F430869

General Info

Members Datasets Scaffolds Average Seq Length
387 184 387 447

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100099971|Ga0307408_1000999712
Length 516
Sequence LETVSTVRGSGWVAVPKCELAIDYEYGRYTHPLPRTVLTVSNRNVLTFVQSQSYRAYYYFCALTGIMIAKIMASTIREFSGQDTVSIADLYTQVRARTMQIVAPLEIEDYVIQTADFMSPPRWHIGHTSWFFETVLQAYKSGYRVYSEDFLFYFNSYYEGFGERIERPKRGTKSRPTVKETVAYRNHIDEQLLSFLQSSTDPKVLSLVRLGLEHEMQHQELLVYDIKHLLCDQFDAPVKPLPEPSIKVEGMAKIEGGLFWLGYDNAQAPRSRPFAFDNEKPAHQVFLQDFAIDKALVSNGDFLEFINDGGYQNFHWWFSEGWETVNREHWRAPLYWELHDGEWMIRDFSGLHPAASRKNEPVSHVSYFEASAYAKWAGKRLPTEAEWEKAACYDAARNVRRAFPWGDTDPDSGNTNLFENGFWSVAPIGAFPDGANAYGCQQMIGDVWEWTTSDYVPYPGFKSEFDEYNDKWFVNQKVLRGGSFATPQLHIRTTYRNFFHAHERWMISGFRCAATD

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
158 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
159 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
171 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
172 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
173 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
174 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
175 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.29
Rhizosphere 98.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000004 3300002074 Bacteria 262344
2 JGI24034J26672_10000001 3300002239 Bacteria 1118280
3 JGI24751J29686_10000003 3300002459 Bacteria 157815
4 JGI25406J46586_10034588 3300003203 Bacteria 1852
5 Ga0065714_10064425 3300005288 Bacteria 189652
6 Ga0065712_10067727 3300005290 Bacteria 189643
7 Ga0065712_10076150 3300005290 Unclassified 3719
8 Ga0065715_10008422 3300005293 Bacteria 2671
9 Ga0065715_10012850 3300005293 Unclassified 3712
10 Ga0065715_10090321 3300005293 Bacteria 7209
11 Ga0065707_10005134 3300005295 Bacteria 8707
12 Ga0065707_10132970 3300005295 Bacteria 1877
13 Ga0065707_10141210 3300005295 Bacteria 1770
14 Ga0065707_10147420 3300005295 Bacteria 1697
15 Ga0070676_10071350 3300005328 Bacteria 2086
16 Ga0070690_100004956 3300005330 Bacteria 7447
17 Ga0070690_100010268 3300005330 Bacteria 5444
18 Ga0070670_100000223 3300005331 Bacteria 52272
19 Ga0070670_100000832 3300005331 Bacteria 24107
20 Ga0070670_100093181 3300005331 Bacteria 2591
21 Ga0070670_100171350 3300005331 Bacteria 1883
22 Ga0068869_100015163 3300005334 Bacteria 5162
23 Ga0068869_100026448 3300005334 Bacteria 4040
24 Ga0068869_100051828 3300005334 Bacteria 2978
25 Ga0068869_100156395 3300005334 Bacteria 1772
26 Ga0070666_10127345 3300005335 Bacteria 1768
27 Ga0070680_100002231 3300005336 Bacteria 14296
28 Ga0070680_100040815 3300005336 Unclassified 3760
29 Ga0070682_100000210 3300005337 Bacteria 42814
30 Ga0068868_100115148 3300005338 Bacteria 2188
31 Ga0070689_100002015 3300005340 Bacteria 13172
32 Ga0070661_100015168 3300005344 Bacteria 5437
33 Ga0070692_10008215 3300005345 Bacteria 4645
34 Ga0070668_100008204 3300005347 Bacteria 7755
35 Ga0070669_100002272 3300005353 Bacteria 13944
36 Ga0070671_100002475 3300005355 Bacteria 14278
37 Ga0070673_100206313 3300005364 Bacteria 1695
38 Ga0070688_100072480 3300005365 Bacteria 2207
39 Ga0070703_10000014 3300005406 Bacteria 89131
40 Ga0070703_10000267 3300005406 Bacteria 25022
41 Ga0070709_10000172 3300005434 Bacteria 40757
42 Ga0070711_100000001 3300005439 Bacteria 370591
43 Ga0070705_100000011 3300005440 Bacteria 101991
44 Ga0070705_100003338 3300005440 Bacteria 7878
45 Ga0070705_100034495 3300005440 Bacteria 2830
46 Ga0070705_100076995 3300005440 Unclassified 2036
47 Ga0070700_100000248 3300005441 Bacteria 29509
48 Ga0070700_100006305 3300005441 Bacteria 6333
49 Ga0070700_100052342 3300005441 Unclassified 2545
50 Ga0070694_100004027 3300005444 Bacteria 8804
51 Ga0070694_100007275 3300005444 Bacteria 6742
52 Ga0070694_100010531 3300005444 Bacteria 5708
53 Ga0070694_100028099 3300005444 Bacteria 3657
54 Ga0070694_100084736 3300005444 Bacteria 2212
55 Ga0070708_100000042 3300005445 Bacteria 83511
56 Ga0070708_100020297 3300005445 Bacteria 5601
57 Ga0070662_100035420 3300005457 Bacteria 3525
58 Ga0070681_10000053 3300005458 Bacteria 81387
59 Ga0070681_10045566 3300005458 Unclassified 4387
60 Ga0068867_100174481 3300005459 Bacteria 1705
61 Ga0070706_100000120 3300005467 Bacteria 95553
62 Ga0070706_100006976 3300005467 Bacteria 10655
63 Ga0070706_100036769 3300005467 Bacteria 4523
