F430954

General Info

Members Datasets Scaffolds Average Seq Length
387 232 774 165

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0806058|Ga0501070_0806058_14_523
Length 161
Sequence VRSDSSGHAGPLSGAAGYRFAIVYSRFNQAITESLRDAAGKALAEAGAAMSDIEVVSVPGAFELPQAARCLAETGRFDAVICLGCVIRGETPHFEYISTSVAHGIQDASGGTGVPMAFGVLTTDTMAQRDNKGFEAAAAAIEMAQLFRRLHSTRPAGFAAS

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
131 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
132 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
138 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
139 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
140 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
141 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
142 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
143 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
146 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
147 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
148 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
151 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
152 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
153 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
161 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
162 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
163 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
164 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
165 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
166 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
167 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
168 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
169 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
170 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
171 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
179 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
213 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
214 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
215 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
228 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
229 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
230 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.43
Nodule 0
Rhizoplane 4.91
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 12.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0806058 3300049586 Unclassified 737
2 JGI24744J21845_10085432 3300002077 Unclassified 578
3 rootH2_10214039 3300003320 Bacteria 1233
4 Ga0070676_10470340 3300005328 Unclassified 887
5 Ga0070690_100411760 3300005330 Bacteria 995
6 Ga0070690_100433863 3300005330 Bacteria 971
7 Ga0070670_100009909 3300005331 Bacteria 8137
8 Ga0070670_100038632 3300005331 Bacteria 4105
9 Ga0070666_10074484 3300005335 Bacteria 2314
10 Ga0070666_10459095 3300005335 Bacteria 920
11 Ga0070682_100707065 3300005337 Bacteria 809
12 Ga0070682_101099308 3300005337 Unclassified 665
13 Ga0070660_100097407 3300005339 Bacteria 2327
14 Ga0070689_100547541 3300005340 Unclassified 997
15 Ga0070689_101807781 3300005340 Unclassified 557
16 Ga0070669_100005436 3300005353 Bacteria 9191
17 Ga0070675_100215594 3300005354 Bacteria 1670
18 Ga0070675_100265478 3300005354 Bacteria 1505
19 Ga0070675_100500930 3300005354 Bacteria 1094
20 Ga0070675_100512183 3300005354 Bacteria 1082
21 Ga0070671_101077838 3300005355 Unclassified 705
22 Ga0070674_100006856 3300005356 Bacteria 6678
23 Ga0070673_100100609 3300005364 Bacteria 2380
24 Ga0070659_100133861 3300005366 Bacteria 2015
25 Ga0070659_100689111 3300005366 Unclassified 883
26 Ga0070667_100154296 3300005367 Bacteria 2019
27 Ga0070711_100393515 3300005439 Bacteria 1123
28 Ga0070700_100608444 3300005441 Unclassified 857
29 Ga0070663_100422249 3300005455 Bacteria 1094
30 Ga0070678_100397789 3300005456 Bacteria 1196
31 Ga0070678_100499243 3300005456 Bacteria 1073
32 Ga0070662_100112472 3300005457 Bacteria 2076
33 Ga0070662_101291116 3300005457 Unclassified 628
