769 Ga0373946_0006769_1208_2035 269
21 3300035172 Ga0373955_0095104 Ga0373955_0095104_705_1532 269
22 3300035410 Ga0373924_0050803 Ga0373924_0050803_374_1201 269
23 3300035692 Ga0373935_0264290 Ga0373935_0264290_191_1018 269
24 3300035695 Ga0373927_0027167 Ga0373927_0027167_1002_1829 269
25 3300036401 Ga0373937_0272570 Ga0373937_0272570_49_876 269
26 3300046454 Ga0495592_0068107 Ga0495592_0068107_1301_2128 269
27 3300046459 Ga0495629_0070617 Ga0495629_0070617_755_1582 269
28 3300046462 Ga0495651_0034225 Ga0495651_0034225_1022_1849 269
29 3300046472 Ga0495580_0029872 Ga0495580_0029872_2566_3393 269
30 3300046473 Ga0495582_0002201 Ga0495582_0002201_3275_4102 269
31 3300046475 Ga0495639_0075116 Ga0495639_0075116_685_1512 269
32 3300046477 Ga0495664_0067966 Ga0495664_0067966_412_1239 269
33 3300046491 Ga0495584_0076462 Ga0495584_0076462_195_1022 269
34 3300046492 Ga0495585_0017268 Ga0495585_0017268_2952_3779 269
35 3300046511 Ga0495608_0110767 Ga0495608_0110767_407_1234 269
36 3300046514 Ga0495618_0032167 Ga0495618_0032167_1757_2584 269
37 3300046516 Ga0495628_0126899 Ga0495628_0126899_919_1746 269
38 3300046523 Ga0495644_0000706 Ga0495644_0000706_12621_13448 269
39 3300046526 Ga0495666_0026305 Ga0495666_0026305_1467_2294 269
40 3300046531 Ga0495665_0011500 Ga0495665_0011500_3853_4680 269
41 3300046533 Ga0495640_0082567 Ga0495640_0082567_924_1751 269
42 3300046558 Ga0495633_0011814 Ga0495633_0011814_2556_3383 269
43 3300046559 Ga0495667_0039622 Ga0495667_0039622_2236_3063 269
44 3300046615 Ga0495656_0035426 Ga0495656_0035426_1015_1842 269
45 3300046642 Ga0495634_0077169 Ga0495634_0077169_1267_2094 269
46 3300046648 Ga0495611_0142692 Ga0495611_0142692_218_1045 269
47 3300046663 Ga0495635_0044748 Ga0495635_0044748_1812_2639 269
48 3300046664 Ga0495659_0022078 Ga0495659_0022078_1061_1888 269
49 3300046674 Ga0495588_0025544 Ga0495588_0025544_797_1624 269
50 3300046678 Ga0495599_0017684 Ga0495599_0017684_1134_1961 269
51 3300046680 Ga0495646_0059936 Ga0495646_0059936_743_1570 269
52 3300046681 Ga0495647_0005716 Ga0495647_0005716_218_1045 269
53 3300046683 Ga0495658_0197252 Ga0495658_0197252_346_1173 269
54 3300046690 Ga0495624_0019841 Ga0495624_0019841_1884_2711 269
55 3300046691 Ga0495670_0211999 Ga0495670_0211999_89_916 269
56 3300046809 Ga0495600_0018889 Ga0495600_0018889_1193_2020 269
57 3300047315 Ga0495581_0081497 Ga0495581_0081497_345_1172 269
58 3300047321 Ga0495676_0376873 Ga0495676_0376873_74_901 269
59 3300047471 Ga0495684_0014410 Ga0495684_0014410_4732_5559 269
60 3300047673 Ga0495593_0023711 Ga0495593_0023711_797_1624 269
61 3300048089 Ga0495614_0169714 Ga0495614_0169714_82_909 269
62 3300049588 Ga0501072_0010447 Ga0501072_0010447_5450_6262 269
63 3300049744 Ga0501083_0124984 Ga0501083_0124984_455_1267 269
64 3300053078 Ga0495612_0021651 Ga0495612_0021651_44_871 269
65 3300053084 Ga0495595_0006505 Ga0495595_0006505_702_1529 269
66 3300053085 Ga0495619_0006030 Ga0495619_0006030_1903_2730 269
