F430937

General Info

Members Datasets Scaffolds Average Seq Length
387 214 774 194

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0197293|Ga0496105_0197293_706_1287
Length 193
Sequence MTGFTRHRRSGLIIANFTGFEADLLRSLAGQLVELLRNESAAPVEKDPLEALLDFSGPTTEPDDPVLARLFPTAYRDDEEAAGDFRRFTEGALRDGKAAAATAIIDALEDAGLPPELAEDGLMIDVELDEPTASTWMRSFTDIRLALATRLEVEEGDEAYWASLPDDDPRGQAHDIYDWVGYLQETLVDALSD

Samples

Sample ID Description Type Environment
1 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
117 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
118 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
119 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
120 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
121 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
124 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
125 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
126 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
127 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
187 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
188 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
189 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
198 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
199 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
200 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
204 2643221576 Nocardioides sp. Root614 Isolate Unclassified
205 2643221590 Nocardioides sp. Root682 Isolate Unclassified
206 2643221615 Nocardioides sp. Root224 Isolate Unclassified
207 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
208 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
209 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
210 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
211 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
212 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
213 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
214 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 96.38
Metatranscriptomes 0.78
Isolates 2.84

Biome Distribution

Category Percentage (%)
Aerial Root 0.52
Bulb 0
Endosphere 12.14
Nodule 0
Rhizoplane 13.18
Rhizosphere 70.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496105_0197293 3300048908 Bacteria 1644
2 JGI24740J21852_10020524 3300001979 Bacteria 2302
3 Ga0006562J51391_1022588 3300003578 Bacteria 3160
4 Ga0070683_100002484 3300005329 Bacteria 14674
5 Ga0070683_100034230 3300005329 Bacteria 4639
6 Ga0070683_100071787 3300005329 Bacteria 3231
7 Ga0070683_100135632 3300005329 Bacteria 2330
8 Ga0070682_100005518 3300005337 Bacteria 7041
9 Ga0068868_100085731 3300005338 Bacteria 2531
10 Ga0068868_100416988 3300005338 Bacteria 1162
11 Ga0070660_100012028 3300005339 Bacteria 6176
12 Ga0070689_100333709 3300005340 Bacteria 1269
13 Ga0070692_10079272 3300005345 Bacteria 1765
14 Ga0070668_100122498 3300005347 Bacteria 2080
15 Ga0070673_101323054 3300005364 Bacteria 677
16 Ga0070659_100023607 3300005366 Bacteria 4709
17 Ga0070701_10541698 3300005438 Bacteria 762
18 Ga0070663_100271250 3300005455 Bacteria 1349
19 Ga0070678_100114169 3300005456 Bacteria 2118
20 Ga0070681_10063993 3300005458 Bacteria 3650
21 Ga0068867_101260453 3300005459 Bacteria 681
22 Ga0070679_100002885 3300005530 Bacteria 15616
23 Ga0070679_100738914 3300005530 Bacteria 927
24 Ga0070684_100006183 3300005535 Bacteria 9237
25 Ga0070684_100204288 3300005535 Bacteria 1800
26 Ga0070684_100359017 3300005535 Bacteria 1341
27 Ga0070684_100725675 3300005535 Bacteria 927
28 Ga0070665_100371502 3300005548 Bacteria 1437
29 Ga0068855_100164723 3300005563 Bacteria 2514
30 Ga0068857_100835371 3300005577 Bacteria 881
31 Ga0070702_100077070 3300005615 Bacteria 1986
32 Ga0070702_100380877 3300005615 Bacteria 1003
33 Ga0068852_100074861 3300005616 Bacteria 2984
34 Ga0068859_100682986 3300005617 Bacteria 1118