64 Ga0070706_100083419 3300005467 Bacteria 2960
65 Ga0070707_100000054 3300005468 Bacteria 100665
66 Ga0070707_100001523 3300005468 Bacteria 22581
67 Ga0070707_100241925 3300005468 Unclassified 1756
68 Ga0070698_100000593 3300005471 Bacteria 38912
69 Ga0070698_100015537 3300005471 Bacteria 8041
70 Ga0070698_100018189 3300005471 Bacteria 7400
71 Ga0070698_100023480 3300005471 Bacteria 6446
72 Ga0070698_100076457 3300005471 Bacteria 3350
73 Ga0070699_100000013 3300005518 Bacteria 241303
74 Ga0070699_100001084 3300005518 Bacteria 25336
75 Ga0070699_100003703 3300005518 Bacteria 13518
76 Ga0070699_100019870 3300005518 Bacteria 5790
77 Ga0070699_100038324 3300005518 Bacteria 4150
78 Ga0070699_100045879 3300005518 Bacteria 3781
79 Ga0070699_100146622 3300005518 Unclassified 2086
80 Ga0070679_100000030 3300005530 Bacteria 108148
81 Ga0070697_100001859 3300005536 Bacteria 16142
82 Ga0070697_100002202 3300005536 Bacteria 14960
83 Ga0070697_100011445 3300005536 Bacteria 6935
84 Ga0070697_100064289 3300005536 Bacteria 2997
85 Ga0070697_100084765 3300005536 Bacteria 2614
86 Ga0068853_100060375 3300005539 Bacteria 3276
87 Ga0070672_100148631 3300005543 Bacteria 1937
88 Ga0070686_100003241 3300005544 Bacteria 8908
89 Ga0070696_100000142 3300005546 Bacteria 39428
90 Ga0070696_100097777 3300005546 Bacteria 2099
91 Ga0070693_100005167 3300005547 Bacteria 6241
92 Ga0070693_100018368 3300005547 Bacteria 3651
93 Ga0070693_100019543 3300005547 Bacteria 3554
94 Ga0070693_100053955 3300005547 Bacteria 2309
95 Ga0070704_100002716 3300005549 Bacteria 10004
96 Ga0070704_100052919 3300005549 Bacteria 2867
97 Ga0070704_100064247 3300005549 Bacteria 2637
98 Ga0070704_100208471 3300005549 Bacteria 1582
99 Ga0070664_100000993 3300005564 Bacteria 22209
100 Ga0068857_100075692 3300005577 Unclassified 3001
101 Ga0068857_100114492 3300005577 Bacteria 2425
102 Ga0068854_100149786 3300005578 Bacteria 1798
103 Ga0068856_100079417 3300005614 Bacteria 3253
104 Ga0070702_100007963 3300005615 Bacteria 5106
105 Ga0068859_100012132 3300005617 Bacteria 8661
106 Ga0068859_100012145 3300005617 Bacteria 8656
107 Ga0068859_100025911 3300005617 Bacteria 5883
108 Ga0068859_100063531 3300005617 Bacteria 3722
109 Ga0068859_100081413 3300005617 Bacteria 3280
110 Ga0068859_100101607 3300005617 Bacteria 2932
111 Ga0068864_100014272 3300005618 Bacteria 6597
112 Ga0068864_100027262 3300005618 Bacteria 4823
113 Ga0068866_10069757 3300005718 Bacteria 1853
114 Ga0068861_100069250 3300005719 Bacteria 2729
115 Ga0068861_100071239 3300005719 Bacteria 2694
116 Ga0068851_10001956 3300005834 Bacteria 9053
117 Ga0068863_100029208 3300005841 Bacteria 5264
118 Ga0068863_100148694 3300005841 Bacteria 2241
119 Ga0068858_100000005 3300005842 Bacteria 305830
120 Ga0068858_100036853 3300005842 Bacteria 4534
121 Ga0068858_100056354 3300005842 Bacteria 3633
122 Ga0068860_100025612 3300005843 Bacteria 5689
123 Ga0068860_100035513 3300005843 Bacteria 4781
124 Ga0068860_100081740 3300005843 Unclassified 3072
125 Ga0068860_100197071 3300005843 Bacteria 1951
126 Ga0068862_100022736 3300005844 Bacteria 5246
127 Ga0068862_100056733 3300005844 Bacteria 3356
128 Ga0081455_10064380 3300005937 Bacteria 3070
129 Ga0081539_10000481 3300005985 Bacteria 84382
130 Ga0081539_10083093 3300005985 Unclassified 1677
131 Ga0070715_10000024 3300006163 Bacteria 110647
132 Ga0070716_100000001 3300006173 Bacteria 400668
133 Ga0097621_100007343 3300006237 Bacteria 7880
134 Ga0097621_100017050 3300006237 Bacteria 5508
135 Ga0068871_100010860 3300006358 Bacteria 6667
136 Ga0068871_100087484 3300006358 Bacteria 2591
137 Ga0075428_100000734 3300006844 Bacteria 34044
138 Ga0075428_100082736 3300006844 Unclassified 3502
139 Ga0075428_100106388 3300006844 Bacteria 3058
140 Ga0075430_100025248 3300006846 Bacteria 5054
141 Ga0075431_100005971 3300006847 Bacteria 12061
142 Ga0075433_10016589 3300006852 Bacteria 6076
143 Ga0075433_10081714 3300006852 Bacteria 2849
144 Ga0075433_10090835 3300006852 Bacteria 2699
145 Ga0075433_10117750 3300006852 Bacteria 2357
146 Ga0075433_10123218 3300006852 Bacteria 2303
147 Ga0075433_10164164 3300006852 Bacteria 1977
148 Ga0075433_10169261 3300006852 Bacteria 1944
149 Ga0075434_100062809 3300006871 Bacteria 3698
150 Ga0075434_100097509 3300006871 Unclassified 2944
151 Ga0075434_100156208 3300006871 Bacteria 2300
