F430874

General Info

Members Datasets Scaffolds Average Seq Length
387 275 774 247

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100083040|Ga0307415_1000830401
Length 293
Sequence MSRLVIVPRLPFHQRPTVSMTEHTIEHQFDSHLLRAMQSRDDTLVRMSRAVLITGASRGIGRATARAFAASGDRVAVHHRDSADLAAEALAELAGSGHVVVRGDAGDPAAVQAFVDEAAHALGGLDVVVNNAAVFPPHPIADVDYAGWQRAWRQTVDVNLLGPANVIFCAVRHMKPGGRIVNVSSRGAFRGEPEQPAYGASKAGLNALGQSMALVLAPLGIAVTAVAPGYVETDMGNAHLKSPRGAAIRAQSPFNRVATPDEVAAAVHWLASPAAEWASGAIVDLNGASYLRT

Samples

Sample ID Description Type Environment
1 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
152 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
153 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
172 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
206 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
231 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
234 2501939600 Micromonospora sp. L5 Isolate Unclassified
235 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
236 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
237 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
238 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
239 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
240 2855683550 Micromonospora sp. RP3T Isolate Unclassified
241 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
242 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
243 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
244 2858868258 Micromonospora sp. MH33 Isolate Unclassified
245 2858882152 Micromonospora noduli MED15 Isolate Nodule
246 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
247 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
248 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
249 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
250 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
251 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
252 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
253 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
254 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
255 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
256 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
257 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
258 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
259 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
260 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
261 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
262 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
263 2902582711 Micromonospora sp. AP08 Isolate Unclassified
264 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
265 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
266 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
267 649633069 Micromonospora sp. L5 Isolate Unclassified
268 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
269 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
270 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
271 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
272 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
273 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
274 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
275 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.11
Metatranscriptomes 1.03
Isolates 10.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 1.29
Rhizoplane 4.65
Rhizosphere 83.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307415_100083040 3300032126 Bacteria 2294
2 JGI24751J29686_10018110 3300002459 Bacteria 1456
3 JGI25406J46586_10043541 3300003203 Bacteria 1562
4 Ga0070658_10080220 3300005327 Bacteria 2680
5 Ga0070676_10034286 3300005328 Bacteria 2915
6 Ga0070676_10303928 3300005328 Bacteria 1082
7 Ga0070683_100003291 3300005329 Bacteria 13062
8 Ga0070683_100264299 3300005329 Bacteria 1637
9 Ga0070670_100304412 3300005331 Bacteria 1395
10 Ga0068869_100012006 3300005334 Bacteria 5703
11 Ga0068869_100013222 3300005334 Bacteria 5484
12 Ga0070680_100013498 3300005336 Bacteria 6363
13 Ga0070680_100069616 3300005336 Bacteria 2889
14 Ga0070682_100009449 3300005337 Bacteria 5517
15 Ga0070682_100045783 3300005337 Bacteria 2713
16 Ga0068868_100038314 3300005338 Bacteria 3721
17 Ga0070660_100152231 3300005339 Bacteria 1860
18 Ga0070660_100182998 3300005339 Bacteria 1696