67 3300054114 Ga0501084_0219402 Ga0501084_0219402_564_1376 269
68 iso_pu_bacteria 2842038055 2842039882 269
69 iso_pu_bacteria 2842045827 2842047172 269
70 3300005471 Ga0070698_100408332 Ga0070698_1004083321 270
71 3300005842 Ga0068858_100651742 Ga0068858_1006517421 270
72 3300005843 Ga0068860_100605200 Ga0068860_1006052002 270
73 3300005937 Ga0081455_10017410 Ga0081455_100174102 270
74 3300005937 Ga0081455_10058862 Ga0081455_100588623 270
75 3300006173 Ga0070716_100278607 Ga0070716_1002786071 270
76 3300006847 Ga0075431_100086837 Ga0075431_1000868373 270
77 3300006847 Ga0075431_100091035 Ga0075431_1000910354 270
78 3300006847 Ga0075431_100301179 Ga0075431_1003011791 270
79 3300006871 Ga0075434_100018900 Ga0075434_1000189002 270
80 3300009094 Ga0111539_10030732 Ga0111539_100307327 270
81 3300009098 Ga0105245_10095701 Ga0105245_100957012 270
82 3300009147 Ga0114129_10049269 Ga0114129_100492699 270
83 3300009147 Ga0114129_10583151 Ga0114129_105831511 270
84 3300013308 Ga0157375_10144336 Ga0157375_101443361 270
85 3300014968 Ga0157379_10009331 Ga0157379_100093312 270
86 3300026035 Ga0207703_10089220 Ga0207703_100892202 270
87 3300028381 Ga0268264_10529645 Ga0268264_105296451 270
88 3300035692 Ga0373935_0058579 Ga0373935_0058579_1485_2321 270
89 3300035695 Ga0373927_0025899 Ga0373927_0025899_2720_3556 270
90 3300035725 Ga0373947_0054006 Ga0373947_0054006_594_1430 270
91 3300037068 Ga0373925_0070124 Ga0373925_0070124_625_1449 270
92 3300045976 Ga0466967_0250231 Ga0466967_0250231_816_1637 270
93 3300046473 Ga0495582_0017513 Ga0495582_0017513_642_1478 270
94 3300046475 Ga0495639_0032790 Ga0495639_0032790_1343_2179 270
95 3300046517 Ga0495630_0113796 Ga0495630_0113796_392_1228 270
96 3300046520 Ga0495637_0084268 Ga0495637_0084268_414_1238 270
97 3300046683 Ga0495658_0020752 Ga0495658_0020752_2545_3381 270
98 3300047321 Ga0495676_0102013 Ga0495676_0102013_424_1260 270
99 3300049593 Ga0501077_0105599 Ga0501077_0105599_660_1484 270
100 3300050507 nmdc:mga05p37_209668_c1 nmdc:mga05p37_209668_c1_350_1174 270
101 3300050511 nmdc:mga08y16_30715_c1 nmdc:mga08y16_30715_c1_494_1318 270
102 3300050512 nmdc:mga0n895_41547_c1 nmdc:mga0n895_41547_c1_807_1631 270
103 iso_pu_bacteria 2932794094 2932796379 270
104 iso_pu_bacteria 2932801729 2932808997 270
105 iso_pu_bacteria 2935883170 2935886710 270
106 iso_pu_bacteria 2941531003 2941534022 270
107 iso_pu_bacteria 3005594810 3005598336 270
108 iso_pu_bacteria 8056967851 8056972619 270
109 3300005339 Ga0070660_100061963 Ga0070660_1000619632 271
110 3300005353 Ga0070669_100098342 Ga0070669_1000983422 271
111 3300005366 Ga0070659_100008288 Ga0070659_1000082881 271
112 3300006237 Ga0097621_100285033 Ga0097621_1002850332 271
113 3300013297 Ga0157378_10068071 Ga0157378_100680712 271
114 3300014497 Ga0182008_10014072 Ga0182008_100140722 271
115 3300015261 Ga0182006_1029933 Ga0182006_10299332 271
116 3300025919 Ga0207657_10081484 Ga0207657_100814842 271
117 3300025932 Ga0207690_10052598 Ga0207690_100525981 271