152 Ga0075434_100179411 3300006871 Bacteria 2137
153 Ga0075434_100422203 3300006871 Bacteria 1355
154 Ga0075429_100012443 3300006880 Bacteria 7383
155 Ga0075429_100188636 3300006880 Bacteria 1806
156 Ga0075429_100265842 3300006880 Unclassified 1502
157 Ga0075436_100000002 3300006914 Bacteria 475522
158 Ga0075436_100004884 3300006914 Bacteria 9211
159 Ga0075436_100017679 3300006914 Bacteria 4881
160 Ga0097620_100012131 3300006931 Bacteria 8661
161 Ga0097620_100012145 3300006931 Bacteria 8656
162 Ga0097620_100025911 3300006931 Bacteria 5883
163 Ga0097620_100063535 3300006931 Bacteria 3722
164 Ga0097620_100081410 3300006931 Bacteria 3280
165 Ga0097620_100101606 3300006931 Bacteria 2932
166 Ga0097620_100282070 3300006931 Unclassified 1754
167 Ga0075435_100000689 3300007076 Bacteria 20967
168 Ga0099794_10070388 3300007265 Bacteria 1713
169 Ga0105240_10122081 3300009093 Bacteria 3136
170 Ga0111539_10000405 3300009094 Bacteria 53738
171 Ga0111539_10002073 3300009094 Bacteria 26784
172 Ga0111539_10236915 3300009094 Bacteria 2124
173 Ga0105247_10000002 3300009101 Bacteria 724587
174 Ga0105247_10010710 3300009101 Bacteria 5536
175 Ga0105247_10022027 3300009101 Unclassified 3836
176 Ga0105247_10070983 3300009101 Bacteria 2177
177 Ga0114129_10001476 3300009147 Bacteria 31850
178 Ga0114129_10001970 3300009147 Bacteria 28080
179 Ga0114129_10029655 3300009147 Bacteria 7748
180 Ga0114129_10104616 3300009147 Bacteria 3912
181 Ga0114129_10110930 3300009147 Bacteria 3786
182 Ga0114129_10168975 3300009147 Bacteria 2982
183 Ga0114129_10179277 3300009147 Bacteria 2884
184 Ga0114129_10236112 3300009147 Bacteria 2460
185 Ga0114129_10357139 3300009147 Bacteria 1934
186 Ga0114129_10412478 3300009147 Unclassified 1778
187 Ga0114129_10459359 3300009147 Bacteria 1669
188 Ga0105243_10000037 3300009148 Bacteria 175237
189 Ga0105243_10001856 3300009148 Bacteria 18034
190 Ga0105243_10002586 3300009148 Bacteria 15104
191 Ga0105243_10135246 3300009148 Bacteria 2096
192 Ga0105241_10045843 3300009174 Unclassified 3319
193 Ga0105242_10000276 3300009176 Bacteria 40893
194 Ga0105242_10002534 3300009176 Bacteria 14339
195 Ga0105242_10136008 3300009176 Bacteria 2127
196 Ga0105248_10001987 3300009177 Bacteria 22745
197 Ga0105248_10170707 3300009177 Unclassified 2451
198 Ga0105237_10000521 3300009545 Bacteria 54240
199 Ga0105238_10014544 3300009551 Bacteria 7959
200 Ga0105249_10000201 3300009553 Bacteria 68199
201 Ga0105249_10003117 3300009553 Bacteria 14331
202 Ga0105249_10033991 3300009553 Bacteria 4618
203 Ga0105249_10038428 3300009553 Bacteria 4343
204 Ga0105249_10126065 3300009553 Bacteria 2438
205 Ga0157373_10021953 3300013100 Unclassified 4632
206 Ga0157373_10027431 3300013100 Unclassified 4108
207 Ga0157371_10133952 3300013102 Bacteria 1764
208 Ga0157378_10000003 3300013297 Bacteria 203725
209 Ga0157378_10003542 3300013297 Bacteria 13841
210 Ga0157378_10006907 3300013297 Bacteria 9909
211 Ga0157378_10041609 3300013297 Unclassified 4076
212 Ga0163162_10000128 3300013306 Bacteria 68199
213 Ga0163162_10003297 3300013306 Bacteria 15445
214 Ga0163162_10008501 3300013306 Bacteria 10011
215 Ga0163162_10155501 3300013306 Unclassified 2407
216 Ga0163162_10194714 3300013306 Bacteria 2155
217 Ga0157372_10034510 3300013307 Bacteria 5561
218 Ga0157375_10001282 3300013308 Bacteria 21701
219 Ga0157375_10004533 3300013308 Bacteria 12068
220 Ga0157375_10213712 3300013308 Bacteria 2086
221 Ga0157375_10291866 3300013308 Bacteria 1794
222 Ga0163163_10002306 3300014325 Bacteria 16112
223 Ga0163163_10022736 3300014325 Bacteria 5941
224 Ga0163163_10023389 3300014325 Bacteria 5864
225 Ga0163163_10139974 3300014325 Bacteria 2462
226 Ga0157380_10003764 3300014326 Bacteria 10426
227 Ga0157380_10005594 3300014326 Bacteria 8780
228 Ga0157380_10156230 3300014326 Bacteria 1977
229 Ga0157377_10031395 3300014745 Bacteria 2886
230 Ga0157379_10050448 3300014968 Bacteria 3715
231 Ga0163161_10032068 3300017792 Bacteria 3748
232 Ga0207672_1000084 3300025223 Bacteria 12333
233 Ga0207653_10000133 3300025885 Bacteria 53038
234 Ga0207653_10000307 3300025885 Bacteria 27669
235 Ga0207653_10001368 3300025885 Bacteria 7953
236 Ga0207710_10000002 3300025900 Bacteria 1251998
237 Ga0207710_10000808 3300025900 Bacteria 16971
238 Ga0207710_10091037 3300025900 Bacteria 1427