19 Ga0070689_100036469 3300005340 Bacteria 3761
20 Ga0070691_10009879 3300005341 Bacteria 4347
21 Ga0070687_100136598 3300005343 Bacteria 1422
22 Ga0070661_100042544 3300005344 Bacteria 3316
23 Ga0070661_100085448 3300005344 Bacteria 2331
24 Ga0070692_10019799 3300005345 Bacteria 3253
25 Ga0070692_10073900 3300005345 Bacteria 1822
26 Ga0070675_100006141 3300005354 Bacteria 9209
27 Ga0070671_100005402 3300005355 Bacteria 10189
28 Ga0070671_100195401 3300005355 Bacteria 1715
29 Ga0070673_100079752 3300005364 Bacteria 2651
30 Ga0070659_100056329 3300005366 Bacteria 3100
31 Ga0070709_10005858 3300005434 Bacteria 6665
32 Ga0070709_10078312 3300005434 Bacteria 2150
33 Ga0070709_10106221 3300005434 Bacteria 1879
34 Ga0070709_10217646 3300005434 Bacteria 1360
35 Ga0070714_100011474 3300005435 Bacteria 7028
36 Ga0070714_100012483 3300005435 Bacteria 6784
37 Ga0070714_100120704 3300005435 Bacteria 2331
38 Ga0070713_100038647 3300005436 Bacteria 3868
39 Ga0070713_100046526 3300005436 Bacteria 3560
40 Ga0070713_100218516 3300005436 Bacteria 1728
41 Ga0070710_10002507 3300005437 Bacteria 8706
42 Ga0070710_10050295 3300005437 Bacteria 2336
43 Ga0070711_100004392 3300005439 Bacteria 8313
44 Ga0070711_100009360 3300005439 Bacteria 6032
45 Ga0070711_100205254 3300005439 Bacteria 1523
46 Ga0070700_100063797 3300005441 Bacteria 2331
47 Ga0070700_100101133 3300005441 Bacteria 1899
48 Ga0070708_100114749 3300005445 Bacteria 2479
49 Ga0070708_100168679 3300005445 Bacteria 2042
50 Ga0070663_100010748 3300005455 Bacteria 5716
51 Ga0070678_100005608 3300005456 Bacteria 7283
52 Ga0070662_100081901 3300005457 Bacteria 2405
53 Ga0070681_10043083 3300005458 Bacteria 4522
54 Ga0070706_100059300 3300005467 Bacteria 3532
55 Ga0070706_100064736 3300005467 Bacteria 3380
56 Ga0070707_100202987 3300005468 Bacteria 1932
57 Ga0070698_100109171 3300005471 Bacteria 2734
58 Ga0070679_100151846 3300005530 Bacteria 2292
59 Ga0070684_100036329 3300005535 Bacteria 4221
60 Ga0070684_100046964 3300005535 Bacteria 3742
61 Ga0070697_100054262 3300005536 Bacteria 3258
62 Ga0070696_100163381 3300005546 Bacteria 1642
63 Ga0070665_100102318 3300005548 Bacteria 2868
64 Ga0070664_100000534 3300005564 Bacteria 29002
65 Ga0068857_100006062 3300005577 Bacteria 10327
66 Ga0068857_100023132 3300005577 Bacteria 5467
67 Ga0068854_100031595 3300005578 Bacteria 3680
68 Ga0068854_100125197 3300005578 Bacteria 1956
69 Ga0068856_100021582 3300005614 Bacteria 6258
70 Ga0070702_100031374 3300005615 Bacteria 2907
71 Ga0068852_100106857 3300005616 Bacteria 2538
72 Ga0068852_100156833 3300005616 Bacteria 2121
73 Ga0068859_100019543 3300005617 Bacteria 6806
74 Ga0068859_100339545 3300005617 Bacteria 1596
75 Ga0068859_100793329 3300005617 Bacteria 1035
76 Ga0068864_100022836 3300005618 Bacteria 5247
77 Ga0068864_100175609 3300005618 Bacteria 1955
78 Ga0068851_10043575 3300005834 Bacteria 2262
79 Ga0068870_10000435 3300005840 Bacteria 15823
80 Ga0068863_100010169 3300005841 Bacteria 9151
81 Ga0068858_100007085 3300005842 Bacteria 10884
82 Ga0068862_100021790 3300005844 Bacteria 5358
83 Ga0068862_100182191 3300005844 Bacteria 1886
84 Ga0081539_10002173 3300005985 Bacteria 28814
85 Ga0081539_10033765 3300005985 Bacteria 3108
86 Ga0075364_10087658 3300006051 Bacteria 2063
87 Ga0075432_10028256 3300006058 Bacteria 1935
88 Ga0070716_100000033 3300006173 Bacteria 57092
89 Ga0070716_100386675 3300006173 Bacteria 1002
90 Ga0097621_100148200 3300006237 Bacteria 2011
91 Ga0075428_100171721 3300006844 Bacteria 2350
92 Ga0075430_100249171 3300006846 Bacteria 1472
93 Ga0075433_10064556 3300006852 Bacteria 3210
94 Ga0075434_100056952 3300006871 Bacteria 3884
95 Ga0075436_100010700 3300006914 Bacteria 6293
96 Ga0097620_100019542 3300006931 Bacteria 6806
97 Ga0097620_100339553 3300006931 Bacteria 1596
98 Ga0097620_100793355 3300006931 Bacteria 1035
99 Ga0075435_100001615 3300007076 Bacteria 14583
100 Ga0105251_10071724 3300009011 Bacteria 1611
101 Ga0111539_10013384 3300009094 Bacteria 10255
102 Ga0111539_10175520 3300009094 Bacteria 2503
103 Ga0105245_10030048 3300009098 Bacteria 4804
104 Ga0105247_10010491 3300009101 Bacteria 5601
105 Ga0114129_10085696 3300009147 Bacteria 4371
106 Ga0114129_10230340 3300009147 Bacteria 2495
107 Ga0105243_10249143 3300009148 Bacteria 1585
108 Ga0105248_10006036 3300009177 Bacteria 13302
109 Ga0105248_10092780 3300009177 Bacteria 3400