35 Ga0068864_100093226 3300005618 Bacteria 2660
36 Ga0068851_10160348 3300005834 Bacteria 1235
37 Ga0068870_10340801 3300005840 Bacteria 959
38 Ga0068863_101117333 3300005841 Bacteria 793
39 Ga0068858_100085809 3300005842 Bacteria 2929
40 Ga0068860_100246993 3300005843 Bacteria 1737
41 Ga0081539_10045239 3300005985 Bacteria 2534
42 Ga0075365_10008341 3300006038 Bacteria 5874
43 Ga0075365_10030414 3300006038 Bacteria 3458
44 Ga0075365_10049406 3300006038 Bacteria 2771
45 Ga0075365_10074759 3300006038 Bacteria 2285
46 Ga0075365_10295573 3300006038 Bacteria 1139
47 Ga0075365_10410909 3300006038 Bacteria 955
48 Ga0075365_10444648 3300006038 Bacteria 915
49 Ga0075365_10512896 3300006038 Bacteria 848
50 Ga0075363_100000769 3300006048 Bacteria 11011
51 Ga0075363_100007205 3300006048 Bacteria 5098
52 Ga0075363_100032411 3300006048 Bacteria 2714
53 Ga0075364_10002837 3300006051 Bacteria 9761
54 Ga0075364_10126083 3300006051 Bacteria 1716
55 Ga0075364_10132043 3300006051 Bacteria 1676
56 Ga0075364_10153653 3300006051 Bacteria 1551
57 Ga0075367_10000401 3300006178 Bacteria 15899
58 Ga0075367_10071054 3300006178 Bacteria 2093
59 Ga0075367_10098800 3300006178 Bacteria 1782
60 Ga0075370_10011673 3300006353 Bacteria 4623
61 Ga0075370_10096719 3300006353 Bacteria 1706
62 Ga0068871_100994057 3300006358 Bacteria 781
63 Ga0075428_101086603 3300006844 Bacteria 845
64 Ga0068865_100124972 3300006881 Bacteria 1919
65 Ga0068865_100206526 3300006881 Bacteria 1528
66 Ga0068865_100378354 3300006881 Bacteria 1154
67 Ga0068865_100416806 3300006881 Bacteria 1103
68 Ga0068865_100551296 3300006881 Bacteria 968
69 Ga0097620_100682970 3300006931 Bacteria 1118
70 Ga0105245_10009576 3300009098 Bacteria 8451
71 Ga0105245_10250481 3300009098 Bacteria 1720
72 Ga0105243_10263445 3300009148 Bacteria 1544
73 Ga0105242_10052924 3300009176 Bacteria 3314
74 Ga0105242_10241460 3300009176 Bacteria 1624
75 Ga0105248_10766324 3300009177 Bacteria 1089
76 Ga0105237_10048712 3300009545 Bacteria 4259
77 Ga0105238_10089008 3300009551 Bacteria 3074
78 Ga0105238_10515809 3300009551 Bacteria 1197
79 Ga0105249_10034823 3300009553 Bacteria 4564
80 Ga0105249_10130692 3300009553 Bacteria 2397
81 Ga0105239_10003376 3300010375 Bacteria 19591
82 Ga0105246_10002553 3300011119 Bacteria 11006
83 Ga0105246_10338349 3300011119 Bacteria 1229
84 Ga0105246_10672376 3300011119 Bacteria 904
85 Ga0157371_10501709 3300013102 Bacteria 896
86 Ga0157369_10844621 3300013105 Bacteria 940
87 Ga0163162_10004012 3300013306 Bacteria 14126
88 Ga0157372_10003758 3300013307 Bacteria 16307
89 Ga0157372_10613923 3300013307 Bacteria 1267
90 Ga0157372_11142858 3300013307 Bacteria 900
91 Ga0157375_10069480 3300013308 Bacteria 3529
92 Ga0157375_10073250 3300013308 Bacteria 3444
93 Ga0157375_11209896 3300013308 Bacteria 886
94 Ga0157375_11250489 3300013308 Bacteria 872
95 Ga0163163_10033431 3300014325 Bacteria 4974
96 Ga0157380_11025739 3300014326 Bacteria 860
97 Ga0182008_10212698 3300014497 Bacteria 987
98 Ga0157379_10814487 3300014968 Bacteria 882
99 Ga0157376_10274817 3300014969 Bacteria 1584
100 Ga0163161_10393920 3300017792 Bacteria 1109
101 Ga0163161_10590830 3300017792 Bacteria 914
102 Ga0206353_10931239 3300020082 Bacteria 2501
103 Ga0206353_11071417 3300020082 Bacteria 905
104 Ga0213876_10097944 3300021384 Bacteria 1554
105 Ga0207647_10044575 3300025904 Bacteria 2770
106 Ga0207647_10109258 3300025904 Bacteria 1636
107 Ga0207643_10571411 3300025908 Bacteria 726
108 Ga0207705_10016424 3300025909 Bacteria 5307
109 Ga0207707_10199681 3300025912 Bacteria 1744
110 Ga0207660_10215883 3300025917 Bacteria 1504
111 Ga0207657_10021083 3300025919 Bacteria 6141
112 Ga0207652_10158451 3300025921 Bacteria 2028
113 Ga0207652_10371941 3300025921 Bacteria 1290
114 Ga0207650_10287957 3300025925 Bacteria 1339
115 Ga0207687_10032526 3300025927 Bacteria 3532
116 Ga0207687_10038727 3300025927 Bacteria 3260
117 Ga0207687_10723623 3300025927 Bacteria 846