118 3300031247 Ga0265340_10024347 Ga0265340_100243472 271
119 3300031852 Ga0307410_10354936 Ga0307410_103549362 271
120 3300035112 Ga0373932_0037223 Ga0373932_0037223_178_1152 271
121 3300044694 Ga0466963_0031195 Ga0466963_0031195_819_1643 271
122 3300044694 Ga0466963_0308959 Ga0466963_0308959_137_961 271
123 3300044842 Ga0466957_0256964 Ga0466957_0256964_58_882 271
124 3300045976 Ga0466967_0075849 Ga0466967_0075849_360_1184 271
125 3300045976 Ga0466967_0267652 Ga0466967_0267652_658_1482 271
126 3300048920 Ga0496117_0100169 Ga0496117_0100169_241_1080 271
127 3300048921 Ga0496118_0072262 Ga0496118_0072262_539_1378 271
128 3300050509 nmdc:mga0qj67_404066_c1 nmdc:mga0qj67_404066_c1_21_872 271
129 3300050510 nmdc:mga06r32_77570_c1 nmdc:mga06r32_77570_c1_234_1085 271
130 iso_pu_bacteria 2513237161 2514010670 271
131 iso_pu_bacteria 2617270735 2617352187 271
132 iso_pu_bacteria 2824671348 2824676907 271
133 iso_pu_bacteria 2841974524 2841975836 271
134 iso_pu_bacteria 2841983080 2841991094 271
135 iso_pu_bacteria 3005710791 3005714051 271
136 3300005336 Ga0070680_100166369 Ga0070680_1001663693 272
137 3300005435 Ga0070714_100331723 Ga0070714_1003317231 272
138 3300025917 Ga0207660_10137116 Ga0207660_101371163 272
139 3300025928 Ga0207700_10192172 Ga0207700_101921721 272
140 3300025929 Ga0207664_10656338 Ga0207664_106563381 272
141 3300037466 Ga0395898_0067994 Ga0395898_0067994_464_1285 272
142 iso_pu_bacteria 2507262055 2507509467 272
143 iso_pu_bacteria 2508501009 2508543513 272
144 iso_pu_bacteria 2508501042 2508698709 272
145 iso_pu_bacteria 2824687955 2824695699 272
146 iso_pu_bacteria 2824773399 2824779268 272
147 iso_pu_bacteria 2838122688 2838128629 272
148 iso_pu_bacteria 2841941048 2841948812 272
149 iso_pu_bacteria 2841949485 2841950775 272
150 iso_pu_bacteria 2841966195 2841967088 272
151 iso_pu_bacteria 2847930680 2847935138 272
152 iso_pu_bacteria 2874628541 2874636381 272
153 iso_pu_bacteria 2879083081 2879083509 272
154 iso_pu_bacteria 2935648319 2935651716 272
155 iso_pu_bacteria 2935656913 2935660526 272
156 iso_pu_bacteria 2935984226 2935990327 272
157 iso_pu_bacteria 2936011229 2936014582 272
158 iso_pu_bacteria 2936019824 2936023622 272
159 iso_pu_bacteria 2936028420 2936032650 272
160 iso_pu_bacteria 2936046547 2936050323 272
161 iso_pu_bacteria 2936055302 2936059185 272
162 iso_pu_bacteria 8016630954 8016631985 272
163 3300005290 Ga0065712_10119854 Ga0065712_101198541 273
164 3300005355 Ga0070671_100040168 Ga0070671_1000401682 273
165 3300005367 Ga0070667_100297714 Ga0070667_1002977141 273
166 3300005445 Ga0070708_100372500 Ga0070708_1003725001 273
167 3300005456 Ga0070678_100145943 Ga0070678_1001459432 273
168 3300005535 Ga0070684_100180328 Ga0070684_1001803282 273
169 3300005539 Ga0068853_100032644 Ga0068853_1000326443 273
170 3300005843 Ga0068860_100486136 Ga0068860_1004861362 273
171 3300006038 Ga0075365_10210431 Ga0075365_102104312 273
172 3300006195 Ga0075366_10060848 Ga0075366_100608483 273