34 Ga0070707_100104043 3300005468 Bacteria 2752
35 Ga0070707_100181054 3300005468 Bacteria 2054
36 Ga0070698_100194742 3300005471 Bacteria 1964
37 Ga0070679_100101799 3300005530 Bacteria 2859
38 Ga0070684_100000897 3300005535 Bacteria 21069
39 Ga0068853_100460445 3300005539 Bacteria 1197
40 Ga0070672_100398828 3300005543 Bacteria 1179
41 Ga0070686_100000481 3300005544 Bacteria 24146
42 Ga0070695_100239383 3300005545 Bacteria 1316
43 Ga0070693_100033512 3300005547 Bacteria 2835
44 Ga0070693_100457124 3300005547 Bacteria 897
45 Ga0070665_100001145 3300005548 Bacteria 32593
46 Ga0070665_100820187 3300005548 Unclassified 943
47 Ga0070704_100209059 3300005549 Bacteria 1580
48 Ga0070664_100003663 3300005564 Bacteria 12374
49 Ga0070664_100090589 3300005564 Bacteria 2647
50 Ga0068857_100003893 3300005577 Bacteria 12567
51 Ga0068857_100205528 3300005577 Bacteria 1796
52 Ga0070702_100593713 3300005615 Bacteria 829
53 Ga0068852_100543691 3300005616 Bacteria 1161
54 Ga0068852_100640213 3300005616 Unclassified 1070
55 Ga0068859_100156834 3300005617 Bacteria 2354
56 Ga0068859_102632667 3300005617 Unclassified 553
57 Ga0068864_100099067 3300005618 Bacteria 2582
58 Ga0068864_100110956 3300005618 Bacteria 2443
59 Ga0068864_100168066 3300005618 Bacteria 1998
60 Ga0068866_10239414 3300005718 Unclassified 1104
61 Ga0068861_100106085 3300005719 Bacteria 2244
62 Ga0068861_100544063 3300005719 Bacteria 1057
63 Ga0068861_100589077 3300005719 Bacteria 1019
64 Ga0068861_101368145 3300005719 Bacteria 690
65 Ga0068851_10265603 3300005834 Bacteria 977
66 Ga0068870_10055723 3300005840 Bacteria 2107
67 Ga0068863_100183286 3300005841 Bacteria 2010
68 Ga0068858_100008048 3300005842 Bacteria 10152
69 Ga0068858_100074660 3300005842 Bacteria 3148
70 Ga0068858_100320069 3300005842 Bacteria 1482
71 Ga0068860_100998022 3300005843 Bacteria 855
72 Ga0068862_100121497 3300005844 Bacteria 2303
73 Ga0068862_100916799 3300005844 Unclassified 862
74 Ga0075368_10029116 3300006042 Bacteria 2135
75 Ga0075368_10178521 3300006042 Bacteria 894
76 Ga0075364_10249575 3300006051 Bacteria 1206
77 Ga0075367_10003399 3300006178 Bacteria 7585
78 Ga0075367_10058674 3300006178 Bacteria 2290
79 Ga0075367_10282360 3300006178 Bacteria 1044
80 Ga0075366_10039544 3300006195 Bacteria 2788
81 Ga0075366_10049792 3300006195 Bacteria 2487
82 Ga0075366_10330944 3300006195 Bacteria 934
83 Ga0097621_100001067 3300006237 Bacteria 19163
84 Ga0097621_100025032 3300006237 Bacteria 4666
85 Ga0097621_100050602 3300006237 Bacteria 3379
86 Ga0075370_10371513 3300006353 Bacteria 856
87 Ga0068871_100000882 3300006358 Bacteria 19997
88 Ga0068871_100003753 3300006358 Bacteria 10458
89 Ga0068871_100046892 3300006358 Bacteria 3482
90 Ga0068871_100206641 3300006358 Bacteria 1697
91 Ga0075428_100011429 3300006844 Bacteria 9876
92 Ga0075428_100056010 3300006844 Bacteria 4319
93 Ga0075430_100076136 3300006846 Bacteria 2812
94 Ga0075431_100064469 3300006847 Bacteria 3783
95 Ga0075431_100162463 3300006847 Bacteria 2296
96 Ga0075433_10004699 3300006852 Bacteria 10640
97 Ga0075433_10186085 3300006852 Bacteria 1848
98 Ga0075433_10237197 3300006852 Bacteria 1619
99 Ga0075434_100004125 3300006871 Bacteria 13026
100 Ga0075434_100008876 3300006871 Bacteria 9360
101 Ga0075434_100588569 3300006871 Bacteria 1132
102 Ga0075434_100646104 3300006871 Unclassified 1076
103 Ga0075434_101042294 3300006871 Bacteria 832
104 Ga0075434_101202638 3300006871 Bacteria 770
105 Ga0075429_100006846 3300006880 Bacteria 9895
106 Ga0068865_100043146 3300006881 Bacteria 3080
107 Ga0075436_100158229 3300006914 Bacteria 1596
108 Ga0075436_100453605 3300006914 Bacteria 934
109 Ga0097620_100156833 3300006931 Bacteria 2354
110 Ga0097620_102633351 3300006931 Unclassified 553
111 Ga0075435_100001367 3300007076 Bacteria 15741
112 Ga0075435_100045342 3300007076 Bacteria 3524
113 Ga0105240_10296017 3300009093 Bacteria 1853
114 Ga0105240_10678510 3300009093 Bacteria 1127
115 Ga0111539_10001074 3300009094 Bacteria 36076