118 Ga0207690_10015272 3300025932 Bacteria 4650
119 Ga0207686_10140123 3300025934 Bacteria 1670
120 Ga0207709_10029541 3300025935 Bacteria 3181
121 Ga0207670_10253041 3300025936 Bacteria 1362
122 Ga0207704_10049391 3300025938 Bacteria 2531
123 Ga0207704_10077896 3300025938 Bacteria 2130
124 Ga0207704_10152158 3300025938 Bacteria 1634
125 Ga0207711_10249061 3300025941 Bacteria 1631
126 Ga0207689_10213334 3300025942 Bacteria 1595
127 Ga0207661_10006769 3300025944 Bacteria 8116
128 Ga0207661_10074193 3300025944 Bacteria 2788
129 Ga0207661_10172564 3300025944 Bacteria 1883
130 Ga0207661_10185353 3300025944 Bacteria 1821
131 Ga0207661_10691711 3300025944 Bacteria 938
132 Ga0207679_10223025 3300025945 Bacteria 1587
133 Ga0207667_10242865 3300025949 Bacteria 1843
134 Ga0207712_10086249 3300025961 Bacteria 2299
135 Ga0207712_10232589 3300025961 Bacteria 1480
136 Ga0207668_10151823 3300025972 Bacteria 1794
137 Ga0207677_10032930 3300026023 Bacteria 3337
138 Ga0207677_10114154 3300026023 Bacteria 2018
139 Ga0207703_10224909 3300026035 Bacteria 1680
140 Ga0207639_10141342 3300026041 Bacteria 2006
141 Ga0207678_10148581 3300026067 Bacteria 2000
142 Ga0207708_10096418 3300026075 Bacteria 2285
143 Ga0207708_10538701 3300026075 Bacteria 983
144 Ga0207702_10650375 3300026078 Bacteria 1037
145 Ga0207648_11086954 3300026089 Bacteria 750
146 Ga0207676_10107920 3300026095 Bacteria 2323
147 Ga0207674_10012818 3300026116 Bacteria 9356
148 Ga0207674_10628046 3300026116 Bacteria 1037
149 Ga0207674_10846473 3300026116 Bacteria 882
150 Ga0207683_10021147 3300026121 Bacteria 5568
151 Ga0207683_10288786 3300026121 Bacteria 1500
152 Ga0207683_10719513 3300026121 Bacteria 926
153 Ga0207683_10788207 3300026121 Bacteria 882
154 Ga0207698_10144741 3300026142 Bacteria 2053
155 Ga0209813_10003048 3300027866 Bacteria 3893
156 Ga0268266_10695374 3300028379 Bacteria 980
157 Ga0268264_10208860 3300028381 Bacteria 1791
158 Ga0268264_11084232 3300028381 Bacteria 809
159 Ga0265327_10164351 3300031251 Bacteria 1023
160 Ga0307405_10293258 3300031731 Bacteria 1230
161 Ga0307413_10779905 3300031824 Bacteria 801
162 Ga0307413_10948403 3300031824 Bacteria 734
163 Ga0307410_10040476 3300031852 Bacteria 3067
164 Ga0307410_10245675 3300031852 Bacteria 1389
165 Ga0307406_10047891 3300031901 Bacteria 2697
166 Ga0307407_10082808 3300031903 Bacteria 1945
167 Ga0307412_10033273 3300031911 Bacteria 3275
168 Ga0307412_10144190 3300031911 Bacteria 1748
169 Ga0307409_100007272 3300031995 Bacteria 6607
170 Ga0307409_100040785 3300031995 Bacteria 3460
171 Ga0307409_100082390 3300031995 Bacteria 2604
172 Ga0307409_100387954 3300031995 Bacteria 1330
173 Ga0307409_100659068 3300031995 Bacteria 1041
174 Ga0307416_100000326 3300032002 Bacteria 24620
175 Ga0307416_100017966 3300032002 Bacteria 4967
176 Ga0307416_100114022 3300032002 Bacteria 2390
177 Ga0307416_100322619 3300032002 Bacteria 1547
178 Ga0307416_100911454 3300032002 Bacteria 979
179 Ga0307416_101362686 3300032002 Bacteria 815
180 Ga0307414_10170660 3300032004 Bacteria 1739
181 Ga0307411_10072794 3300032005 Bacteria 2335
182 Ga0307411_10088295 3300032005 Bacteria 2156
183 Ga0307411_10260109 3300032005 Bacteria 1370
184 Ga0307415_100000660 3300032126 Bacteria 15214
185 Ga0307415_100094877 3300032126 Bacteria 2170
186 Ga0395900_0115028 3300037418 Bacteria 2761
187 Ga0395900_0630347 3300037418 Bacteria 1010
188 Ga0395898_0170577 3300037466 Bacteria 2080
189 Ga0395898_0306899 3300037466 Bacteria 1514
190 Ga0395905_0223722 3300037471 Bacteria 1761
191 Ga0395901_0058509 3300038443 Bacteria 4008
192 Ga0395901_0079250 3300038443 Bacteria 3430
193 Ga0436365_1291148 3300039437 Bacteria 1744
194 Ga0439438_034744 3300041405 Bacteria 1327
195 Ga0439461_0015637 3300041410 Bacteria 1456
196 Ga0439465_0023863 3300041413 Bacteria 1926
197 Ga0451793_0961876 3300041452 Bacteria 963
198 Ga0451837_0697132 3300041494 Bacteria 1002