173 3300007788 Ga0099795_10000552 Ga0099795_100005524 273
174 3300009093 Ga0105240_10093060 Ga0105240_100930602 273
175 3300009101 Ga0105247_10111291 Ga0105247_101112912 273
176 3300010159 Ga0099796_10002587 Ga0099796_100025871 273
177 3300010375 Ga0105239_10651472 Ga0105239_106514721 273
178 3300014325 Ga0163163_10487661 Ga0163163_104876612 273
179 3300025931 Ga0207644_10024884 Ga0207644_100248843 273
180 3300026041 Ga0207639_10741358 Ga0207639_107413581 273
181 3300026118 Ga0207675_100379056 Ga0207675_1003790562 273
182 3300026121 Ga0207683_10508044 Ga0207683_105080441 273
183 3300027512 Ga0209179_1002863 Ga0209179_10028632 273
184 3300031730 Ga0307516_10372319 Ga0307516_103723191 273
185 3300041460 Ga0451802_0899642 Ga0451802_0899642_52_882 273
186 3300041486 Ga0451807_1188679 Ga0451807_1188679_223_1053 273
187 3300046473 Ga0495582_0203390 Ga0495582_0203390_193_1023 273
188 3300046492 Ga0495585_0128438 Ga0495585_0128438_70_900 273
189 3300046558 Ga0495633_0207833 Ga0495633_0207833_45_875 273
190 3300046648 Ga0495611_0040385 Ga0495611_0040385_696_1526 273
191 3300048912 Ga0496109_0106998 Ga0496109_0106998_1233_2081 273
192 3300053087 Ga0500643_027913 Ga0500643_027913_709_1539 273
193 3300053146 Ga0500588_0034570 Ga0500588_0034570_42_872 273
194 3300053161 Ga0500634_0080870 Ga0500634_0080870_443_1273 273
195 3300053730 Ga0500645_009740 Ga0500645_009740_692_1522 273
196 3300005293 Ga0065715_10157406 Ga0065715_101574062 274
197 3300005334 Ga0068869_100054814 Ga0068869_1000548141 274
198 3300005336 Ga0070680_100248781 Ga0070680_1002487812 274
199 3300005337 Ga0070682_100408684 Ga0070682_1004086841 274
200 3300005435 Ga0070714_100090364 Ga0070714_1000903641 274
201 3300005435 Ga0070714_100312230 Ga0070714_1003122302 274
202 3300005436 Ga0070713_100008031 Ga0070713_1000080318 274
203 3300005530 Ga0070679_100027125 Ga0070679_1000271254 274
204 3300005545 Ga0070695_100106482 Ga0070695_1001064821 274
205 3300005547 Ga0070693_100042253 Ga0070693_1000422533 274
206 3300005618 Ga0068864_100103942 Ga0068864_1001039422 274
207 3300005937 Ga0081455_10024337 Ga0081455_100243373 274
208 3300006178 Ga0075367_10336406 Ga0075367_103364061 274
209 3300006195 Ga0075366_10054878 Ga0075366_100548782 274
210 3300006844 Ga0075428_100171035 Ga0075428_1001710351 274
211 3300006852 Ga0075433_10092315 Ga0075433_100923152 274
212 3300006871 Ga0075434_100023828 Ga0075434_1000238284 274
213 3300009101 Ga0105247_10019663 Ga0105247_100196633 274
214 3300009174 Ga0105241_10164781 Ga0105241_101647812 274
215 3300009177 Ga0105248_10718900 Ga0105248_107189001 274
216 3300011119 Ga0105246_10031494 Ga0105246_100314943 274
217 3300013297 Ga0157378_10022273 Ga0157378_100222733 274
218 3300013297 Ga0157378_10315993 Ga0157378_103159932 274
219 3300013308 Ga0157375_10055997 Ga0157375_100559972 274
220 3300013308 Ga0157375_10092363 Ga0157375_100923633 274
221 3300013308 Ga0157375_10452051 Ga0157375_104520512 274
222 3300014325 Ga0163163_10009773 Ga0163163_100097739 274