239 Ga0207680_10089226 3300025903 Bacteria 1957
240 Ga0207647_10008624 3300025904 Bacteria 7292
241 Ga0207685_10000018 3300025905 Bacteria 145715
242 Ga0207699_10000135 3300025906 Bacteria 50093
243 Ga0207643_10022506 3300025908 Bacteria 3470
244 Ga0207684_10000053 3300025910 Bacteria 225260
245 Ga0207684_10000075 3300025910 Bacteria 183366
246 Ga0207684_10007834 3300025910 Bacteria 9555
247 Ga0207684_10014046 3300025910 Bacteria 6916
248 Ga0207684_10026162 3300025910 Bacteria 4972
249 Ga0207684_10044488 3300025910 Bacteria 3765
250 Ga0207684_10076008 3300025910 Bacteria 2854
251 Ga0207707_10000063 3300025912 Bacteria 108163
252 Ga0207707_10021764 3300025912 Bacteria 5604
253 Ga0207671_10002243 3300025914 Bacteria 20925
254 Ga0207663_10000001 3300025916 Bacteria 591990
255 Ga0207660_10004704 3300025917 Bacteria 8885
256 Ga0207660_10071530 3300025917 Bacteria 2524
257 Ga0207652_10000091 3300025921 Bacteria 98787
258 Ga0207646_10000900 3300025922 Bacteria 38311
259 Ga0207646_10001776 3300025922 Bacteria 26130
260 Ga0207646_10010198 3300025922 Bacteria 9201
261 Ga0207646_10083499 3300025922 Bacteria 2857
262 Ga0207646_10280537 3300025922 Bacteria 1506
263 Ga0207681_10000966 3300025923 Bacteria 18757
264 Ga0207681_10010828 3300025923 Bacteria 5602
265 Ga0207681_10056980 3300025923 Bacteria 2668
266 Ga0207694_10008843 3300025924 Bacteria 7597
267 Ga0207650_10000007 3300025925 Bacteria 530810
268 Ga0207650_10005207 3300025925 Bacteria 8869
269 Ga0207650_10040448 3300025925 Bacteria 3412
270 Ga0207650_10102415 3300025925 Bacteria 2206
271 Ga0207650_10119043 3300025925 Bacteria 2053
272 Ga0207659_10230710 3300025926 Bacteria 1493
273 Ga0207644_10000636 3300025931 Bacteria 22253
274 Ga0207690_10217111 3300025932 Bacteria 1461
275 Ga0207706_10152066 3300025933 Bacteria 2035
276 Ga0207686_10000003 3300025934 Bacteria 376934
277 Ga0207686_10000127 3300025934 Bacteria 61880
278 Ga0207686_10001296 3300025934 Bacteria 14326
279 Ga0207686_10079652 3300025934 Bacteria 2134
280 Ga0207709_10000017 3300025935 Bacteria 470753
281 Ga0207709_10001732 3300025935 Bacteria 14688
282 Ga0207709_10012319 3300025935 Unclassified 4712
283 Ga0207670_10000756 3300025936 Bacteria 16999
284 Ga0207670_10134188 3300025936 Bacteria 1818
285 Ga0207665_10000002 3300025939 Bacteria 267895
286 Ga0207665_10096970 3300025939 Bacteria 2052
287 Ga0207691_10127115 3300025940 Bacteria 2254
288 Ga0207711_10007889 3300025941 Bacteria 8903
289 Ga0207711_10051152 3300025941 Bacteria 3538
290 Ga0207689_10180526 3300025942 Bacteria 1740
291 Ga0207679_10051087 3300025945 Bacteria 3025
292 Ga0207679_10153115 3300025945 Bacteria 1879
293 Ga0207651_10009797 3300025960 Bacteria 5270
294 Ga0207712_10000259 3300025961 Bacteria 51318
295 Ga0207668_10002115 3300025972 Bacteria 11592
296 Ga0207640_10122374 3300025981 Bacteria 1867
297 Ga0207677_10028133 3300026023 Bacteria 3550
298 Ga0207703_10000158 3300026035 Bacteria 78397
299 Ga0207703_10216658 3300026035 Bacteria 1710
300 Ga0207639_10062044 3300026041 Unclassified 2889
301 Ga0207708_10000471 3300026075 Bacteria 31120
302 Ga0207708_10001411 3300026075 Bacteria 18027
303 Ga0207708_10010429 3300026075 Bacteria 6898
304 Ga0207708_10086213 3300026075 Unclassified 2416
305 Ga0207702_10235083 3300026078 Bacteria 1714
306 Ga0207641_10029595 3300026088 Bacteria 4530
307 Ga0207648_10130198 3300026089 Bacteria 2215
308 Ga0207648_10139359 3300026089 Bacteria 2137
309 Ga0207676_10003650 3300026095 Bacteria 10884
310 Ga0207676_10013313 3300026095 Bacteria 5908
311 Ga0207676_10018621 3300026095 Bacteria 5053
312 Ga0207674_10000058 3300026116 Bacteria 113012
313 Ga0207674_10041265 3300026116 Bacteria 4774
314 Ga0207674_10165161 3300026116 Bacteria 2168
315 Ga0207675_100018476 3300026118 Bacteria 6503
316 Ga0207675_100262242 3300026118 Bacteria 1675
317 Ga0207675_100347960 3300026118 Bacteria 1452
318 Ga0207428_10011055 3300027907 Bacteria 8020
319 Ga0207428_10074568 3300027907 Bacteria 2661
320 Ga0207428_10147730 3300027907 Bacteria 1791
321 Ga0268264_10040432 3300028381 Bacteria 3853
322 Ga0268264_10047490 3300028381 Bacteria 3569
323 Ga0265327_10000041 3300031251 Bacteria 288506
324 Ga0307408_100002360 3300031548 Bacteria 13325
325 Ga0307408_100099971 3300031548 Bacteria 2208
326 Ga0307405_10064398 3300031731 Bacteria 2330