199 Ga0451851_1290731 3300041507 Bacteria 768
200 Ga0451853_0745752 3300041512 Bacteria 1122
201 Ga0439431_0002237 3300041997 Bacteria 4268
202 Ga0450906_027930 3300042145 Bacteria 1000
203 Ga0450907_009731 3300042146 Bacteria 1595
204 Ga0439434_0003237 3300042435 Bacteria 4781
205 Ga0466965_0016698 3300044683 Bacteria 3498
206 Ga0466965_0040219 3300044683 Bacteria 2301
207 Ga0466966_0043650 3300044684 Bacteria 2873
208 Ga0466966_0125495 3300044684 Bacteria 1574
209 Ga0466961_0106626 3300044693 Bacteria 1764
210 Ga0466963_0474956 3300044694 Bacteria 882
211 Ga0466964_0018084 3300044706 Bacteria 2702
212 Ga0466964_0062760 3300044706 Bacteria 1550
213 Ga0466964_0097809 3300044706 Bacteria 1288
214 Ga0466970_0010529 3300044765 Bacteria 4697
215 Ga0466970_0023807 3300044765 Bacteria 3201
216 Ga0466970_0119306 3300044765 Bacteria 1444
217 Ga0466970_0161223 3300044765 Bacteria 1240
218 Ga0466957_0004995 3300044842 Bacteria 7421
219 Ga0466957_0029122 3300044842 Bacteria 3292
220 Ga0466960_0011491 3300044901 Bacteria 3708
221 Ga0466960_0011511 3300044901 Bacteria 3704
222 Ga0466960_0030693 3300044901 Bacteria 2475
223 Ga0466960_0303622 3300044901 Bacteria 900
224 Ga0466960_0632176 3300044901 Bacteria 638
225 Ga0466958_0301598 3300045836 Bacteria 1028
226 Ga0466967_0008279 3300045976 Bacteria 7599
227 Ga0466967_0016591 3300045976 Bacteria 5815
228 Ga0466967_0018913 3300045976 Bacteria 5524
229 Ga0466967_0024704 3300045976 Bacteria 4944
230 Ga0466967_0036682 3300045976 Bacteria 4188
231 Ga0466967_0217067 3300045976 Bacteria 1816
232 Ga0466967_0297111 3300045976 Bacteria 1553
233 Ga0466967_0966737 3300045976 Bacteria 848
234 Ga0466967_1655400 3300045976 Bacteria 637
235 Ga0495603_0063683 3300046455 Bacteria 2175
236 Ga0495653_0253152 3300046463 Bacteria 1168
237 Ga0495630_0205159 3300046517 Bacteria 1505
238 Ga0495657_0064067 3300046675 Bacteria 2423
239 Ga0495647_0171141 3300046681 Bacteria 941
240 Ga0495613_0771940 3300046689 Bacteria 629
241 Ga0495674_0542974 3300047319 Bacteria 926
242 Ga0495676_0636580 3300047321 Bacteria 693
243 Ga0496100_0054555 3300048903 Bacteria 2607
244 Ga0496100_0102854 3300048903 Bacteria 1972
245 Ga0496100_0116948 3300048903 Bacteria 1861
246 Ga0496101_0016151 3300048904 Bacteria 5040
247 Ga0496101_0057933 3300048904 Bacteria 2804
248 Ga0496102_0010713 3300048905 Bacteria 7899
249 Ga0496102_0013615 3300048905 Bacteria 7050
250 Ga0496102_0051846 3300048905 Bacteria 3737
251 Ga0496102_0078612 3300048905 Bacteria 3037
252 Ga0496102_0164313 3300048905 Bacteria 2089
253 Ga0496102_0183676 3300048905 Bacteria 1970
254 Ga0496102_0432086 3300048905 Bacteria 1236
255 Ga0496102_0929998 3300048905 Bacteria 791
256 Ga0496103_0025605 3300048906 Bacteria 3567
257 Ga0496104_0034400 3300048907 Bacteria 4725
258 Ga0496105_0011827 3300048908 Bacteria 6912
259 Ga0496105_0054004 3300048908 Bacteria 3318
260 Ga0496106_0107325 3300048909 Bacteria 2171
261 Ga0496106_0184223 3300048909 Bacteria 1658
262 Ga0496106_0377365 3300048909 Bacteria 1139
263 Ga0496107_0015123 3300048910 Bacteria 5406
264 Ga0496107_0086427 3300048910 Bacteria 2289
265 Ga0496108_0055364 3300048911 Bacteria 3330
266 Ga0496108_0080203 3300048911 Bacteria 2764
267 Ga0496108_0125414 3300048911 Bacteria 2204
268 Ga0496108_0207133 3300048911 Bacteria 1702
269 Ga0496109_0022898 3300048912 Bacteria 5537
270 Ga0496109_0068307 3300048912 Bacteria 3258
271 Ga0496109_0091621 3300048912 Bacteria 2811
272 Ga0496109_0250612 3300048912 Bacteria 1667
273 Ga0496109_0811479 3300048912 Bacteria 874
274 Ga0496110_0002615 3300048913 Bacteria 13555
275 Ga0496110_0250717 3300048913 Bacteria 1611
276 Ga0496111_0000863 3300048914 Bacteria 16436
277 Ga0496111_0105153 3300048914 Bacteria 2077
278 Ga0496112_0376106 3300048915 Bacteria 1362
279 Ga0496112_0649785 3300048915 Bacteria 984
280 Ga0496112_0672460 3300048915 Bacteria 964