223 3300014325 Ga0163163_10053273 Ga0163163_100532732 274
224 3300014969 Ga0157376_10470897 Ga0157376_104708972 274
225 3300025900 Ga0207710_10061779 Ga0207710_100617791 274
226 3300025912 Ga0207707_10092383 Ga0207707_100923833 274
227 3300025915 Ga0207693_10420285 Ga0207693_104202851 274
228 3300025917 Ga0207660_10522435 Ga0207660_105224352 274
229 3300025920 Ga0207649_10107854 Ga0207649_101078542 274
230 3300025921 Ga0207652_10296625 Ga0207652_102966252 274
231 3300025925 Ga0207650_10288323 Ga0207650_102883232 274
232 3300025928 Ga0207700_10625401 Ga0207700_106254011 274
233 3300025933 Ga0207706_10214029 Ga0207706_102140291 274
234 3300025941 Ga0207711_10519706 Ga0207711_105197061 274
235 3300025942 Ga0207689_10084188 Ga0207689_100841884 274
236 3300025944 Ga0207661_10195941 Ga0207661_101959413 274
237 3300026067 Ga0207678_10046846 Ga0207678_100468462 274
238 3300026088 Ga0207641_10392117 Ga0207641_103921171 274
239 3300026095 Ga0207676_10089921 Ga0207676_100899211 274
240 3300026118 Ga0207675_100250125 Ga0207675_1002501252 274
241 3300026121 Ga0207683_10042216 Ga0207683_100422163 274
242 3300031903 Ga0307407_10338683 Ga0307407_103386831 274
243 3300035083 Ga0373926_0006884 Ga0373926_0006884_1480_2358 274
244 3300035085 Ga0373929_0019382 Ga0373929_0019382_193_1020 274
245 3300035111 Ga0373923_0027400 Ga0373923_0027400_878_1756 274
246 3300035116 Ga0373945_0005789 Ga0373945_0005789_1181_2008 274
247 3300035118 Ga0373954_0029685 Ga0373954_0029685_1435_2313 274
248 3300035171 Ga0373946_0051092 Ga0373946_0051092_258_1085 274
249 3300035241 Ga0373961_0059648 Ga0373961_0059648_246_1073 274
250 3300035691 Ga0373931_0106166 Ga0373931_0106166_474_1301 274
251 3300035691 Ga0373931_0195766 Ga0373931_0195766_340_1176 274
252 3300035692 Ga0373935_0015880 Ga0373935_0015880_747_1574 274
253 3300035692 Ga0373935_0021957 Ga0373935_0021957_1421_2299 274
254 3300035695 Ga0373927_0025306 Ga0373927_0025306_2876_3754 274
255 3300035695 Ga0373927_0076568 Ga0373927_0076568_590_1417 274
256 3300035725 Ga0373947_0020329 Ga0373947_0020329_2540_3367 274
257 3300035725 Ga0373947_0044280 Ga0373947_0044280_415_1293 274
258 3300035725 Ga0373947_0118274 Ga0373947_0118274_74_931 274
259 3300035725 Ga0373947_0260334 Ga0373947_0260334_132_959 274
260 3300036401 Ga0373937_0019937 Ga0373937_0019937_3787_4665 274
261 3300042435 Ga0439434_0076664 Ga0439434_0076664_61_897 274
262 3300044712 Ga0453684_0114683 Ga0453684_0114683_2301_3140 274
263 3300046454 Ga0495592_0117294 Ga0495592_0117294_856_1734 274
264 3300046462 Ga0495651_0000580 Ga0495651_0000580_894_1772 274
265 3300046462 Ga0495651_0000793 Ga0495651_0000793_12218_13096 274
266 3300046462 Ga0495651_0043029 Ga0495651_0043029_1879_2757 274
267 3300046463 Ga0495653_0034006 Ga0495653_0034006_1124_2002 274
268 3300046472 Ga0495580_0047173 Ga0495580_0047173_210_1088 274
269 3300046476 Ga0495662_0007346 Ga0495662_0007346_1280_2107 274
270 3300046477 Ga0495664_0002978 Ga0495664_0002978_3414_4241 274