116 Ga0111539_10007305 3300009094 Bacteria 14144
117 Ga0111539_10244176 3300009094 Bacteria 2091
118 Ga0111539_10287396 3300009094 Bacteria 1914
119 Ga0111539_10673127 3300009094 Bacteria 1205
120 Ga0105245_10045287 3300009098 Bacteria 3929
121 Ga0105245_10578019 3300009098 Bacteria 1148
122 Ga0105245_10789572 3300009098 Unclassified 987
123 Ga0105247_10101547 3300009101 Bacteria 1839
124 Ga0114129_10014353 3300009147 Bacteria 11291
125 Ga0114129_10034646 3300009147 Bacteria 7131
126 Ga0105243_11521871 3300009148 Bacteria 693
127 Ga0105241_10088677 3300009174 Bacteria 2436
128 Ga0105242_10002352 3300009176 Bacteria 14918
129 Ga0105242_10012814 3300009176 Bacteria 6459
130 Ga0105242_10848120 3300009176 Unclassified 909
131 Ga0105248_10039155 3300009177 Bacteria 5308
132 Ga0105248_10190810 3300009177 Bacteria 2309
133 Ga0105248_10270989 3300009177 Bacteria 1912
134 Ga0105248_10618578 3300009177 Bacteria 1222
135 Ga0105248_11671404 3300009177 Bacteria 722
136 Ga0105249_10007989 3300009553 Bacteria 9223
137 Ga0105246_10164331 3300011119 Bacteria 1694
138 Ga0157374_10036446 3300013296 Bacteria 4505
139 Ga0157374_11112401 3300013296 Bacteria 811
140 Ga0157374_12085972 3300013296 Bacteria 594
141 Ga0157378_10019436 3300013297 Bacteria 5972
142 Ga0157378_10942374 3300013297 Bacteria 896
143 Ga0163162_10162412 3300013306 Bacteria 2356
144 Ga0157375_10156938 3300013308 Bacteria 2415
145 Ga0163163_10030557 3300014325 Bacteria 5191
146 Ga0163163_10180062 3300014325 Bacteria 2161
147 Ga0163163_10277972 3300014325 Bacteria 1726
148 Ga0157380_10990077 3300014326 Bacteria 873
149 Ga0157380_11226720 3300014326 Unclassified 794
150 Ga0157377_10034663 3300014745 Bacteria 2762
151 Ga0157377_10313545 3300014745 Unclassified 1040
152 Ga0157376_10012398 3300014969 Bacteria 6326
153 Ga0157376_10019114 3300014969 Bacteria 5272
154 Ga0157376_10037985 3300014969 Bacteria 3915
155 Ga0157376_11387936 3300014969 Unclassified 734
156 Ga0182005_1098618 3300015265 Bacteria 817
157 Ga0213876_10558035 3300021384 Unclassified 609
158 Ga0207710_10086364 3300025900 Bacteria 1462
159 Ga0207710_10276502 3300025900 Bacteria 844
160 Ga0207680_10027869 3300025903 Bacteria 3153
161 Ga0207680_10442771 3300025903 Bacteria 922
162 Ga0207684_10729025 3300025910 Bacteria 841
163 Ga0207654_10034736 3300025911 Bacteria 2803
164 Ga0207695_10315266 3300025913 Bacteria 1454
165 Ga0207663_10268948 3300025916 Bacteria 1262
166 Ga0207649_10034366 3300025920 Bacteria 3037
167 Ga0207646_10344594 3300025922 Unclassified 1346
168 Ga0207646_10367819 3300025922 Bacteria 1299
169 Ga0207681_10060851 3300025923 Bacteria 2594
170 Ga0207681_10865188 3300025923 Bacteria 756
171 Ga0207650_10016057 3300025925 Bacteria 5226
172 Ga0207650_11082161 3300025925 Unclassified 682
173 Ga0207659_10720797 3300025926 Unclassified 854
174 Ga0207659_10841861 3300025926 Bacteria 788
175 Ga0207687_10135246 3300025927 Bacteria 1864
176 Ga0207706_10240104 3300025933 Bacteria 1584
177 Ga0207706_10350569 3300025933 Bacteria 1284
178 Ga0207706_11351169 3300025933 Unclassified 587
179 Ga0207686_10017035 3300025934 Bacteria 4086
180 Ga0207686_10551074 3300025934 Unclassified 901
181 Ga0207709_10968917 3300025935 Bacteria 694
182 Ga0207669_10035400 3300025937 Unclassified 2840
183 Ga0207669_10106336 3300025937 Bacteria 1869
184 Ga0207704_10018853 3300025938 Bacteria 3612
185 Ga0207704_10060449 3300025938 Bacteria 2344
186 Ga0207665_10204330 3300025939 Bacteria 1440
187 Ga0207691_10374363 3300025940 Bacteria 1216
188 Ga0207711_10013249 3300025941 Bacteria 6851
189 Ga0207711_10028600 3300025941 Bacteria 4693
190 Ga0207711_10703508 3300025941 Bacteria 942
191 Ga0207689_10095254 3300025942 Bacteria 2445
192 Ga0207689_10225550 3300025942 Bacteria 1549
193 Ga0207661_10090911 3300025944 Bacteria 2542
194 Ga0207679_10006888 3300025945 Bacteria 7202
195 Ga0207667_10400680 3300025949 Bacteria 1397
196 Ga0207667_11014157 3300025949 Bacteria 817
197 Ga0207651_11318583 3300025960 Bacteria 649
198 Ga0207712_10004072 3300025961 Bacteria 9224