110 Ga0105237_10049321 3300009545 Bacteria 4232
111 Ga0105239_10271255 3300010375 Bacteria 1908
112 Ga0105246_10082176 3300011119 Bacteria 2299
113 Ga0157373_10349294 3300013100 Bacteria 1055
114 Ga0157371_10005046 3300013102 Bacteria 11290
115 Ga0157370_10059688 3300013104 Bacteria 3624
116 Ga0157369_10006196 3300013105 Bacteria 13878
117 Ga0163162_10322685 3300013306 Bacteria 1677
118 Ga0163162_10677466 3300013306 Bacteria 1154
119 Ga0157372_10089799 3300013307 Bacteria 3491
120 Ga0157375_10098353 3300013308 Bacteria 3003
121 Ga0163163_10007838 3300014325 Bacteria 9442
122 Ga0163163_10054829 3300014325 Bacteria 3939
123 Ga0163163_10291095 3300014325 Bacteria 1685
124 Ga0157380_10179695 3300014326 Bacteria 1858
125 Ga0182008_10059471 3300014497 Bacteria 1886
126 Ga0157377_10009354 3300014745 Bacteria 4805
127 Ga0157377_10009787 3300014745 Bacteria 4721
128 Ga0157379_10010137 3300014968 Bacteria 8215
129 Ga0157379_10144080 3300014968 Bacteria 2148
130 Ga0157376_10039785 3300014969 Bacteria 3837
131 Ga0197907_10783840 3300020069 Bacteria 1367
132 Ga0206356_10467182 3300020070 Bacteria 2435
133 Ga0206354_11412859 3300020081 Bacteria 1385
134 Ga0206353_10118627 3300020082 Bacteria 2730
135 Ga0213874_10020963 3300021377 Bacteria 1797
136 Ga0213875_10001933 3300021388 Bacteria 12825
137 Ga0207692_10031973 3300025898 Bacteria 2524
138 Ga0207688_10079942 3300025901 Bacteria 1865
139 Ga0207688_10185046 3300025901 Bacteria 1243
140 Ga0207680_10386866 3300025903 Bacteria 987
141 Ga0207699_10013196 3300025906 Bacteria 4221
142 Ga0207699_10202451 3300025906 Bacteria 1346
143 Ga0207645_10032470 3300025907 Bacteria 3355
144 Ga0207643_10007044 3300025908 Bacteria 6024
145 Ga0207705_10013920 3300025909 Bacteria 5800
146 Ga0207705_10023993 3300025909 Bacteria 4352
147 Ga0207684_10002014 3300025910 Bacteria 20940
148 Ga0207684_10385963 3300025910 Bacteria 1204
149 Ga0207707_10236155 3300025912 Bacteria 1590
150 Ga0207693_10057533 3300025915 Bacteria 3047
151 Ga0207693_10063331 3300025915 Bacteria 2897
152 Ga0207663_10014117 3300025916 Bacteria 4365
153 Ga0207663_10035712 3300025916 Bacteria 2984
154 Ga0207663_10388198 3300025916 Bacteria 1065
155 Ga0207660_10091031 3300025917 Bacteria 2261
156 Ga0207662_10161859 3300025918 Bacteria 1430
157 Ga0207657_10048128 3300025919 Bacteria 3723
158 Ga0207657_10097495 3300025919 Bacteria 2444
159 Ga0207649_10006275 3300025920 Bacteria 6459
160 Ga0207652_10022633 3300025921 Bacteria 5201
161 Ga0207646_10177498 3300025922 Bacteria 1924
162 Ga0207650_10010956 3300025925 Bacteria 6231
163 Ga0207650_10317443 3300025925 Bacteria 1275
164 Ga0207659_10071141 3300025926 Bacteria 2539
165 Ga0207687_10011190 3300025927 Bacteria 5859
166 Ga0207687_10019556 3300025927 Bacteria 4487
167 Ga0207700_10077585 3300025928 Bacteria 2581
168 Ga0207700_10152296 3300025928 Bacteria 1912
169 Ga0207700_10311730 3300025928 Bacteria 1361
170 Ga0207664_10000276 3300025929 Bacteria 38889
171 Ga0207664_10105482 3300025929 Bacteria 2335
172 Ga0207664_10142502 3300025929 Bacteria 2029
173 Ga0207644_10014974 3300025931 Bacteria 5200
174 Ga0207644_10110077 3300025931 Bacteria 2082
175 Ga0207706_10184808 3300025933 Bacteria 1830
176 Ga0207709_10235316 3300025935 Bacteria 1329
177 Ga0207670_10057053 3300025936 Bacteria 2647
178 Ga0207670_10384487 3300025936 Bacteria 1119
179 Ga0207665_10000079 3300025939 Bacteria 62721
180 Ga0207665_10394131 3300025939 Bacteria 1053
181 Ga0207691_10044052 3300025940 Bacteria 4109
182 Ga0207689_10004347 3300025942 Bacteria 12911
183 Ga0207689_10013228 3300025942 Bacteria 7040
184 Ga0207661_10051400 3300025944 Bacteria 3288
185 Ga0207661_10084335 3300025944 Bacteria 2631
186 Ga0207679_10009267 3300025945 Bacteria 6297
187 Ga0207679_10095284 3300025945 Bacteria 2313
188 Ga0207667_10632883 3300025949 Bacteria 1077
189 Ga0207712_10466281 3300025961 Bacteria 1074
190 Ga0207640_10097914 3300025981 Bacteria 2049
191 Ga0207677_10015314 3300026023 Bacteria 4505
192 Ga0207677_10093580 3300026023 Bacteria 2192
193 Ga0207703_10098980 3300026035 Bacteria 2467
194 Ga0207703_10316564 3300026035 Bacteria 1428
195 Ga0207639_10072817 3300026041 Bacteria 2691
196 Ga0207639_10747181 3300026041 Bacteria 909
197 Ga0207678_10000794 3300026067 Bacteria 28950
198 Ga0207678_10559210 3300026067 Bacteria 1001
199 Ga0207708_10023630 3300026075 Bacteria 4647