281 Ga0496113_0124981 3300048916 Bacteria 2014
282 Ga0496113_0371653 3300048916 Bacteria 1147
283 Ga0496114_0010389 3300048917 Bacteria 7408
284 Ga0496114_0044896 3300048917 Bacteria 3668
285 Ga0496114_0056062 3300048917 Bacteria 3287
286 Ga0496114_0165894 3300048917 Bacteria 1923
287 Ga0496114_0243842 3300048917 Bacteria 1580
288 Ga0496114_0553089 3300048917 Bacteria 1017
289 Ga0496115_0007901 3300048918 Bacteria 7847
290 Ga0496115_0009599 3300048918 Bacteria 7194
291 Ga0496115_0268515 3300048918 Bacteria 1402
292 Ga0501031_0008197 3300049568 Bacteria 6800
293 Ga0501031_0064870 3300049568 Bacteria 2379
294 Ga0501031_0362561 3300049568 Bacteria 938
295 Ga0501032_0068471 3300049569 Bacteria 2369
296 Ga0501033_0004737 3300049570 Bacteria 10884
297 Ga0501033_0138789 3300049570 Bacteria 1758
298 Ga0501034_0670582 3300049571 Bacteria 937
299 Ga0501036_0005938 3300049572 Bacteria 9891
300 Ga0501036_0027654 3300049572 Bacteria 4793
301 Ga0501036_0473617 3300049572 Bacteria 1043
302 Ga0501037_0024336 3300049573 Bacteria 4478
303 Ga0501038_0058935 3300049574 Bacteria 3290
304 Ga0501039_0050956 3300049575 Bacteria 3204
305 Ga0501039_0061682 3300049575 Bacteria 2904
306 Ga0501039_0076781 3300049575 Bacteria 2597
307 Ga0501039_0284948 3300049575 Bacteria 1299
308 Ga0501040_0010997 3300049576 Bacteria 5918
309 Ga0501042_0003027 3300049578 Bacteria 10455
310 Ga0501042_0016005 3300049578 Bacteria 5144
311 Ga0501043_0019572 3300049579 Bacteria 5313
312 Ga0501043_0056458 3300049579 Bacteria 3084
313 Ga0501043_0116717 3300049579 Bacteria 2094
314 Ga0501046_0000837 3300049580 Bacteria 29974
315 Ga0501046_0005031 3300049580 Bacteria 11866
316 Ga0501047_0296943 3300049581 Bacteria 1458
317 Ga0501048_0012985 3300049582 Bacteria 6186
318 Ga0501067_0011262 3300049583 Bacteria 4950
319 Ga0501067_0199201 3300049583 Bacteria 1115
320 Ga0501067_0478907 3300049583 Bacteria 696
321 Ga0501068_0011969 3300049584 Bacteria 4907
322 Ga0501068_0164304 3300049584 Bacteria 1400
323 Ga0501070_0006679 3300049586 Bacteria 9825
324 Ga0501070_0101746 3300049586 Bacteria 2376
325 Ga0501070_0302899 3300049586 Bacteria 1302
326 Ga0501071_0002975 3300049587 Bacteria 10474
327 Ga0501071_0200370 3300049587 Bacteria 1499
328 Ga0501072_0260095 3300049588 Bacteria 1381
329 Ga0501072_0453982 3300049588 Bacteria 1015
330 Ga0501073_0078002 3300049589 Bacteria 2305
331 Ga0501076_0011109 3300049592 Bacteria 6699
332 Ga0501076_1075026 3300049592 Bacteria 663
333 Ga0501080_0068743 3300049742 Bacteria 3295
334 Ga0501080_0136169 3300049742 Bacteria 2273
335 Ga0501283_011360 3300049779 Bacteria 1324
336 Ga0501035_0040454 3300049822 Bacteria 4212
337 Ga0501035_0076150 3300049822 Bacteria 2967
338 Ga0501035_0643100 3300049822 Bacteria 861
339 Ga0501044_0071808 3300049823 Bacteria 3519
340 Ga0501045_0167020 3300049824 Bacteria 1639
341 Ga0501045_0277251 3300049824 Bacteria 1248
342 nmdc:mga03683_168774_c1 3300050489 Bacteria 993
343 nmdc:mga03n38_12049_c1 3300050490 Bacteria 3242
344 nmdc:mga03n38_2054_c1 3300050490 Bacteria 6076
345 nmdc:mga03n38_26187_c1 3300050490 Bacteria 2406
346 nmdc:mga00v17_11382_c1 3300050491 Bacteria 4890
347 nmdc:mga00v17_122443_c1 3300050491 Bacteria 1657
348 nmdc:mga00v17_55161_c1 3300050491 Bacteria 2426
349 nmdc:mga00v17_7300_c1 3300050491 Bacteria 5890
350 nmdc:mga0yw44_10251_c1 3300050492 Bacteria 4779
351 nmdc:mga0yw44_12139_c1 3300050492 Bacteria 4478
352 nmdc:mga0yw44_185413_c1 3300050492 Bacteria 1371
353 nmdc:mga0yw44_26140_c1 3300050492 Bacteria 3330
354 nmdc:mga0yw44_282369_c1 3300050492 Bacteria 1110
355 nmdc:mga0yw44_352707_c1 3300050492 Bacteria 991
356 nmdc:mga0yw44_431918_c1 3300050492 Bacteria 892
357 nmdc:mga0yw44_474948_c1 3300050492 Bacteria 848
358 nmdc:mga0yw44_499431_c1 3300050492 Bacteria 825
359 nmdc:mga0yw44_6515_c1 3300050492 Bacteria 5651
360 nmdc:mga0yw44_83384_c1 3300050492 Bacteria 2008
361 nmdc:mga06z11_2730_c1 3300050494 Bacteria 6767