199 Ga0207712_10573302 3300025961 Bacteria 973
200 Ga0207668_10449977 3300025972 Bacteria 1099
201 Ga0207640_10267752 3300025981 Bacteria 1335
202 Ga0207658_10259882 3300025986 Bacteria 1479
203 Ga0207677_10030506 3300026023 Bacteria 3442
204 Ga0207677_10073305 3300026023 Bacteria 2424
205 Ga0207677_10143664 3300026023 Bacteria 1831
206 Ga0207703_10011917 3300026035 Bacteria 6770
207 Ga0207703_10171850 3300026035 Bacteria 1907
208 Ga0207703_10242999 3300026035 Bacteria 1619
209 Ga0207703_11909585 3300026035 Bacteria 570
210 Ga0207678_10007437 3300026067 Bacteria 9697
211 Ga0207678_10434395 3300026067 Bacteria 1140
212 Ga0207641_10733918 3300026088 Bacteria 974
213 Ga0207648_10080796 3300026089 Bacteria 2836
214 Ga0207676_10028161 3300026095 Bacteria 4194
215 Ga0207676_10455079 3300026095 Bacteria 1207
216 Ga0207676_10533181 3300026095 Bacteria 1119
217 Ga0207676_11034695 3300026095 Bacteria 810
218 Ga0207674_10005749 3300026116 Bacteria 14716
219 Ga0207674_10075991 3300026116 Bacteria 3368
220 Ga0207675_100012630 3300026118 Bacteria 7892
221 Ga0207675_100064998 3300026118 Bacteria 3410
222 Ga0207675_100308231 3300026118 Unclassified 1543
223 Ga0207675_100615839 3300026118 Bacteria 1090
224 Ga0207675_101384573 3300026118 Bacteria 724
225 Ga0207683_10504223 3300026121 Bacteria 1118
226 Ga0207683_10854658 3300026121 Bacteria 845
227 Ga0207683_10907857 3300026121 Bacteria 818
228 Ga0207698_10519337 3300026142 Bacteria 1162
229 Ga0209813_10062729 3300027866 Bacteria 1190
230 Ga0207428_10268295 3300027907 Bacteria 1269
231 Ga0207428_10290282 3300027907 Unclassified 1212
232 Ga0268266_10007803 3300028379 Bacteria 9598
233 Ga0268266_11649315 3300028379 Bacteria 617
234 Ga0268265_10028793 3300028380 Bacteria 3981
235 Ga0268265_10205120 3300028380 Bacteria 1713
236 Ga0268265_10431647 3300028380 Bacteria 1226
237 Ga0268264_10095204 3300028381 Bacteria 2576
238 Ga0268264_10466592 3300028381 Bacteria 1226
239 Ga0268264_10549248 3300028381 Bacteria 1133
240 Ga0268264_11036188 3300028381 Unclassified 828
241 Ga0265336_10052052 3300028666 Bacteria 1235
242 Ga0265320_10074589 3300031240 Bacteria 1593
243 Ga0265316_10343804 3300031344 Bacteria 1081
244 Ga0307408_100176978 3300031548 Bacteria 1708
245 Ga0307408_100728559 3300031548 Bacteria 894
246 Ga0307409_100450234 3300031995 Bacteria 1242
247 Ga0307416_100203123 3300032002 Bacteria 1882
248 Ga0307416_100346702 3300032002 Bacteria 1501
249 Ga0307411_10393023 3300032005 Bacteria 1144
250 Ga0373930_0000895 3300034816 Bacteria 4263
251 Ga0373948_0000547 3300034817 Bacteria 4739
252 Ga0373958_0052121 3300034819 Bacteria 866
253 Ga0373959_0045751 3300034820 Bacteria 931
254 Ga0373938_0000455 3300034957 Bacteria 6664
255 Ga0373928_0000949 3300035084 Bacteria 5702
256 Ga0373929_0000954 3300035085 Bacteria 5617
257 Ga0373940_0004240 3300035088 Bacteria 3016
258 Ga0373940_0147549 3300035088 Unclassified 747
259 Ga0373951_0000284 3300035091 Bacteria 16235
260 Ga0373952_0053536 3300035092 Bacteria 969
261 Ga0373932_0018855 3300035112 Bacteria 1790
262 Ga0373939_0000854 3300035114 Bacteria 7534
263 Ga0373939_0031158 3300035114 Bacteria 1539
264 Ga0373941_0001665 3300035115 Bacteria 4752
265 Ga0373941_0084567 3300035115 Bacteria 1077
266 Ga0373942_0000660 3300035207 Bacteria 9662
267 Ga0373961_0000449 3300035241 Bacteria 16580
268 Ga0373962_0000291 3300035242 Bacteria 10766
269 Ga0373924_0027411 3300035410 Bacteria 2265
270 Ga0373931_0010637 3300035691 Bacteria 4425
271 Ga0373933_0152961 3300035724 Unclassified 1462
272 Ga0373937_0807418 3300036401 Unclassified 886
273 Ga0373925_0507554 3300037068 Bacteria 990
274 Ga0395905_0518315 3300037471 Bacteria 1093
275 Ga0436365_0282360 3300039437 Bacteria 4107
276 Ga0439461_0007576 3300041410 Bacteria 1927
277 Ga0451807_1988229 3300041486 Bacteria 1080
278 Ga0439431_0118541 3300041997 Bacteria 737
279 Ga0439445_0057977 3300042004 Bacteria 1055
280 Ga0439449_0036033 3300042007 Bacteria 1840
281 Ga0439456_074351 3300042013 Bacteria 755