200 Ga0207708_10040679 3300026075 Bacteria 3544
201 Ga0207702_10038726 3300026078 Bacteria 3993
202 Ga0207702_10623667 3300026078 Bacteria 1059
203 Ga0207641_10022899 3300026088 Bacteria 5145
204 Ga0207641_10071583 3300026088 Bacteria 2983
205 Ga0207676_10005362 3300026095 Bacteria 9080
206 Ga0207674_10045530 3300026116 Bacteria 4512
207 Ga0207674_10099887 3300026116 Bacteria 2884
208 Ga0207674_10186412 3300026116 Bacteria 2025
209 Ga0207683_10002283 3300026121 Bacteria 16812
210 Ga0207428_10013762 3300027907 Bacteria 7052
211 Ga0207428_10238947 3300027907 Bacteria 1358
212 Ga0268266_10076121 3300028379 Bacteria 2916
213 Ga0268265_10374040 3300028380 Bacteria 1308
214 Ga0268264_10056790 3300028381 Bacteria 3273
215 Ga0307513_10072008 3300031456 Bacteria 3604
216 Ga0307508_10007096 3300031616 Bacteria 10446
217 Ga0316576_10034246 3300031727 Bacteria 3619
218 Ga0307405_10085294 3300031731 Bacteria 2076
219 Ga0307413_10140744 3300031824 Bacteria 1667
220 Ga0307406_10235789 3300031901 Bacteria 1369
221 Ga0307406_10339852 3300031901 Bacteria 1169
222 Ga0307406_10592704 3300031901 Bacteria 913
223 Ga0307407_10326404 3300031903 Bacteria 1079
224 Ga0307416_100239952 3300032002 Bacteria 1755
225 Ga0307416_101020150 3300032002 Bacteria 931
226 Ga0373948_0025863 3300034817 Bacteria 1154
227 Ga0373934_0039803 3300035086 Bacteria 1853
228 Ga0373934_0102939 3300035086 Bacteria 1154
229 Ga0373951_0000210 3300035091 Bacteria 20860
230 Ga0373936_0008531 3300035113 Bacteria 3859
231 Ga0373936_0016835 3300035113 Bacteria 2813
232 Ga0373936_0123190 3300035113 Bacteria 1109
233 Ga0373945_0017686 3300035116 Bacteria 2417
234 Ga0373953_0074631 3300035117 Bacteria 1403
235 Ga0373957_0017518 3300035120 Bacteria 2496
236 Ga0373957_0159656 3300035120 Bacteria 928
237 Ga0373943_0184259 3300035170 Bacteria 1149
238 Ga0373946_0122547 3300035171 Bacteria 1188
239 Ga0373946_0319202 3300035171 Bacteria 771
240 Ga0373955_0010343 3300035172 Bacteria 4401
241 Ga0373962_0003480 3300035242 Bacteria 3783
242 Ga0373933_0003895 3300035724 Bacteria 8232
243 Ga0373937_0101934 3300036401 Bacteria 2664
244 Ga0373937_0180057 3300036401 Bacteria 1984
245 Ga0373925_0012870 3300037068 Bacteria 6060
246 Ga0373925_0199138 3300037068 Bacteria 1592
247 Ga0395899_0036602 3300037312 Bacteria 3681
248 Ga0395898_0028053 3300037466 Bacteria 5645
249 Ga0395905_0098343 3300037471 Bacteria 2748
250 Ga0436364_0635330 3300037853 Bacteria 60935
251 Ga0436364_1123072 3300037853 Bacteria 2123
252 Ga0436361_0664023 3300039447 Bacteria 910
253 Ga0436363_0579932 3300039450 Bacteria 2083
254 Ga0436363_1182548 3300039450 Bacteria 2901
255 Ga0439448_0102843 3300042005 Bacteria 972
256 Ga0439459_0002828 3300042438 Bacteria 2709
257 Ga0466957_0043113 3300044842 Bacteria 2731
258 Ga0466967_0137726 3300045976 Bacteria 2271
259 Ga0495651_0005482 3300046462 Bacteria 9678
260 Ga0495653_0007879 3300046463 Bacteria 8719
261 Ga0495662_0026335 3300046476 Bacteria 2808
262 Ga0495662_0213686 3300046476 Bacteria 951
263 Ga0495664_0020764 3300046477 Bacteria 3791
264 Ga0495606_0000643 3300046507 Bacteria 54831
265 Ga0495606_0003702 3300046507 Bacteria 15981
266 Ga0495608_0008274 3300046511 Bacteria 7301
267 Ga0495618_0091957 3300046514 Bacteria 1940
268 Ga0495618_0194724 3300046514 Bacteria 1284
269 Ga0495628_0213445 3300046516 Bacteria 1451
270 Ga0495628_0243351 3300046516 Bacteria 1345
271 Ga0495652_0055779 3300046529 Bacteria 3359
272 Ga0495652_0345386 3300046529 Bacteria 1068
273 Ga0495640_0022941 3300046533 Bacteria 4558
274 Ga0495640_0296740 3300046533 Bacteria 1004
275 Ga0495645_0023815 3300046543 Bacteria 4437
276 Ga0495645_0098367 3300046543 Bacteria 2082
277 Ga0495667_0027510 3300046559 Bacteria 3831
278 Ga0495667_0103482 3300046559 Bacteria 1841
279 Ga0495668_0000916 3300046616 Bacteria 32966
280 Ga0495668_0001512 3300046616 Bacteria 22160
281 Ga0495625_0000782 3300046660 Bacteria 44208
282 Ga0495635_0012626 3300046663 Bacteria 5923
283 Ga0495657_0011034 3300046675 Bacteria 6774
284 Ga0495657_0077971 3300046675 Bacteria 2148
285 Ga0495657_0079584 3300046675 Bacteria 2122
286 Ga0495599_0146335 3300046678 Bacteria 1464
287 Ga0495599_0331129 3300046678 Bacteria 915
288 Ga0495623_0089596 3300046679 Bacteria 1890
289 Ga0495658_0062283 3300046683 Bacteria 2144
290 Ga0495613_0009921 3300046689 Bacteria 7080
291 Ga0495613_0129364 3300046689 Bacteria 1809