327 Ga0307406_10001697 3300031901 Bacteria 12099
328 Ga0307407_10018518 3300031903 Bacteria 3524
329 Ga0307412_10008136 3300031911 Bacteria 5975
330 Ga0307409_100065304 3300031995 Bacteria 2863
331 Ga0307416_100172520 3300032002 Bacteria 2015
332 Ga0307411_10083895 3300032005 Bacteria 2202
333 Ga0307415_100060683 3300032126 Bacteria 2614
334 Ga0373951_0000704 3300035091 Bacteria 9185
335 Ga0373937_0136583 3300036401 Bacteria 2293
336 Ga0439458_0021101 3300042157 Bacteria 1506
337 Ga0439464_0015452 3300042439 Bacteria 2060
338 Ga0453683_0011215 3300044673 Bacteria 5919
339 Ga0453683_0040331 3300044673 Bacteria 2932
340 Ga0451576_0009797 3300045051 Bacteria 11073
341 Ga0495639_0087801 3300046475 Bacteria 1456
342 Ga0495635_0197913 3300046663 Bacteria 1364
343 Ga0495658_0066334 3300046683 Unclassified 2085
344 Ga0496106_0000699 3300048909 Bacteria 24103
345 Ga0496106_0040904 3300048909 Bacteria 3473
346 Ga0496106_0049848 3300048909 Bacteria 3155
347 Ga0496107_0074985 3300048910 Bacteria 2462
348 Ga0496109_0000068 3300048912 Bacteria 110206
349 Ga0501298_003668 3300049521 Bacteria 2390
350 Ga0501298_017138 3300049521 Bacteria 1320
351 Ga0501038_0007479 3300049574 Bacteria 10078
352 Ga0501040_0142368 3300049576 Bacteria 1690
353 Ga0501202_004137 3300049652 Bacteria 2528
354 Ga0501202_007745 3300049652 Bacteria 1946
355 Ga0501217_008599 3300049661 Bacteria 2209
356 Ga0501223_012156 3300049663 Bacteria 1724
357 Ga0501238_004433 3300049671 Bacteria 1756
358 Ga0501257_009145 3300049686 Bacteria 2233
359 Ga0501225_0001898 3300049705 Bacteria 6558
360 Ga0501225_0005299 3300049705 Bacteria 3790
361 Ga0501225_0014429 3300049705 Bacteria 2206
362 nmdc:mga05p37_13047_c1 3300050507 Bacteria 9943
363 nmdc:mga05p37_1311_c1 3300050507 Bacteria 28942
364 nmdc:mga05p37_327289_c1 3300050507 Bacteria 1811
365 nmdc:mga05p37_4069_c1 3300050507 Bacteria 17094
366 nmdc:mga05p37_74_c1 3300050507 Bacteria 87063
367 nmdc:mga09592_1548_c1 3300050508 Bacteria 18478
368 nmdc:mga0qj67_18202_c1 3300050509 Bacteria 5352
369 nmdc:mga06r32_146_c1 3300050510 Bacteria 53243
370 nmdc:mga06r32_51317_c1 3300050510 Bacteria 3947
371 nmdc:mga08y16_167263_c1 3300050511 Bacteria 2284
372 nmdc:mga08y16_373_c1 3300050511 Bacteria 40656
373 nmdc:mga08y16_5499_c1 3300050511 Bacteria 13248
374 nmdc:mga0n895_123203_c1 3300050512 Bacteria 2614
375 nmdc:mga0n895_151149_c1 3300050512 Bacteria 2352
376 nmdc:mga0n895_69474_c1 3300050512 Bacteria 3490
377 nmdc:mga0rr50_3567_c1 3300050513 Bacteria 8989
378 nmdc:mga08x19_222220_c1 3300050514 Bacteria 1298
379 nmdc:mga08x19_3501_c1 3300050514 Bacteria 9341
380 nmdc:mga08x19_7_c1 3300050514 Bacteria 437351
381 nmdc:mga08x19_9_c1 3300050514 Bacteria 418852
382 nmdc:mga0a205_127484_c1 3300050515 Bacteria 2445
383 nmdc:mga0a205_141398_c1 3300050515 Bacteria 2307
384 nmdc:mga0a205_228595_c1 3300050515 Bacteria 1744
385 nmdc:mga0a205_285200_c1 3300050515 Bacteria 1526
386 nmdc:mga0a205_351877_c1 3300050515 Bacteria 1340
387 nmdc:mga0a205_59534_c1 3300050515 Bacteria 3689

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031251 Ga0265327_10000041 Ga0265327_10000041132 391
2 3300005440 Ga0070705_100076995 Ga0070705_1000769952 400
3 3300005985 Ga0081539_10000481 Ga0081539_1000048168 401
4 3300046663 Ga0495635_0197913 Ga0495635_0197913_39_1265 403
5 3300005331 Ga0070670_100171350 Ga0070670_1001713502 406
6 3300025925 Ga0207650_10102415 Ga0207650_101024152 406
7 3300006844 Ga0075428_100000734 Ga0075428_1000007349 407
8 3300006846 Ga0075430_100025248 Ga0075430_1000252484 407
9 3300006847 Ga0075431_100005971 Ga0075431_1000059712 407
10 3300006880 Ga0075429_100012443 Ga0075429_1000124432 407
11 3300009094 Ga0111539_10000405 Ga0111539_1000040511 407
12 3300009147 Ga0114129_10001476 Ga0114129_100014768 407
13 3300027907 Ga0207428_10011055 Ga0207428_100110554 407
14 3300050507 nmdc:mga05p37_74_c1 nmdc:mga05p37_74_c1_64220_65551 407
15 3300050508 nmdc:mga09592_1548_c1 nmdc:mga09592_1548_c1_16089_17420 407
16 3300050509 nmdc:mga0qj67_18202_c1 nmdc:mga0qj67_18202_c1_2139_3470 407
17 3300050510 nmdc:mga06r32_146_c1 nmdc:mga06r32_146_c1_27764_29095 407
18 3300050511 nmdc:mga08y16_373_c1 nmdc:mga08y16_373_c1_35012_36343 407
19 3300046683 Ga0495658_0066334 Ga0495658_0066334_740_2017 408
20 3300049652 Ga0501202_007745 Ga0501202_007745_647_1903 409