362 nmdc:mga06z11_282444_c1 3300050494 Bacteria 984
363 nmdc:mga07m45_2428_c1 3300050496 Bacteria 8741
364 nmdc:mga08y16_1062774_c1 3300050511 Bacteria 786
365 nmdc:mga0rr50_702353_c1 3300050513 Bacteria 863
366 Ga0495601_0385877 3300053077 Bacteria 909
367 Ga0495595_0209914 3300053084 Bacteria 970
368 Ga0495619_0045613 3300053085 Bacteria 2880
369 Ga0500556_0000726 3300053104 Bacteria 19847
370 Ga0500593_000179 3300053117 Bacteria 25713
371 Ga0500568_0129159 3300053139 Bacteria 940
372 Ga0500573_0008490 3300053140 Bacteria 5660
373 Ga0501084_0519446 3300054114 Bacteria 1007
374 Ga0466962_0033113 3300061719 Bacteria 2472
375 Ga0530510_0425141 3300061734 Bacteria 1003
376 Ga0530510_0637559 3300061734 Bacteria 811
377 2643889906 2643221576 Bacteria 5214352
378 2643958962 2643221590 Bacteria 5214697
379 2644091757 2643221615 Bacteria 5487866
380 2644321560 2643221657 Bacteria 5490246
381 2774393846 2773857762 Bacteria 5971770
382 2809195281 2808606439 Bacteria 5952208
383 2812350158 2811994878 Bacteria 5992952
384 2855388915 2855386786 Bacteria 4752232
385 2891972221 2891968417 Bacteria 5821697
386 2984577240 2984576629 Bacteria 4248407
387 2990260651 2990256926 Bacteria 4252839
388 Ga0496105_0197293
389 JGI24740J21852_10020524
390 Ga0006562J51391_1022588
391 Ga0070683_100002484
392 Ga0070683_100034230
393 Ga0070683_100071787
394 Ga0070683_100135632
395 Ga0070682_100005518
396 Ga0068868_100085731
397 Ga0068868_100416988
398 Ga0070660_100012028
399 Ga0070689_100333709
400 Ga0070692_10079272
401 Ga0070668_100122498
402 Ga0070673_101323054
403 Ga0070659_100023607
404 Ga0070701_10541698
405 Ga0070663_100271250
406 Ga0070678_100114169
407 Ga0070681_10063993
408 Ga0068867_101260453
409 Ga0070679_100002885
410 Ga0070679_100738914
411 Ga0070684_100006183
412 Ga0070684_100204288
413 Ga0070684_100359017
414 Ga0070684_100725675
415 Ga0070665_100371502
416 Ga0068855_100164723
417 Ga0068857_100835371
418 Ga0070702_100077070
419 Ga0070702_100380877
420 Ga0068852_100074861
421 Ga0068859_100682986
422 Ga0068864_100093226
423 Ga0068851_10160348
424 Ga0068870_10340801
425 Ga0068863_101117333
426 Ga0068858_100085809
427 Ga0068860_100246993
428 Ga0081539_10045239
429 Ga0075365_10008341
430 Ga0075365_10030414
431 Ga0075365_10049406
432 Ga0075365_10074759
433 Ga0075365_10295573
434 Ga0075365_10410909
435 Ga0075365_10444648
436 Ga0075365_10512896
437 Ga0075363_100000769
438 Ga0075363_100007205
439 Ga0075363_100032411
440 Ga0075364_10002837
441 Ga0075364_10126083
442 Ga0075364_10132043
443 Ga0075364_10153653
444 Ga0075367_10000401
445 Ga0075367_10071054
446 Ga0075367_10098800
447 Ga0075370_10011673
448 Ga0075370_10096719
449 Ga0068871_100994057
450 Ga0075428_101086603
451 Ga0068865_100124972
452 Ga0068865_100206526
453 Ga0068865_100378354
454 Ga0068865_100416806
455 Ga0068865_100551296
456 Ga0097620_100682970
457 Ga0105245_10009576
458 Ga0105245_10250481
459 Ga0105243_10263445
460 Ga0105242_10052924
461 Ga0105242_10241460
462 Ga0105248_10766324
463 Ga0105237_10048712
464 Ga0105238_10089008
465 Ga0105238_10515809
466 Ga0105249_10034823
467 Ga0105249_10130692
468 Ga0105239_10003376
469 Ga0105246_10002553
470 Ga0105246_10338349
471 Ga0105246_10672376
472 Ga0157371_10501709
473 Ga0157369_10844621
474 Ga0163162_10004012
475 Ga0157372_10003758
476 Ga0157372_10613923
477 Ga0157372_11142858
478 Ga0157375_10069480
479 Ga0157375_10073250
480 Ga0157375_11209896
481 Ga0157375_11250489
482 Ga0163163_10033431
483 Ga0157380_11025739
484 Ga0182008_10212698
485 Ga0157379_10814487
486 Ga0157376_10274817
487 Ga0163161_10393920
488 Ga0163161_10590830
489 Ga0206353_10931239
490 Ga0206353_11071417
491 Ga0213876_10097944
492 Ga0207647_10044575
493 Ga0207647_10109258
494 Ga0207643_10571411
495 Ga0207705_10016424
496 Ga0207707_10199681
497 Ga0207660_10215883
498 Ga0207657_10021083
499 Ga0207652_10158451
500 Ga0207652_10371941
501 Ga0207650_10287957