292 Ga0495624_0214551 3300046690 Bacteria 1167
293 Ga0495581_0033953 3300047315 Bacteria 2952
294 Ga0495604_0064173 3300047317 Bacteria 2799
295 Ga0495674_0032731 3300047319 Bacteria 4713
296 Ga0495674_0344716 3300047319 Bacteria 1210
297 Ga0495680_0020930 3300047322 Bacteria 5486
298 Ga0495680_0174741 3300047322 Bacteria 1553
299 Ga0495683_0024123 3300047323 Bacteria 3123
300 Ga0495675_0021587 3300047444 Bacteria 4101
301 Ga0495684_0069019 3300047471 Bacteria 2687
302 Ga0495593_0008302 3300047673 Bacteria 6042
303 Ga0495602_0277408 3300048088 Bacteria 1236
304 Ga0495614_0016170 3300048089 Bacteria 3249
305 Ga0495626_0000387 3300048091 Bacteria 45484
306 Ga0495626_0000669 3300048091 Bacteria 32989
307 Ga0496102_0010558 3300048905 Bacteria 7953
308 Ga0496103_0097151 3300048906 Bacteria 1862
309 Ga0496104_0058217 3300048907 Bacteria 3657
310 Ga0496104_0128742 3300048907 Bacteria 2431
311 Ga0496105_0022480 3300048908 Bacteria 5107
312 Ga0496105_0064627 3300048908 Bacteria 3019
313 Ga0496106_0030299 3300048909 Bacteria 4035
314 Ga0496107_0020223 3300048910 Bacteria 4701
315 Ga0496108_0020307 3300048911 Bacteria 5459
316 Ga0496108_0033930 3300048911 Bacteria 4239
317 Ga0496109_0019363 3300048912 Bacteria 6000
318 Ga0496109_0064708 3300048912 Bacteria 3346
319 Ga0496110_0004971 3300048913 Bacteria 10377
320 Ga0496111_0069591 3300048914 Bacteria 2559
321 Ga0496111_0120892 3300048914 Bacteria 1934
322 Ga0496112_0155494 3300048915 Bacteria 2253
323 Ga0496113_0006392 3300048916 Bacteria 7461
324 Ga0496113_0009775 3300048916 Bacteria 6306
325 Ga0501047_0003807 3300049581 Bacteria 14177
326 Ga0501077_0019640 3300049593 Bacteria 4274
327 nmdc:mga00v17_102215_c1 3300050491 Bacteria 1810
328 nmdc:mga05p37_148904_c1 3300050507 Bacteria 2865
329 nmdc:mga05p37_421519_c1 3300050507 Bacteria 1553
330 nmdc:mga09592_307053_c1 3300050508 Bacteria 1375
331 nmdc:mga06r32_120798_c2 3300050510 Bacteria 1567
332 nmdc:mga08y16_104090_c1 3300050511 Bacteria 2955
333 nmdc:mga0n895_16226_c1 3300050512 Bacteria 6828
334 nmdc:mga0n895_32935_c1 3300050512 Bacteria 4977
335 nmdc:mga0rr50_16615_c1 3300050513 Bacteria 4894
336 nmdc:mga0rr50_2398_c1 3300050513 Bacteria 10546
337 nmdc:mga0rr50_338258_c1 3300050513 Bacteria 1264
338 nmdc:mga08x19_33178_c1 3300050514 Bacteria 3258
339 nmdc:mga08x19_41974_c1 3300050514 Bacteria 2914
340 Ga0495601_0052116 3300053077 Bacteria 2583
341 Ga0495612_0026885 3300053078 Bacteria 2312
342 Ga0495595_0115861 3300053084 Bacteria 1302
343 Ga0495619_0036779 3300053085 Bacteria 3189
344 Ga0495619_0138428 3300053085 Bacteria 1675
345 Ga0500630_061937 3300053159 Bacteria 1786
346 2501939835 2501939600 Bacteria 6907073
347 2623591186 2622736626 Bacteria 7181580
348 2676491233 2675903060 Bacteria 10051191
349 2772647210 2772190715 Bacteria 6959372
350 2855674068 2855670206 Bacteria 7120389
351 2855677085 2855676851 Bacteria 7063653
352 2855688838 2855683550 Bacteria 7134265
353 2856858140 2856858025 Bacteria 7255264
354 2857295379 2857288857 Bacteria 7189066
355 2858852759 2858848962 Bacteria 6963058
356 2858874381 2858868258 Bacteria 7683772
357 2858886595 2858882152 Bacteria 7230291
358 2858894295 2858888857 Bacteria 7060307
359 2858898196 2858895516 Bacteria 7378898
360 2858908241 2858902515 Bacteria 7086037
361 2867307665 2867302475 Bacteria 7087181
362 2867316456 2867312974 Bacteria 7058875
363 2867324908 2867319477 Bacteria 7069771
364 2867512935 2867507094 Bacteria 6506033
365 2869054915 2869048445 Bacteria 6875584
366 2869067451 2869061728 Bacteria 7112407
367 2869072609 2869068681 Bacteria 7205615
368 2880495936 2880489317 Bacteria 7096270
369 2880496433 2880495981 Bacteria 7340502
370 2884700766 2884693830 Bacteria 11273186
371 2887480705 2887478801 Bacteria 8972725
372 2891399339 2891395885 Bacteria 9251614
373 2895429089 2895427314 Bacteria 13147766
374 2895452517 2895442618 Bacteria 11027144
375 2902584852 2902582711 Bacteria 6187705
376 2929225068 2929219909 Bacteria 6984360
377 2929231968 2929226422 Bacteria 7248583
378 2996224859 2996221748 Bacteria 6799777
379 649813619 649633069 Bacteria 6962533
380 8001786157 8001781756 Bacteria 9586736
381 8003834683 8003830390 Bacteria 6541657
382 8003861051 8003856774 Bacteria 7675274
383 8003873638 8003870546 Bacteria 7396674
384 8054705251 8054704163 Bacteria 7247792
385 8054730003 8054727385 Bacteria 7558670
386 8055066887 8055066027 Bacteria 9479577