282 Ga0450923_015329 3300042125 Bacteria 1432
283 Ga0450895_002517 3300042132 Bacteria 1366
284 Ga0450896_000835 3300042133 Bacteria 3497
285 Ga0450899_006648 3300042135 Bacteria 1253
286 Ga0450909_022652 3300042185 Bacteria 941
287 Ga0439435_0007661 3300042436 Bacteria 2480
288 Ga0439435_0030981 3300042436 Bacteria 1452
289 Ga0453684_0229314 3300044712 Bacteria 2145
290 Ga0451576_0005989 3300045051 Bacteria 15034
291 Ga0451576_1166375 3300045051 Bacteria 805
292 Ga0466967_0969851 3300045976 Unclassified 846
293 Ga0466967_1084709 3300045976 Unclassified 798
294 Ga0495638_0161112 3300046460 Bacteria 1294
295 Ga0495580_0039644 3300046472 Bacteria 3370
296 Ga0495618_0738466 3300046514 Bacteria 577
297 Ga0495631_0334771 3300046518 Bacteria 644
298 Ga0495642_0265552 3300046528 Unclassified 751
299 Ga0495640_0211569 3300046533 Unclassified 1226
300 Ga0495640_0487462 3300046533 Unclassified 751
301 Ga0495645_0019581 3300046543 Bacteria 4872
302 Ga0495635_0521912 3300046663 Bacteria 780
303 Ga0495588_0722418 3300046674 Unclassified 521
304 Ga0495669_0003095 3300046684 Bacteria 6842
305 Ga0495613_0078097 3300046689 Bacteria 2409
306 Ga0495674_0940930 3300047319 Unclassified 665
307 Ga0495672_0159328 3300047320 Bacteria 1162
308 Ga0495684_0219388 3300047471 Bacteria 1395
309 Ga0496101_0221102 3300048904 Bacteria 1470
310 Ga0496101_0316211 3300048904 Bacteria 1225
311 Ga0496102_0082156 3300048905 Bacteria 2972
312 Ga0496102_1155308 3300048905 Bacteria 694
313 Ga0496103_0855661 3300048906 Bacteria 572
314 Ga0496104_0089637 3300048907 Bacteria 2938
315 Ga0496104_0106805 3300048907 Bacteria 2683
316 Ga0496104_0174857 3300048907 Bacteria 2058
317 Ga0496107_0285654 3300048910 Bacteria 1228
318 Ga0496109_1538741 3300048912 Bacteria 600
319 Ga0496111_0458461 3300048914 Bacteria 940
320 Ga0496111_0520930 3300048914 Unclassified 874
321 Ga0496112_0136567 3300048915 Bacteria 2422
322 Ga0496112_0447873 3300048915 Bacteria 1229
323 Ga0496112_1637286 3300048915 Bacteria 557
324 Ga0496113_0033009 3300048916 Bacteria 3766
325 Ga0496114_0130161 3300048917 Bacteria 2173
326 Ga0496114_0375135 3300048917 Bacteria 1259
327 Ga0501039_0336077 3300049575 Bacteria 1187
328 Ga0501040_0022578 3300049576 Bacteria 4213
329 Ga0501040_0224827 3300049576 Unclassified 1336
330 Ga0501042_0250212 3300049578 Bacteria 1279
331 Ga0501042_0254934 3300049578 Bacteria 1266
332 Ga0501042_0876574 3300049578 Bacteria 654
333 Ga0501048_0041483 3300049582 Bacteria 3296
334 Ga0501071_0005178 3300049587 Bacteria 8356
335 Ga0501071_0285808 3300049587 Bacteria 1248
336 Ga0501071_0629653 3300049587 Bacteria 825
337 Ga0501072_0385601 3300049588 Unclassified 1112
338 Ga0501075_0059709 3300049591 Bacteria 2873
339 Ga0501075_0304208 3300049591 Bacteria 1215
340 Ga0501075_0450479 3300049591 Bacteria 981
341 Ga0501076_0020534 3300049592 Bacteria 5056
342 Ga0501077_0126644 3300049593 Bacteria 1619
343 Ga0501077_0374317 3300049593 Unclassified 910
344 Ga0501079_0118184 3300049741 Bacteria 2061
345 Ga0501079_0300899 3300049741 Bacteria 1255
346 Ga0501081_0030169 3300049743 Bacteria 3669
347 Ga0501083_0311327 3300049744 Bacteria 1024
348 Ga0501045_0147882 3300049824 Bacteria 1748
349 nmdc:mga03n38_393157_c1 3300050490 Bacteria 762
350 nmdc:mga0k408_117036_c1 3300050493 Bacteria 1577
351 nmdc:mga0k408_397935_c1 3300050493 Bacteria 820
352 nmdc:mga06z11_96335_c1 3300050494 Bacteria 1616
353 nmdc:mga04h51_172577_c1 3300050495 Bacteria 838
354 nmdc:mga04h51_92184_c1 3300050495 Bacteria 1092
355 nmdc:mga05p37_133336_c1 3300050507 Bacteria 3047
356 nmdc:mga05p37_363433_c1 3300050507 Bacteria 1701
357 nmdc:mga05p37_42809_c1 3300050507 Bacteria 5566
358 nmdc:mga05p37_53391_c1 3300050507 Bacteria 4970
359 nmdc:mga09592_116854_c1 3300050508 Bacteria 2289
360 nmdc:mga09592_131806_c1 3300050508 Bacteria 2151
361 nmdc:mga09592_24776_c1 3300050508 Bacteria 4961
362 nmdc:mga09592_552997_c1 3300050508 Bacteria 988
363 nmdc:mga09592_9696_c1 3300050508 Bacteria 7821
364 nmdc:mga0qj67_56082_c1 3300050509 Bacteria 3123