502 Ga0207687_10032526
503 Ga0207687_10038727
504 Ga0207687_10723623
505 Ga0207690_10015272
506 Ga0207686_10140123
507 Ga0207709_10029541
508 Ga0207670_10253041
509 Ga0207704_10049391
510 Ga0207704_10077896
511 Ga0207704_10152158
512 Ga0207711_10249061
513 Ga0207689_10213334
514 Ga0207661_10006769
515 Ga0207661_10074193
516 Ga0207661_10172564
517 Ga0207661_10185353
518 Ga0207661_10691711
519 Ga0207679_10223025
520 Ga0207667_10242865
521 Ga0207712_10086249
522 Ga0207712_10232589
523 Ga0207668_10151823
524 Ga0207677_10032930
525 Ga0207677_10114154
526 Ga0207703_10224909
527 Ga0207639_10141342
528 Ga0207678_10148581
529 Ga0207708_10096418
530 Ga0207708_10538701
531 Ga0207702_10650375
532 Ga0207648_11086954
533 Ga0207676_10107920
534 Ga0207674_10012818
535 Ga0207674_10628046
536 Ga0207674_10846473
537 Ga0207683_10021147
538 Ga0207683_10288786
539 Ga0207683_10719513
540 Ga0207683_10788207
541 Ga0207698_10144741
542 Ga0209813_10003048
543 Ga0268266_10695374
544 Ga0268264_10208860
545 Ga0268264_11084232
546 Ga0265327_10164351
547 Ga0307405_10293258
548 Ga0307413_10779905
549 Ga0307413_10948403
550 Ga0307410_10040476
551 Ga0307410_10245675
552 Ga0307406_10047891
553 Ga0307407_10082808
554 Ga0307412_10033273
555 Ga0307412_10144190
556 Ga0307409_100007272
557 Ga0307409_100040785
558 Ga0307409_100082390
559 Ga0307409_100387954
560 Ga0307409_100659068
561 Ga0307416_100000326
562 Ga0307416_100017966
563 Ga0307416_100114022
564 Ga0307416_100322619
565 Ga0307416_100911454
566 Ga0307416_101362686
567 Ga0307414_10170660
568 Ga0307411_10072794
569 Ga0307411_10088295
570 Ga0307411_10260109
571 Ga0307415_100000660
572 Ga0307415_100094877
573 Ga0395900_0115028
574 Ga0395900_0630347
575 Ga0395898_0170577
576 Ga0395898_0306899
577 Ga0395905_0223722
578 Ga0395901_0058509
579 Ga0395901_0079250
580 Ga0436365_1291148
581 Ga0439438_034744
582 Ga0439461_0015637
583 Ga0439465_0023863
584 Ga0451793_0961876
585 Ga0451837_0697132
586 Ga0451851_1290731
587 Ga0451853_0745752
588 Ga0439431_0002237
589 Ga0450906_027930
590 Ga0450907_009731
591 Ga0439434_0003237
592 Ga0466965_0016698
593 Ga0466965_0040219
594 Ga0466966_0043650
595 Ga0466966_0125495
596 Ga0466961_0106626
597 Ga0466963_0474956
598 Ga0466964_0018084
599 Ga0466964_0062760
600 Ga0466964_0097809
601 Ga0466970_0010529
602 Ga0466970_0023807
603 Ga0466970_0119306
604 Ga0466970_0161223
605 Ga0466957_0004995
606 Ga0466957_0029122
607 Ga0466960_0011491
608 Ga0466960_0011511
609 Ga0466960_0030693
610 Ga0466960_0303622
611 Ga0466960_0632176
612 Ga0466958_0301598
613 Ga0466967_0008279
614 Ga0466967_0016591
615 Ga0466967_0018913
616 Ga0466967_0024704
617 Ga0466967_0036682
618 Ga0466967_0217067
619 Ga0466967_0297111
620 Ga0466967_0966737
621 Ga0466967_1655400
622 Ga0495603_0063683
623 Ga0495653_0253152
624 Ga0495630_0205159
625 Ga0495657_0064067
626 Ga0495647_0171141
627 Ga0495613_0771940
628 Ga0495674_0542974
629 Ga0495676_0636580
630 Ga0496100_0054555
631 Ga0496100_0102854
632 Ga0496100_0116948
633 Ga0496101_0016151
634 Ga0496101_0057933
635 Ga0496102_0010713
636 Ga0496102_0013615
637 Ga0496102_0051846
638 Ga0496102_0078612
639 Ga0496102_0164313
640 Ga0496102_0183676
641 Ga0496102_0432086
642 Ga0496102_0929998
643 Ga0496103_0025605
644 Ga0496104_0034400
645 Ga0496105_0011827
646 Ga0496105_0054004
647 Ga0496106_0107325
648 Ga0496106_0184223
649 Ga0496106_0377365
650 Ga0496107_0015123
651 Ga0496107_0086427
652 Ga0496108_0055364
653 Ga0496108_0080203
654 Ga0496108_0125414
655 Ga0496108_0207133
656 Ga0496109_0022898
657 Ga0496109_0068307
658 Ga0496109_0091621
659 Ga0496109_0250612
660 Ga0496109_0811479
661 Ga0496110_0002615
662 Ga0496110_0250717
663 Ga0496111_0000863
664 Ga0496111_0105153
665 Ga0496112_0376106
666 Ga0496112_0649785
667 Ga0496112_0672460
668 Ga0496113_0124981
669 Ga0496113_0371653
670 Ga0496114_0010389
671 Ga0496114_0044896
672 Ga0496114_0056062
673 Ga0496114_0165894