387 8055416429 8055412473 Bacteria 6257500
388 Ga0307415_100083040
389 JGI24751J29686_10018110
390 JGI25406J46586_10043541
391 Ga0070658_10080220
392 Ga0070676_10034286
393 Ga0070676_10303928
394 Ga0070683_100003291
395 Ga0070683_100264299
396 Ga0070670_100304412
397 Ga0068869_100012006
398 Ga0068869_100013222
399 Ga0070680_100013498
400 Ga0070680_100069616
401 Ga0070682_100009449
402 Ga0070682_100045783
403 Ga0068868_100038314
404 Ga0070660_100152231
405 Ga0070660_100182998
406 Ga0070689_100036469
407 Ga0070691_10009879
408 Ga0070687_100136598
409 Ga0070661_100042544
410 Ga0070661_100085448
411 Ga0070692_10019799
412 Ga0070692_10073900
413 Ga0070675_100006141
414 Ga0070671_100005402
415 Ga0070671_100195401
416 Ga0070673_100079752
417 Ga0070659_100056329
418 Ga0070709_10005858
419 Ga0070709_10078312
420 Ga0070709_10106221
421 Ga0070709_10217646
422 Ga0070714_100011474
423 Ga0070714_100012483
424 Ga0070714_100120704
425 Ga0070713_100038647
426 Ga0070713_100046526
427 Ga0070713_100218516
428 Ga0070710_10002507
429 Ga0070710_10050295
430 Ga0070711_100004392
431 Ga0070711_100009360
432 Ga0070711_100205254
433 Ga0070700_100063797
434 Ga0070700_100101133
435 Ga0070708_100114749
436 Ga0070708_100168679
437 Ga0070663_100010748
438 Ga0070678_100005608
439 Ga0070662_100081901
440 Ga0070681_10043083
441 Ga0070706_100059300
442 Ga0070706_100064736
443 Ga0070707_100202987
444 Ga0070698_100109171
445 Ga0070679_100151846
446 Ga0070684_100036329
447 Ga0070684_100046964
448 Ga0070697_100054262
449 Ga0070696_100163381
450 Ga0070665_100102318
451 Ga0070664_100000534
452 Ga0068857_100006062
453 Ga0068857_100023132
454 Ga0068854_100031595
455 Ga0068854_100125197
456 Ga0068856_100021582
457 Ga0070702_100031374
458 Ga0068852_100106857
459 Ga0068852_100156833
460 Ga0068859_100019543
461 Ga0068859_100339545
462 Ga0068859_100793329
463 Ga0068864_100022836
464 Ga0068864_100175609
465 Ga0068851_10043575
466 Ga0068870_10000435
467 Ga0068863_100010169
468 Ga0068858_100007085
469 Ga0068862_100021790
470 Ga0068862_100182191
471 Ga0081539_10002173
472 Ga0081539_10033765
473 Ga0075364_10087658
474 Ga0075432_10028256
475 Ga0070716_100000033
476 Ga0070716_100386675
477 Ga0097621_100148200
478 Ga0075428_100171721
479 Ga0075430_100249171
480 Ga0075433_10064556
481 Ga0075434_100056952
482 Ga0075436_100010700
483 Ga0097620_100019542
484 Ga0097620_100339553
485 Ga0097620_100793355
486 Ga0075435_100001615
487 Ga0105251_10071724
488 Ga0111539_10013384
489 Ga0111539_10175520
490 Ga0105245_10030048
491 Ga0105247_10010491
492 Ga0114129_10085696
493 Ga0114129_10230340
494 Ga0105243_10249143
495 Ga0105248_10006036
496 Ga0105248_10092780
497 Ga0105237_10049321
498 Ga0105239_10271255
499 Ga0105246_10082176
500 Ga0157373_10349294
501 Ga0157371_10005046
502 Ga0157370_10059688
503 Ga0157369_10006196
504 Ga0163162_10322685
505 Ga0163162_10677466
506 Ga0157372_10089799
507 Ga0157375_10098353
508 Ga0163163_10007838
509 Ga0163163_10054829
510 Ga0163163_10291095
511 Ga0157380_10179695
512 Ga0182008_10059471
513 Ga0157377_10009354
514 Ga0157377_10009787
515 Ga0157379_10010137
516 Ga0157379_10144080
517 Ga0157376_10039785
518 Ga0197907_10783840
519 Ga0206356_10467182
520 Ga0206354_11412859
521 Ga0206353_10118627
522 Ga0213874_10020963
523 Ga0213875_10001933
524 Ga0207692_10031973
525 Ga0207688_10079942
526 Ga0207688_10185046
527 Ga0207680_10386866
528 Ga0207699_10013196
529 Ga0207699_10202451
530 Ga0207645_10032470
531 Ga0207643_10007044
532 Ga0207705_10013920
533 Ga0207705_10023993
534 Ga0207684_10002014
535 Ga0207684_10385963
536 Ga0207707_10236155
537 Ga0207693_10057533
538 Ga0207693_10063331
539 Ga0207663_10014117
540 Ga0207663_10035712
541 Ga0207663_10388198
542 Ga0207660_10091031
543 Ga0207662_10161859
544 Ga0207657_10048128
545 Ga0207657_10097495
546 Ga0207649_10006275
547 Ga0207652_10022633
548 Ga0207646_10177498
549 Ga0207650_10010956
550 Ga0207650_10317443
551 Ga0207659_10071141
552 Ga0207687_10011190
553 Ga0207687_10019556
554 Ga0207700_10077585
555 Ga0207700_10152296
556 Ga0207700_10311730
557 Ga0207664_10000276
558 Ga0207664_10105482
559 Ga0207664_10142502
560 Ga0207644_10014974
561 Ga0207644_10110077
562 Ga0207706_10184808
563 Ga0207709_10235316
564 Ga0207670_10057053
565 Ga0207670_10384487
566 Ga0207665_10000079
567 Ga0207665_10394131
568 Ga0207691_10044052
569 Ga0207689_10004347
570 Ga0207689_10013228