365 nmdc:mga06r32_1339991_c1 3300050510 Bacteria 659
366 nmdc:mga06r32_18955_c1 3300050510 Bacteria 6309
367 nmdc:mga06r32_420136_c1 3300050510 Bacteria 1318
368 nmdc:mga08y16_135270_c1 3300050511 Bacteria 2562
369 nmdc:mga08y16_161208_c1 3300050511 Bacteria 2330
370 nmdc:mga08y16_55188_c1 3300050511 Bacteria 4152
371 nmdc:mga08y16_88700_c1 3300050511 Bacteria 3223
372 nmdc:mga0n895_1785_c1 3300050512 Bacteria 16332
373 nmdc:mga0n895_679368_c1 3300050512 Bacteria 1027
374 nmdc:mga0n895_871115_c1 3300050512 Unclassified 887
375 nmdc:mga0rr50_1704_c1 3300050513 Bacteria 12133
376 nmdc:mga0a205_259901_c1 3300050515 Bacteria 1614
377 nmdc:mga0a205_9342_c1 3300050515 Bacteria 8958
378 Ga0495601_0178812 3300053077 Bacteria 1387
379 Ga0495595_0132056 3300053084 Unclassified 1221
380 Ga0495619_0038697 3300053085 Bacteria 3112
381 Ga0500555_000241 3300053103 Bacteria 24303
382 Ga0500568_0005200 3300053139 Bacteria 6783
383 Ga0500616_0000358 3300053153 Bacteria 64893
384 Ga0500645_002590 3300053730 Bacteria 7953
385 Ga0501084_0091900 3300054114 Bacteria 2548
386 Ga0501084_0875804 3300054114 Bacteria 755
387 Ga0530510_0147116 3300061734 Bacteria 1738
388 Ga0501070_0806058
389 JGI24744J21845_10085432
390 rootH2_10214039
391 Ga0070676_10470340
392 Ga0070690_100411760
393 Ga0070690_100433863
394 Ga0070670_100009909
395 Ga0070670_100038632
396 Ga0070666_10074484
397 Ga0070666_10459095
398 Ga0070682_100707065
399 Ga0070682_101099308
400 Ga0070660_100097407
401 Ga0070689_100547541
402 Ga0070689_101807781
403 Ga0070669_100005436
404 Ga0070675_100215594
405 Ga0070675_100265478
406 Ga0070675_100500930
407 Ga0070675_100512183
408 Ga0070671_101077838
409 Ga0070674_100006856
410 Ga0070673_100100609
411 Ga0070659_100133861
412 Ga0070659_100689111
413 Ga0070667_100154296
414 Ga0070711_100393515
415 Ga0070700_100608444
416 Ga0070663_100422249
417 Ga0070678_100397789
418 Ga0070678_100499243
419 Ga0070662_100112472
420 Ga0070662_101291116
421 Ga0070707_100104043
422 Ga0070707_100181054
423 Ga0070698_100194742
424 Ga0070679_100101799
425 Ga0070684_100000897
426 Ga0068853_100460445
427 Ga0070672_100398828
428 Ga0070686_100000481
429 Ga0070695_100239383
430 Ga0070693_100033512
431 Ga0070693_100457124
432 Ga0070665_100001145
433 Ga0070665_100820187
434 Ga0070704_100209059
435 Ga0070664_100003663
436 Ga0070664_100090589
437 Ga0068857_100003893
438 Ga0068857_100205528
439 Ga0070702_100593713
440 Ga0068852_100543691
441 Ga0068852_100640213
442 Ga0068859_100156834
443 Ga0068859_102632667
444 Ga0068864_100099067
445 Ga0068864_100110956
446 Ga0068864_100168066
447 Ga0068866_10239414
448 Ga0068861_100106085
449 Ga0068861_100544063
450 Ga0068861_100589077
451 Ga0068861_101368145
452 Ga0068851_10265603
453 Ga0068870_10055723
454 Ga0068863_100183286
455 Ga0068858_100008048
456 Ga0068858_100074660
457 Ga0068858_100320069
458 Ga0068860_100998022
459 Ga0068862_100121497
460 Ga0068862_100916799
461 Ga0075368_10029116
462 Ga0075368_10178521
463 Ga0075364_10249575
464 Ga0075367_10003399
465 Ga0075367_10058674
466 Ga0075367_10282360
467 Ga0075366_10039544
468 Ga0075366_10049792
469 Ga0075366_10330944
470 Ga0097621_100001067
471 Ga0097621_100025032
472 Ga0097621_100050602
473 Ga0075370_10371513
474 Ga0068871_100000882
475 Ga0068871_100003753
476 Ga0068871_100046892
477 Ga0068871_100206641
478 Ga0075428_100011429
479 Ga0075428_100056010
480 Ga0075430_100076136
481 Ga0075431_100064469
482 Ga0075431_100162463
483 Ga0075433_10004699
484 Ga0075433_10186085
485 Ga0075433_10237197
486 Ga0075434_100004125
487 Ga0075434_100008876
488 Ga0075434_100588569
489 Ga0075434_100646104
490 Ga0075434_101042294
491 Ga0075434_101202638
492 Ga0075429_100006846
493 Ga0068865_100043146
494 Ga0075436_100158229
495 Ga0075436_100453605
496 Ga0097620_100156833
497 Ga0097620_102633351
498 Ga0075435_100001367
499 Ga0075435_100045342
500 Ga0105240_10296017
501 Ga0105240_10678510
502 Ga0111539_10001074
503 Ga0111539_10007305
504 Ga0111539_10244176
505 Ga0111539_10287396
506 Ga0111539_10673127