21 3300049671 Ga0501238_004433 Ga0501238_004433_46_1302 409
22 3300049705 Ga0501225_0014429 Ga0501225_0014429_14_1270 409
23 3300050514 nmdc:mga08x19_222220_c1 nmdc:mga08x19_222220_c1_13_1263 411
24 3300050515 nmdc:mga0a205_285200_c1 nmdc:mga0a205_285200_c1_242_1492 411
25 3300050515 nmdc:mga0a205_351877_c1 nmdc:mga0a205_351877_c1_65_1315 411
26 3300009553 Ga0105249_10038428 Ga0105249_100384284 412
27 3300014326 Ga0157380_10156230 Ga0157380_101562302 412
28 3300025912 Ga0207707_10021764 Ga0207707_100217644 412
29 3300049574 Ga0501038_0007479 Ga0501038_0007479_1782_3065 412
30 3300005295 Ga0065707_10141210 Ga0065707_101412101 416
31 3300006880 Ga0075429_100265842 Ga0075429_1002658421 416
32 3300049521 Ga0501298_017138 Ga0501298_017138_16_1284 416
33 3300025923 Ga0207681_10000966 Ga0207681_1000096616 418
34 3300005547 Ga0070693_100018368 Ga0070693_1000183682 419
35 3300031903 Ga0307407_10018518 Ga0307407_100185182 419
36 3300031995 Ga0307409_100065304 Ga0307409_1000653042 419
37 3300032002 Ga0307416_100172520 Ga0307416_1001725202 419
38 3300049521 Ga0501298_003668 Ga0501298_003668_578_1855 419
39 3300049705 Ga0501225_0005299 Ga0501225_0005299_1972_3249 419
40 3300005444 Ga0070694_100010531 Ga0070694_1000105318 422
41 3300005467 Ga0070706_100083419 Ga0070706_1000834192 422
42 3300005471 Ga0070698_100023480 Ga0070698_1000234802 422
43 3300005536 Ga0070697_100084765 Ga0070697_1000847652 422
44 3300005549 Ga0070704_100064247 Ga0070704_1000642472 422
45 3300026118 Ga0207675_100262242 Ga0207675_1002622421 422
46 3300050514 nmdc:mga08x19_3501_c1 nmdc:mga08x19_3501_c1_6192_7478 422
47 3300009147 Ga0114129_10412478 Ga0114129_104124782 423
48 3300005444 Ga0070694_100084736 Ga0070694_1000847362 424
49 3300005468 Ga0070707_100001523 Ga0070707_10000152312 424
50 3300006852 Ga0075433_10164164 Ga0075433_101641642 424
51 3300006871 Ga0075434_100422203 Ga0075434_1004222031 424
52 3300025922 Ga0207646_10001776 Ga0207646_100017768 424
53 3300009174 Ga0105241_10045843 Ga0105241_100458432 426
54 3300013100 Ga0157373_10027431 Ga0157373_100274312 426
55 3300013102 Ga0157371_10133952 Ga0157371_101339521 426
56 3300013306 Ga0163162_10155501 Ga0163162_101555012 426
57 3300025922 Ga0207646_10280537 Ga0207646_102805372 426
58 3300044673 Ga0453683_0040331 Ga0453683_0040331_941_2272 426
59 3300048912 Ga0496109_0000068 Ga0496109_0000068_36716_38011 426
60 3300005355 Ga0070671_100002475 Ga0070671_10000247510 427
61 3300005331 Ga0070670_100093181 Ga0070670_1000931812 431
62 3300005334 Ga0068869_100026448 Ga0068869_1000264482 431
63 3300006931 Ga0097620_100282070 Ga0097620_1002820702 431
64 3300025925 Ga0207650_10040448 Ga0207650_100404482 431
65 3300005843 Ga0068860_100035513 Ga0068860_1000355133 432
66 3300028381 Ga0268264_10040432 Ga0268264_100404323 432
67 3300005293 Ga0065715_10008422 Ga0065715_100084221 433
68 3300005334 Ga0068869_100051828 Ga0068869_1000518282 433
69 3300005335 Ga0070666_10127345 Ga0070666_101273452 433
70 3300005336 Ga0070680_100002231 Ga0070680_1000022314 433
71 3300005338 Ga0068868_100115148 Ga0068868_1001151482 433
72 3300005458 Ga0070681_10000053 Ga0070681_1000005350 433
73 3300005459 Ga0068867_100174481 Ga0068867_1001744811 433
74 3300005530 Ga0070679_100000030 Ga0070679_10000003075 433
75 3300005618 Ga0068864_100014272 Ga0068864_1000142723 433
76 3300005718 Ga0068866_10069757 Ga0068866_100697571 433
77 3300005842 Ga0068858_100056354 Ga0068858_1000563542 433
78 3300006237 Ga0097621_100017050 Ga0097621_1000170507 433
79 3300006871 Ga0075434_100097509 Ga0075434_1000975092 433
80 3300009176 Ga0105242_10136008 Ga0105242_101360082 433
81 3300009177 Ga0105248_10001987 Ga0105248_100019874 433
82 3300013297 Ga0157378_10006907 Ga0157378_100069077 433
83 3300013306 Ga0163162_10194714 Ga0163162_101947141 433
84 3300013308 Ga0157375_10213712 Ga0157375_102137121 433
85 3300025903 Ga0207680_10089226 Ga0207680_100892261 433
86 3300025912 Ga0207707_10000063 Ga0207707_1000006373 433
87 3300025917 Ga0207660_10004704 Ga0207660_100047044 433
88 3300025921 Ga0207652_10000091 Ga0207652_1000009130 433
89 3300025941 Ga0207711_10007889 Ga0207711_100078896 433
90 3300025942 Ga0207689_10180526 Ga0207689_101805261 433
91 3300026023 Ga0207677_10028133 Ga0207677_100281331 433
92 3300026035 Ga0207703_10216658 Ga0207703_102166582 433
93 3300026089 Ga0207648_10130198 Ga0207648_101301981 433