271 3300046477 Ga0495664_0256948 Ga0495664_0256948_16_894 274
272 3300046511 Ga0495608_0018180 Ga0495608_0018180_2308_3186 274
273 3300046511 Ga0495608_0042120 Ga0495608_0042120_1919_2797 274
274 3300046514 Ga0495618_0016203 Ga0495618_0016203_1077_1904 274
275 3300046514 Ga0495618_0054958 Ga0495618_0054958_927_1805 274
276 3300046516 Ga0495628_0000589 Ga0495628_0000589_11519_12397 274
277 3300046516 Ga0495628_0028066 Ga0495628_0028066_1950_2828 274
278 3300046517 Ga0495630_0037053 Ga0495630_0037053_2426_3304 274
279 3300046526 Ga0495666_0013735 Ga0495666_0013735_1362_2240 274
280 3300046529 Ga0495652_0005017 Ga0495652_0005017_9130_10008 274
281 3300046529 Ga0495652_0023800 Ga0495652_0023800_2926_3804 274
282 3300046529 Ga0495652_0028160 Ga0495652_0028160_3119_3946 274
283 3300046531 Ga0495665_0037887 Ga0495665_0037887_1078_1956 274
284 3300046533 Ga0495640_0013318 Ga0495640_0013318_3868_4695 274
285 3300046533 Ga0495640_0155802 Ga0495640_0155802_92_970 274
286 3300046535 Ga0495586_0008181 Ga0495586_0008181_719_1597 274
287 3300046536 Ga0495587_0000591 Ga0495587_0000591_9562_10440 274
288 3300046536 Ga0495587_0026350 Ga0495587_0026350_1374_2252 274
289 3300046543 Ga0495645_0002944 Ga0495645_0002944_4718_5596 274
290 3300046559 Ga0495667_0000907 Ga0495667_0000907_1615_2493 274
291 3300046559 Ga0495667_0026081 Ga0495667_0026081_1767_2645 274
292 3300046559 Ga0495667_0071416 Ga0495667_0071416_691_1569 274
293 3300046642 Ga0495634_0014795 Ga0495634_0014795_1290_2117 274
294 3300046663 Ga0495635_0004075 Ga0495635_0004075_7986_8864 274
295 3300046663 Ga0495635_0070394 Ga0495635_0070394_346_1173 274
296 3300046675 Ga0495657_0108837 Ga0495657_0108837_441_1319 274
297 3300046679 Ga0495623_0028213 Ga0495623_0028213_1423_2301 274
298 3300046683 Ga0495658_0054103 Ga0495658_0054103_1435_2262 274
299 3300046689 Ga0495613_0148740 Ga0495613_0148740_226_1104 274
300 3300046690 Ga0495624_0021693 Ga0495624_0021693_3303_4130 274
301 3300046690 Ga0495624_0049385 Ga0495624_0049385_1449_2327 274
302 3300046809 Ga0495600_0002070 Ga0495600_0002070_10382_11260 274
303 3300046809 Ga0495600_0018346 Ga0495600_0018346_123_1001 274
304 3300047317 Ga0495604_0000323 Ga0495604_0000323_9357_10235 274
305 3300047319 Ga0495674_0034824 Ga0495674_0034824_3211_4038 274
306 3300047319 Ga0495674_0041878 Ga0495674_0041878_1365_2243 274
307 3300047321 Ga0495676_0058521 Ga0495676_0058521_1078_1956 274
308 3300047322 Ga0495680_0000568 Ga0495680_0000568_11738_12616 274
309 3300047322 Ga0495680_0014178 Ga0495680_0014178_6027_6905 274
310 3300047444 Ga0495675_0002003 Ga0495675_0002003_4784_5662 274
311 3300047444 Ga0495675_0006860 Ga0495675_0006860_3793_4671 274
312 3300047444 Ga0495675_0008074 Ga0495675_0008074_3971_4849 274
313 3300047471 Ga0495684_0001043 Ga0495684_0001043_675_1553 274
314 3300047471 Ga0495684_0198358 Ga0495684_0198358_264_1142 274
315 3300047673 Ga0495593_0080322 Ga0495593_0080322_365_1192 274
316 3300047673 Ga0495593_0112757 Ga0495593_0112757_75_953 274