507 Ga0105245_10045287
508 Ga0105245_10578019
509 Ga0105245_10789572
510 Ga0105247_10101547
511 Ga0114129_10014353
512 Ga0114129_10034646
513 Ga0105243_11521871
514 Ga0105241_10088677
515 Ga0105242_10002352
516 Ga0105242_10012814
517 Ga0105242_10848120
518 Ga0105248_10039155
519 Ga0105248_10190810
520 Ga0105248_10270989
521 Ga0105248_10618578
522 Ga0105248_11671404
523 Ga0105249_10007989
524 Ga0105246_10164331
525 Ga0157374_10036446
526 Ga0157374_11112401
527 Ga0157374_12085972
528 Ga0157378_10019436
529 Ga0157378_10942374
530 Ga0163162_10162412
531 Ga0157375_10156938
532 Ga0163163_10030557
533 Ga0163163_10180062
534 Ga0163163_10277972
535 Ga0157380_10990077
536 Ga0157380_11226720
537 Ga0157377_10034663
538 Ga0157377_10313545
539 Ga0157376_10012398
540 Ga0157376_10019114
541 Ga0157376_10037985
542 Ga0157376_11387936
543 Ga0182005_1098618
544 Ga0213876_10558035
545 Ga0207710_10086364
546 Ga0207710_10276502
547 Ga0207680_10027869
548 Ga0207680_10442771
549 Ga0207684_10729025
550 Ga0207654_10034736
551 Ga0207695_10315266
552 Ga0207663_10268948
553 Ga0207649_10034366
554 Ga0207646_10344594
555 Ga0207646_10367819
556 Ga0207681_10060851
557 Ga0207681_10865188
558 Ga0207650_10016057
559 Ga0207650_11082161
560 Ga0207659_10720797
561 Ga0207659_10841861
562 Ga0207687_10135246
563 Ga0207706_10240104
564 Ga0207706_10350569
565 Ga0207706_11351169
566 Ga0207686_10017035
567 Ga0207686_10551074
568 Ga0207709_10968917
569 Ga0207669_10035400
570 Ga0207669_10106336
571 Ga0207704_10018853
572 Ga0207704_10060449
573 Ga0207665_10204330
574 Ga0207691_10374363
575 Ga0207711_10013249
576 Ga0207711_10028600
577 Ga0207711_10703508
578 Ga0207689_10095254
579 Ga0207689_10225550
580 Ga0207661_10090911
581 Ga0207679_10006888
582 Ga0207667_10400680
583 Ga0207667_11014157
584 Ga0207651_11318583
585 Ga0207712_10004072
586 Ga0207712_10573302
587 Ga0207668_10449977
588 Ga0207640_10267752
589 Ga0207658_10259882
590 Ga0207677_10030506
591 Ga0207677_10073305
592 Ga0207677_10143664
593 Ga0207703_10011917
594 Ga0207703_10171850
595 Ga0207703_10242999
596 Ga0207703_11909585
597 Ga0207678_10007437
598 Ga0207678_10434395
599 Ga0207641_10733918
600 Ga0207648_10080796
601 Ga0207676_10028161
602 Ga0207676_10455079
603 Ga0207676_10533181
604 Ga0207676_11034695
605 Ga0207674_10005749
606 Ga0207674_10075991
607 Ga0207675_100012630
608 Ga0207675_100064998
609 Ga0207675_100308231
610 Ga0207675_100615839
611 Ga0207675_101384573
612 Ga0207683_10504223
613 Ga0207683_10854658
614 Ga0207683_10907857
615 Ga0207698_10519337
616 Ga0209813_10062729
617 Ga0207428_10268295
618 Ga0207428_10290282
619 Ga0268266_10007803
620 Ga0268266_11649315
621 Ga0268265_10028793
622 Ga0268265_10205120
623 Ga0268265_10431647
624 Ga0268264_10095204
625 Ga0268264_10466592
626 Ga0268264_10549248
627 Ga0268264_11036188
628 Ga0265336_10052052
629 Ga0265320_10074589
630 Ga0265316_10343804
631 Ga0307408_100176978
632 Ga0307408_100728559
633 Ga0307409_100450234
634 Ga0307416_100203123
635 Ga0307416_100346702
636 Ga0307411_10393023
637 Ga0373930_0000895
638 Ga0373948_0000547
639 Ga0373958_0052121
640 Ga0373959_0045751
641 Ga0373938_0000455
642 Ga0373928_0000949
643 Ga0373929_0000954
644 Ga0373940_0004240
645 Ga0373940_0147549
646 Ga0373951_0000284
647 Ga0373952_0053536
648 Ga0373932_0018855
649 Ga0373939_0000854
650 Ga0373939_0031158
651 Ga0373941_0001665
652 Ga0373941_0084567
653 Ga0373942_0000660
654 Ga0373961_0000449
655 Ga0373962_0000291
656 Ga0373924_0027411
657 Ga0373931_0010637
658 Ga0373933_0152961
659 Ga0373937_0807418
660 Ga0373925_0507554
661 Ga0395905_0518315
662 Ga0436365_0282360
663 Ga0439461_0007576
664 Ga0451807_1988229
665 Ga0439431_0118541
666 Ga0439445_0057977
667 Ga0439449_0036033
668 Ga0439456_074351
669 Ga0450923_015329
670 Ga0450895_002517
671 Ga0450896_000835
672 Ga0450899_006648
673 Ga0450909_022652
674 Ga0439435_0007661
675 Ga0439435_0030981
676 Ga0453684_0229314
677 Ga0451576_0005989
678 Ga0451576_1166375
679 Ga0466967_0969851
680 Ga0466967_1084709
681 Ga0495638_0161112