94 3300026095 Ga0207676_10013313 Ga0207676_100133132 433
95 3300036401 Ga0373937_0136583 Ga0373937_0136583_400_1731 433
96 3300050512 nmdc:mga0n895_123203_c1 nmdc:mga0n895_123203_c1_1037_2383 433
97 3300005295 Ga0065707_10147420 Ga0065707_101474201 434
98 3300005330 Ga0070690_100004956 Ga0070690_1000049564 434
99 3300005544 Ga0070686_100003241 Ga0070686_1000032412 434
100 3300005614 Ga0068856_100079417 Ga0068856_1000794171 434
101 3300005719 Ga0068861_100071239 Ga0068861_1000712392 434
102 3300009147 Ga0114129_10001970 Ga0114129_1000197023 434
103 3300009147 Ga0114129_10459359 Ga0114129_104593591 434
104 3300026078 Ga0207702_10235083 Ga0207702_102350831 434
105 3300026118 Ga0207675_100347960 Ga0207675_1003479601 434
106 3300005288 Ga0065714_10064425 Ga0065714_10064425107 435
107 3300005290 Ga0065712_10067727 Ga0065712_10067727107 435
108 3300005293 Ga0065715_10090321 Ga0065715_100903212 435
109 3300005617 Ga0068859_100025911 Ga0068859_1000259112 435
110 3300006844 Ga0075428_100082736 Ga0075428_1000827362 435
111 3300006852 Ga0075433_10090835 Ga0075433_100908352 435
112 3300006871 Ga0075434_100179411 Ga0075434_1001794112 435
113 3300006931 Ga0097620_100025911 Ga0097620_1000259116 435
114 3300009147 Ga0114129_10357139 Ga0114129_103571392 435
115 3300050507 nmdc:mga05p37_1311_c1 nmdc:mga05p37_1311_c1_11014_12396 435
116 3300050512 nmdc:mga0n895_69474_c1 nmdc:mga0n895_69474_c1_697_2022 435
117 3300050515 nmdc:mga0a205_141398_c1 nmdc:mga0a205_141398_c1_46_1371 435
118 3300005340 Ga0070689_100002015 Ga0070689_10000201512 436
119 3300005543 Ga0070672_100148631 Ga0070672_1001486312 436
120 3300005617 Ga0068859_100101607 Ga0068859_1001016072 436
121 3300005618 Ga0068864_100027262 Ga0068864_1000272623 436
122 3300006852 Ga0075433_10016589 Ga0075433_100165892 436
123 3300006931 Ga0097620_100101606 Ga0097620_1001016062 436
124 3300009147 Ga0114129_10029655 Ga0114129_1002965511 436
125 3300009147 Ga0114129_10236112 Ga0114129_102361122 436
126 3300025908 Ga0207643_10022506 Ga0207643_100225062 436
127 3300025922 Ga0207646_10010198 Ga0207646_100101986 436
128 3300025925 Ga0207650_10119043 Ga0207650_101190432 436
129 3300025936 Ga0207670_10000756 Ga0207670_100007564 436
130 3300025940 Ga0207691_10127115 Ga0207691_101271152 436
131 3300026088 Ga0207641_10029595 Ga0207641_100295952 436
132 3300026095 Ga0207676_10003650 Ga0207676_1000365010 436
133 3300026116 Ga0207674_10165161 Ga0207674_101651612 436
134 3300031548 Ga0307408_100002360 Ga0307408_1000023602 436
135 3300031548 Ga0307408_100099971 Ga0307408_1000999712 436
136 3300031731 Ga0307405_10064398 Ga0307405_100643982 436
137 3300031901 Ga0307406_10001697 Ga0307406_100016972 436
138 3300031911 Ga0307412_10008136 Ga0307412_100081364 436
139 3300032005 Ga0307411_10083895 Ga0307411_100838952 436
140 3300032126 Ga0307415_100060683 Ga0307415_1000606832 436
141 3300049652 Ga0501202_004137 Ga0501202_004137_195_1532 436
142 3300049663 Ga0501223_012156 Ga0501223_012156_125_1462 436
143 3300049686 Ga0501257_009145 Ga0501257_009145_740_2092 436
144 3300049705 Ga0501225_0001898 Ga0501225_0001898_4629_5966 436
145 3300050507 nmdc:mga05p37_13047_c1 nmdc:mga05p37_13047_c1_8209_9546 436
146 3300050507 nmdc:mga05p37_327289_c1 nmdc:mga05p37_327289_c1_94_1434 436
147 3300003203 JGI25406J46586_10034588 JGI25406J46586_100345881 437
148 3300005334 Ga0068869_100156395 Ga0068869_1001563951 437
149 3300005336 Ga0070680_100040815 Ga0070680_1000408153 437
150 3300005344 Ga0070661_100015168 Ga0070661_1000151683 437
151 3300005345 Ga0070692_10008215 Ga0070692_100082152 437
152 3300005364 Ga0070673_100206313 Ga0070673_1002063132 437
153 3300005434 Ga0070709_10000172 Ga0070709_100001725 437
154 3300005439 Ga0070711_100000001 Ga0070711_10000000184 437
155 3300005440 Ga0070705_100003338 Ga0070705_1000033382 437
156 3300005444 Ga0070694_100004027 Ga0070694_1000040273 437
157 3300005458 Ga0070681_10045566 Ga0070681_100455664 437
158 3300005539 Ga0068853_100060375 Ga0068853_1000603752 437
159 3300005564 Ga0070664_100000993 Ga0070664_1000009936 437
160 3300005577 Ga0068857_100075692 Ga0068857_1000756921 437
161 3300005617 Ga0068859_100012132 Ga0068859_1000121322 437
162 3300005617 Ga0068859_100063531 Ga0068859_1000635312 437
163 3300005719 Ga0068861_100069250 Ga0068861_1000692501 437