571 Ga0207661_10051400
572 Ga0207661_10084335
573 Ga0207679_10009267
574 Ga0207679_10095284
575 Ga0207667_10632883
576 Ga0207712_10466281
577 Ga0207640_10097914
578 Ga0207677_10015314
579 Ga0207677_10093580
580 Ga0207703_10098980
581 Ga0207703_10316564
582 Ga0207639_10072817
583 Ga0207639_10747181
584 Ga0207678_10000794
585 Ga0207678_10559210
586 Ga0207708_10023630
587 Ga0207708_10040679
588 Ga0207702_10038726
589 Ga0207702_10623667
590 Ga0207641_10022899
591 Ga0207641_10071583
592 Ga0207676_10005362
593 Ga0207674_10045530
594 Ga0207674_10099887
595 Ga0207674_10186412
596 Ga0207683_10002283
597 Ga0207428_10013762
598 Ga0207428_10238947
599 Ga0268266_10076121
600 Ga0268265_10374040
601 Ga0268264_10056790
602 Ga0307513_10072008
603 Ga0307508_10007096
604 Ga0316576_10034246
605 Ga0307405_10085294
606 Ga0307413_10140744
607 Ga0307406_10235789
608 Ga0307406_10339852
609 Ga0307406_10592704
610 Ga0307407_10326404
611 Ga0307416_100239952
612 Ga0307416_101020150
613 Ga0373948_0025863
614 Ga0373934_0039803
615 Ga0373934_0102939
616 Ga0373951_0000210
617 Ga0373936_0008531
618 Ga0373936_0016835
619 Ga0373936_0123190
620 Ga0373945_0017686
621 Ga0373953_0074631
622 Ga0373957_0017518
623 Ga0373957_0159656
624 Ga0373943_0184259
625 Ga0373946_0122547
626 Ga0373946_0319202
627 Ga0373955_0010343
628 Ga0373962_0003480
629 Ga0373933_0003895
630 Ga0373937_0101934
631 Ga0373937_0180057
632 Ga0373925_0012870
633 Ga0373925_0199138
634 Ga0395899_0036602
635 Ga0395898_0028053
636 Ga0395905_0098343
637 Ga0436364_0635330
638 Ga0436364_1123072
639 Ga0436361_0664023
640 Ga0436363_0579932
641 Ga0436363_1182548
642 Ga0439448_0102843
643 Ga0439459_0002828
644 Ga0466957_0043113
645 Ga0466967_0137726
646 Ga0495651_0005482
647 Ga0495653_0007879
648 Ga0495662_0026335
649 Ga0495662_0213686
650 Ga0495664_0020764
651 Ga0495606_0000643
652 Ga0495606_0003702
653 Ga0495608_0008274
654 Ga0495618_0091957
655 Ga0495618_0194724
656 Ga0495628_0213445
657 Ga0495628_0243351
658 Ga0495652_0055779
659 Ga0495652_0345386
660 Ga0495640_0022941
661 Ga0495640_0296740
662 Ga0495645_0023815
663 Ga0495645_0098367
664 Ga0495667_0027510
665 Ga0495667_0103482
666 Ga0495668_0000916
667 Ga0495668_0001512
668 Ga0495625_0000782
669 Ga0495635_0012626
670 Ga0495657_0011034
671 Ga0495657_0077971
672 Ga0495657_0079584
673 Ga0495599_0146335
674 Ga0495599_0331129
675 Ga0495623_0089596
676 Ga0495658_0062283
677 Ga0495613_0009921
678 Ga0495613_0129364
679 Ga0495624_0214551
680 Ga0495581_0033953
681 Ga0495604_0064173
682 Ga0495674_0032731
683 Ga0495674_0344716
684 Ga0495680_0020930
685 Ga0495680_0174741
686 Ga0495683_0024123
687 Ga0495675_0021587
688 Ga0495684_0069019
689 Ga0495593_0008302
690 Ga0495602_0277408
691 Ga0495614_0016170
692 Ga0495626_0000387
693 Ga0495626_0000669
694 Ga0496102_0010558
695 Ga0496103_0097151
696 Ga0496104_0058217
697 Ga0496104_0128742
698 Ga0496105_0022480
699 Ga0496105_0064627
700 Ga0496106_0030299
701 Ga0496107_0020223
702 Ga0496108_0020307
703 Ga0496108_0033930
704 Ga0496109_0019363
705 Ga0496109_0064708
706 Ga0496110_0004971
707 Ga0496111_0069591
708 Ga0496111_0120892
709 Ga0496112_0155494
710 Ga0496113_0006392
711 Ga0496113_0009775
712 Ga0501047_0003807
713 Ga0501077_0019640
714 nmdc:mga00v17_102215_c1
715 nmdc:mga05p37_148904_c1
716 nmdc:mga05p37_421519_c1
717 nmdc:mga09592_307053_c1
718 nmdc:mga06r32_120798_c2
719 nmdc:mga08y16_104090_c1
720 nmdc:mga0n895_16226_c1
721 nmdc:mga0n895_32935_c1
722 nmdc:mga0rr50_16615_c1
723 nmdc:mga0rr50_2398_c1
724 nmdc:mga0rr50_338258_c1
725 nmdc:mga08x19_33178_c1
726 nmdc:mga08x19_41974_c1
727 Ga0495601_0052116
728 Ga0495612_0026885
729 Ga0495595_0115861
730 Ga0495619_0036779
731 Ga0495619_0138428
732 Ga0500630_061937
733 2501939835
734 2623591186
735 2676491233
736 2772647210
737 2855674068
738 2855677085
739 2855688838
740 2856858140
741 2857295379
742 2858852759
743 2858874381
744 2858886595
745 2858894295
746 2858898196
747 2858908241
748 2867307665
749 2867316456
750 2867324908
751 2867512935
752 2869054915
753 2869067451
754 2869072609
755 2880495936
756 2880496433
757 2884700766
758 2887480705
759 2891399339
760 2895429089
761 2895452517
762 2902584852
763 2929225068
764 2929231968
765 2996224859
766 649813619
767 8001786157
768 8003834683
769 8003861051
770 8003873638
771 8054705251
772 8054730003
773 8055066887
774 8055416429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