674 Ga0496114_0243842
675 Ga0496114_0553089
676 Ga0496115_0007901
677 Ga0496115_0009599
678 Ga0496115_0268515
679 Ga0501031_0008197
680 Ga0501031_0064870
681 Ga0501031_0362561
682 Ga0501032_0068471
683 Ga0501033_0004737
684 Ga0501033_0138789
685 Ga0501034_0670582
686 Ga0501036_0005938
687 Ga0501036_0027654
688 Ga0501036_0473617
689 Ga0501037_0024336
690 Ga0501038_0058935
691 Ga0501039_0050956
692 Ga0501039_0061682
693 Ga0501039_0076781
694 Ga0501039_0284948
695 Ga0501040_0010997
696 Ga0501042_0003027
697 Ga0501042_0016005
698 Ga0501043_0019572
699 Ga0501043_0056458
700 Ga0501043_0116717
701 Ga0501046_0000837
702 Ga0501046_0005031
703 Ga0501047_0296943
704 Ga0501048_0012985
705 Ga0501067_0011262
706 Ga0501067_0199201
707 Ga0501067_0478907
708 Ga0501068_0011969
709 Ga0501068_0164304
710 Ga0501070_0006679
711 Ga0501070_0101746
712 Ga0501070_0302899
713 Ga0501071_0002975
714 Ga0501071_0200370
715 Ga0501072_0260095
716 Ga0501072_0453982
717 Ga0501073_0078002
718 Ga0501076_0011109
719 Ga0501076_1075026
720 Ga0501080_0068743
721 Ga0501080_0136169
722 Ga0501283_011360
723 Ga0501035_0040454
724 Ga0501035_0076150
725 Ga0501035_0643100
726 Ga0501044_0071808
727 Ga0501045_0167020
728 Ga0501045_0277251
729 nmdc:mga03683_168774_c1
730 nmdc:mga03n38_12049_c1
731 nmdc:mga03n38_2054_c1
732 nmdc:mga03n38_26187_c1
733 nmdc:mga00v17_11382_c1
734 nmdc:mga00v17_122443_c1
735 nmdc:mga00v17_55161_c1
736 nmdc:mga00v17_7300_c1
737 nmdc:mga0yw44_10251_c1
738 nmdc:mga0yw44_12139_c1
739 nmdc:mga0yw44_185413_c1
740 nmdc:mga0yw44_26140_c1
741 nmdc:mga0yw44_282369_c1
742 nmdc:mga0yw44_352707_c1
743 nmdc:mga0yw44_431918_c1
744 nmdc:mga0yw44_474948_c1
745 nmdc:mga0yw44_499431_c1
746 nmdc:mga0yw44_6515_c1
747 nmdc:mga0yw44_83384_c1
748 nmdc:mga06z11_2730_c1
749 nmdc:mga06z11_282444_c1
750 nmdc:mga07m45_2428_c1
751 nmdc:mga08y16_1062774_c1
752 nmdc:mga0rr50_702353_c1
753 Ga0495601_0385877
754 Ga0495595_0209914
755 Ga0495619_0045613
756 Ga0500556_0000726
757 Ga0500593_000179
758 Ga0500568_0129159
759 Ga0500573_0008490
760 Ga0501084_0519446
761 Ga0466962_0033113
762 Ga0530510_0425141
763 Ga0530510_0637559
764 2643889906
765 2643958962
766 2644091757
767 2644321560
768 2774393846
769 2809195281
770 2812350158
771 2855388915
772 2891972221
773 2984577240
774 2990260651

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09438

DUF2017

Domain of unknown function (DUF2017)

7

192

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8iyj-assembly1.cif.gz_WE cryo-em structure of the 48-nm repeat doublet microtubule from mouse sperm 0.5234 113 193
8iyj-assembly1.cif.gz_UO cryo-em structure of the 48-nm repeat doublet microtubule from mouse sperm 0.5015 113 190
8g3d-assembly1.cif.gz_MK 48-nm doublet microtubule from tetrahymena thermophila strain k40r 0.4626 117 193
8g3d-assembly1.cif.gz_DK 48-nm doublet microtubule from tetrahymena thermophila strain k40r 0.432 113 193
8g2z-assembly1.cif.gz_MG 48-nm doublet microtubule from tetrahymena thermophila strain cu428 0.4249 115 193
ID Description Score Start End Superfamily
af_G5ECH4_2_140_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6077 131 192 1.20.1070.10
af_Q2FXN0_121_275_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.5183 91 192 3.30.420.10
af_K7M4Z9_552_665_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4933 19 150 1.20.140.150
af_K7M4Z9_552_665_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4289 19 150 1.20.140.150
3pfdD03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.412 19 193 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A0Q6FHF1-F1-model_v4 Uncharacterized protein 0.9358 1 193
AF-A0A0Q7QTN9-F1-model_v4 Uncharacterized protein 0.9356 1 192
AF-A0A0Q6FHF1-F1-model_v4 Uncharacterized protein 0.931 1 193
AF-A0A4T0V6T8-F1-model_v4 DUF2017 domain-containing protein 0.9282 1 192
AF-A0A2W6C9K6-F1-model_v4 DUF2017 domain-containing protein 0.9276 4 192

Map