317 3300048089 Ga0495614_0009303 Ga0495614_0009303_1500_2378 274
318 3300048905 Ga0496102_0227248 Ga0496102_0227248_872_1729 274
319 3300048906 Ga0496103_0157561 Ga0496103_0157561_413_1240 274
320 3300048909 Ga0496106_0022083 Ga0496106_0022083_3402_4229 274
321 3300048910 Ga0496107_0147076 Ga0496107_0147076_518_1345 274
322 3300048911 Ga0496108_0003418 Ga0496108_0003418_8277_9104 274
323 3300048911 Ga0496108_0185648 Ga0496108_0185648_86_943 274
324 3300048912 Ga0496109_0024786 Ga0496109_0024786_2935_3762 274
325 3300048913 Ga0496110_0077526 Ga0496110_0077526_1274_2101 274
326 3300048914 Ga0496111_0070993 Ga0496111_0070993_205_1062 274
327 3300048916 Ga0496113_0050217 Ga0496113_0050217_1016_1873 274
328 3300048917 Ga0496114_0391861 Ga0496114_0391861_351_1178 274
329 3300048918 Ga0496115_0173778 Ga0496115_0173778_78_905 274
330 3300048918 Ga0496115_0377461 Ga0496115_0377461_298_1125 274
331 3300049571 Ga0501034_0036110 Ga0501034_0036110_977_1813 274
332 3300049823 Ga0501044_0025538 Ga0501044_0025538_3515_4351 274
333 3300050507 nmdc:mga05p37_18617_c1 nmdc:mga05p37_18617_c1_627_1454 274
334 3300050512 nmdc:mga0n895_117835_c1 nmdc:mga0n895_117835_c1_1462_2289 274
335 3300050512 nmdc:mga0n895_75203_c1 nmdc:mga0n895_75203_c1_164_991 274
336 3300050515 nmdc:mga0a205_89010_c1 nmdc:mga0a205_89010_c1_1329_2156 274
337 3300053077 Ga0495601_0001238 Ga0495601_0001238_6229_7056 274
338 3300053077 Ga0495601_0319446 Ga0495601_0319446_51_929 274
339 3300053078 Ga0495612_0000681 Ga0495612_0000681_6132_6959 274
340 3300053078 Ga0495612_0001828 Ga0495612_0001828_2272_3150 274
341 3300053085 Ga0495619_0009081 Ga0495619_0009081_3321_4148 274
342 3300053119 Ga0500595_013032 Ga0500595_013032_91_927 274
343 iso_pu_bacteria 2515154112 2515631295 274
344 iso_pu_bacteria 2876771140 2876771714 274
345 iso_pu_bacteria 2879074833 2879075501 274
346 iso_pu_bacteria 2879127579 2879134611 274
347 iso_pu_bacteria 2879142872 2879149854 274
348 iso_pu_bacteria 2935975950 2935980845 274
349 iso_pu_bacteria 8019638758 8019644351 274
350 iso_pu_bacteria 8019678201 8019683350 274
351 3300005458 Ga0070681_10047610 Ga0070681_100476102 275
352 3300025928 Ga0207700_10193475 Ga0207700_101934753 275
353 3300031250 Ga0265331_10017599 Ga0265331_100175992 275
354 3300053086 Ga0500578_0020943 Ga0500578_0020943_2480_3307 275
355 iso_pu_bacteria 2874590934 2874591579 275
356 iso_pu_bacteria 2874645413 2874646250 275
357 iso_pu_bacteria 2876818435 2876819022 275
358 iso_pu_bacteria 8019629233 8019635355 275
359 iso_pu_bacteria 8019659431 8019663181 275
360 iso_pu_bacteria 8019668869 8019672788 275
361 3300003354 JGI25160J50197_1001499 JGI25160J50197_10014997 276
362 3300006038 Ga0075365_10196476 Ga0075365_101964761 276
363 3300006051 Ga0075364_10048945 Ga0075364_100489451 276
364 3300006186 Ga0075369_10073933 Ga0075369_100739331 276
365 3300006941 Ga0099825_1028742 Ga0099825_10287422 276
366 3300025297 Ga0209758_1002747 Ga0209758_100274710 276