49

243

0.91

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

55

287

0.91

PF08659

KR

KR domain

50

232

0.83

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

51

207

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4npc-assembly1.cif.gz_A crystal structure of an oxidoreductase, short-chain dehydrogenase/reductase family protein from brucella suis 0.9418 2 241
2d1y-assembly1.cif.gz_B crystal structure of tt0321 from thermus thermophilus hb8 0.9393 2 241
2d1y-assembly1.cif.gz_A crystal structure of tt0321 from thermus thermophilus hb8 0.938 2 241
4cql-assembly1.cif.gz_F crystal structure of heterotetrameric human ketoacyl reductase complexed with nad 0.9331 2 241
4cqm-assembly3.cif.gz_N crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9329 2 240
ID Description Score Start End Superfamily
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9418 2 241 3.40.50.720
1ulsC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9352 2 241 3.40.50.720
4cqmK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9306 2 241 3.40.50.720
5t5qC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9234 2 244 3.40.50.720
5k9zA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9221 2 239 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2D9DQU0-F1-model_v4 3-oxoacyl-ACP reductase 0.9539 2 245
AF-A0A2D9DQU0-F1-model_v4 3-oxoacyl-ACP reductase 0.9464 2 245
AF-A0A354NET0-F1-model_v4 deleted 0.9395 2 242
AF-A0A353FUM2-F1-model_v4 deleted 0.9394 113 240
AF-A0A0P9EU25-F1-model_v4 Short-chain dehydrogenase 0.9359 2 140 GO:0016020
GO:0016491

Map