682 Ga0495580_0039644
683 Ga0495618_0738466
684 Ga0495631_0334771
685 Ga0495642_0265552
686 Ga0495640_0211569
687 Ga0495640_0487462
688 Ga0495645_0019581
689 Ga0495635_0521912
690 Ga0495588_0722418
691 Ga0495669_0003095
692 Ga0495613_0078097
693 Ga0495674_0940930
694 Ga0495672_0159328
695 Ga0495684_0219388
696 Ga0496101_0221102
697 Ga0496101_0316211
698 Ga0496102_0082156
699 Ga0496102_1155308
700 Ga0496103_0855661
701 Ga0496104_0089637
702 Ga0496104_0106805
703 Ga0496104_0174857
704 Ga0496107_0285654
705 Ga0496109_1538741
706 Ga0496111_0458461
707 Ga0496111_0520930
708 Ga0496112_0136567
709 Ga0496112_0447873
710 Ga0496112_1637286
711 Ga0496113_0033009
712 Ga0496114_0130161
713 Ga0496114_0375135
714 Ga0501039_0336077
715 Ga0501040_0022578
716 Ga0501040_0224827
717 Ga0501042_0250212
718 Ga0501042_0254934
719 Ga0501042_0876574
720 Ga0501048_0041483
721 Ga0501071_0005178
722 Ga0501071_0285808
723 Ga0501071_0629653
724 Ga0501072_0385601
725 Ga0501075_0059709
726 Ga0501075_0304208
727 Ga0501075_0450479
728 Ga0501076_0020534
729 Ga0501077_0126644
730 Ga0501077_0374317
731 Ga0501079_0118184
732 Ga0501079_0300899
733 Ga0501081_0030169
734 Ga0501083_0311327
735 Ga0501045_0147882
736 nmdc:mga03n38_393157_c1
737 nmdc:mga0k408_117036_c1
738 nmdc:mga0k408_397935_c1
739 nmdc:mga06z11_96335_c1
740 nmdc:mga04h51_172577_c1
741 nmdc:mga04h51_92184_c1
742 nmdc:mga05p37_133336_c1
743 nmdc:mga05p37_363433_c1
744 nmdc:mga05p37_42809_c1
745 nmdc:mga05p37_53391_c1
746 nmdc:mga09592_116854_c1
747 nmdc:mga09592_131806_c1
748 nmdc:mga09592_24776_c1
749 nmdc:mga09592_552997_c1
750 nmdc:mga09592_9696_c1
751 nmdc:mga0qj67_56082_c1
752 nmdc:mga06r32_1339991_c1
753 nmdc:mga06r32_18955_c1
754 nmdc:mga06r32_420136_c1
755 nmdc:mga08y16_135270_c1
756 nmdc:mga08y16_161208_c1
757 nmdc:mga08y16_55188_c1
758 nmdc:mga08y16_88700_c1
759 nmdc:mga0n895_1785_c1
760 nmdc:mga0n895_679368_c1
761 nmdc:mga0n895_871115_c1
762 nmdc:mga0rr50_1704_c1
763 nmdc:mga0a205_259901_c1
764 nmdc:mga0a205_9342_c1
765 Ga0495601_0178812
766 Ga0495595_0132056
767 Ga0495619_0038697
768 Ga0500555_000241
769 Ga0500568_0005200
770 Ga0500616_0000358
771 Ga0500645_002590
772 Ga0501084_0091900
773 Ga0501084_0875804
774 Ga0530510_0147116

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00885

DMRL_synthase

6,7-dimethyl-8-ribityllumazine synthase

17

148

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a4f-assembly1.cif.gz_AI aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-1 (120-mer) 0.9915 11 81
7a4f-assembly1.cif.gz_AC aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-1 (120-mer) 0.9865 11 81
7a4h-assembly1.cif.gz_BB aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-2 (180-mer) 0.9827 11 79
7a4h-assembly1.cif.gz_BK aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-2 (180-mer) 0.9819 11 79
7a4h-assembly1.cif.gz_BL aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-2 (180-mer) 0.9795 11 77
ID Description Score Start End Superfamily
af_B4FBV7_62_217_3.40.50.960 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9596 11 149 3.40.50.960
1nqwC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9564 11 151 3.40.50.960
3mk3100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9473 7 150 3.40.50.960
2vi5I00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9341 11 151 3.40.50.960
af_Q57751_4_141_3.40.50.960 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.932 11 153 3.40.50.960
ID Description Score Start End GO Terms
AF-A0A2H5ZKH0-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9825 11 151 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A524IKU4-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.979 11 152 GO:0000906
GO:0009231
GO:0009349
AF-A0A2W4RJZ2-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9782 11 153 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A1F7UTE0-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9764 11 147 GO:0000906
GO:0009231
GO:0009349
AF-A0A7R7Y6J6-F1-model_v4 deleted 0.9757 11 157

Map