367 3300025302 Ga0207426_1001142 Ga0207426_100114212 276
368 3300025919 Ga0207657_10396793 Ga0207657_103967932 276
369 3300027296 Ga0209389_1000068 Ga0209389_100006893 276
370 3300027363 Ga0209700_100117 Ga0209700_1001178 276
371 3300041491 Ga0451833_1280534 Ga0451833_1280534_588_1418 276
372 3300046515 Ga0495620_0080753 Ga0495620_0080753_162_992 276
373 3300048928 Ga0496125_0022725 Ga0496125_0022725_1909_2739 276
374 3300053103 Ga0500555_001480 Ga0500555_001480_4798_5727 276
375 3300053130 Ga0500642_0000147 Ga0500642_0000147_25155_25985 276
376 3300053139 Ga0500568_0038390 Ga0500568_0038390_153_1082 276
377 iso_pu_bacteria 2935608549 2935611652 276
378 iso_pu_bacteria 2935819856 2935821129 276
379 iso_pu_bacteria 2935847175 2935850611 276
380 iso_pu_bacteria 2935908558 2935915514 276
381 iso_pu_bacteria 2935916978 2935921384 276
382 iso_pu_bacteria 2935926038 2935932887 276
383 iso_pu_bacteria 2935934488 2935941502 276
384 iso_pu_bacteria 2935942939 2935949661 276
385 iso_pu_bacteria 2935951376 2935958356 276
386 iso_pu_bacteria 2935967501 2935974474 276
387 iso_pu_bacteria 8019619141 8019627194 276
388 iso_pu_bacteria 8019687851 8019689061 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

117

308

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2br6-assembly1.cif.gz_A crystal structure of quorum-quenching n-acyl homoserine lactone lactonase 0.879 30 275
2btn-assembly1.cif.gz_A crystal structure and catalytic mechanism of the quorum-quenching n- acyl homoserine lactone hydrolase 0.8771 30 275
3dha-assembly1.cif.gz_A an ultral high resolution structure of n-acyl homoserine lactone hydrolase with the product n-hexanoyl-l-homoserine bound at an alternative site 0.8743 30 275
2br6-assembly1.cif.gz_A crystal structure of quorum-quenching n-acyl homoserine lactone lactonase 0.8617 30 275
2btn-assembly1.cif.gz_A crystal structure and catalytic mechanism of the quorum-quenching n- acyl homoserine lactone hydrolase 0.8601 30 275
ID Description Score Start End Superfamily
5ehtA01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8643 30 265 3.60.15.10
6n9qD00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8519 30 276 3.60.15.10
5ehtA01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8378 30 265 3.60.15.10
2r2dE00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8348 29 276 3.60.15.10
3aj0A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8255 28 276 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A560MC89-F1-model_v4 Glyoxylase-like metal-dependent hydrolase (Beta-lactamase superfamily II) 0.9899 27 276 GO:0016787
AF-A0A537S6P5-F1-model_v4 N-acyl homoserine lactonase family protein 0.9843 25 276
AF-A0A1I3HTG4-F1-model_v4 Metallo-beta-lactamase superfamily protein 0.9843 117 276
AF-Q8XS86-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9825 147 276
AF-A0A2U3Q0S9-F1-model_v4 AttM/AiiB family protein 0.979 59 276

Feature Viewer

pLDDT pTM Quality
91.27 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map