164 3300005834 Ga0068851_10001956 Ga0068851_100019567 437
165 3300005985 Ga0081539_10083093 Ga0081539_100830932 437
166 3300006358 Ga0068871_100087484 Ga0068871_1000874841 437
167 3300006871 Ga0075434_100062809 Ga0075434_1000628092 437
168 3300006914 Ga0075436_100004884 Ga0075436_1000048842 437
169 3300006914 Ga0075436_100017679 Ga0075436_1000176792 437
170 3300006931 Ga0097620_100012131 Ga0097620_1000121312 437
171 3300006931 Ga0097620_100063535 Ga0097620_1000635352 437
172 3300009093 Ga0105240_10122081 Ga0105240_101220812 437
173 3300009094 Ga0111539_10236915 Ga0111539_102369152 437
174 3300009545 Ga0105237_10000521 Ga0105237_1000052126 437
175 3300013100 Ga0157373_10021953 Ga0157373_100219532 437
176 3300013306 Ga0163162_10008501 Ga0163162_100085013 437
177 3300013307 Ga0157372_10034510 Ga0157372_100345104 437
178 3300013308 Ga0157375_10001282 Ga0157375_100012825 437
179 3300013308 Ga0157375_10291866 Ga0157375_102918661 437
180 3300014325 Ga0163163_10022736 Ga0163163_100227365 437
181 3300014325 Ga0163163_10139974 Ga0163163_101399742 437
182 3300014326 Ga0157380_10003764 Ga0157380_100037648 437
183 3300014968 Ga0157379_10050448 Ga0157379_100504483 437
184 3300025885 Ga0207653_10001368 Ga0207653_100013683 437
185 3300025900 Ga0207710_10091037 Ga0207710_100910371 437
186 3300025906 Ga0207699_10000135 Ga0207699_1000013527 437
187 3300025914 Ga0207671_10002243 Ga0207671_1000224318 437
188 3300025916 Ga0207663_10000001 Ga0207663_1000000143 437
189 3300025917 Ga0207660_10071530 Ga0207660_100715302 437
190 3300025932 Ga0207690_10217111 Ga0207690_102171111 437
191 3300025941 Ga0207711_10051152 Ga0207711_100511523 437
192 3300025945 Ga0207679_10051087 Ga0207679_100510871 437
193 3300025945 Ga0207679_10153115 Ga0207679_101531151 437
194 3300026075 Ga0207708_10001411 Ga0207708_100014116 437
195 3300026089 Ga0207648_10139359 Ga0207648_101393592 437
196 3300026095 Ga0207676_10018621 Ga0207676_100186215 437
197 3300026116 Ga0207674_10000058 Ga0207674_10000058104 437
198 3300027907 Ga0207428_10074568 Ga0207428_100745681 437
199 3300048909 Ga0496106_0040904 Ga0496106_0040904_1564_2904 437
200 3300048909 Ga0496106_0049848 Ga0496106_0049848_730_2061 437
201 3300048910 Ga0496107_0074985 Ga0496107_0074985_688_2019 437
202 3300049661 Ga0501217_008599 Ga0501217_008599_711_2042 437
203 3300050511 nmdc:mga08y16_167263_c1 nmdc:mga08y16_167263_c1_773_2104 437
204 3300050512 nmdc:mga0n895_151149_c1 nmdc:mga0n895_151149_c1_221_1597 437
205 3300050514 nmdc:mga08x19_7_c1 nmdc:mga08x19_7_c1_314468_315796 437
206 3300050515 nmdc:mga0a205_228595_c1 nmdc:mga0a205_228595_c1_159_1535 437
207 3300002459 JGI24751J29686_10000003 JGI24751J29686_1000000344 438
208 3300005290 Ga0065712_10076150 Ga0065712_100761502 438
209 3300005330 Ga0070690_100010268 Ga0070690_1000102683 438
210 3300005331 Ga0070670_100000832 Ga0070670_1000008325 438
211 3300005406 Ga0070703_10000267 Ga0070703_1000026718 438
212 3300005440 Ga0070705_100000011 Ga0070705_10000001112 438
213 3300005444 Ga0070694_100028099 Ga0070694_1000280991 438
214 3300005457 Ga0070662_100035420 Ga0070662_1000354201 438
215 3300005467 Ga0070706_100000120 Ga0070706_1000001208 438
216 3300005467 Ga0070706_100036769 Ga0070706_1000367691 438
217 3300005471 Ga0070698_100018189 Ga0070698_1000181895 438
218 3300005518 Ga0070699_100000013 Ga0070699_100000013167 438
219 3300005518 Ga0070699_100019870 Ga0070699_1000198703 438
220 3300005546 Ga0070696_100000142 Ga0070696_10000014229 438
221 3300005547 Ga0070693_100005167 Ga0070693_1000051674 438
222 3300005549 Ga0070704_100208471 Ga0070704_1002084711 438
223 3300005577 Ga0068857_100114492 Ga0068857_1001144922 438
224 3300005578 Ga0068854_100149786 Ga0068854_1001497861 438
225 3300005844 Ga0068862_100022736 Ga0068862_1000227365 438
226 3300005937 Ga0081455_10064380 Ga0081455_100643801 438
227 3300006852 Ga0075433_10123218 Ga0075433_101232183 438
228 3300009101 Ga0105247_10022027 Ga0105247_100220272 438
229 3300009147 Ga0114129_10104616 Ga0114129_101046162 438
230 3300009147 Ga0114129_10179277 Ga0114129_101792772 438
231 3300009148 Ga0105243_10002586 Ga0105243_100025864 438
232 3300009551 Ga0105238_10014544 Ga0105238_100145443 438
233 3300009553 Ga0105249_10003117 Ga0105249_100031175 438
234 3300014325 Ga0163163_10002306 Ga0163163_100023067 438
235 3300025885 Ga0207653_10000133 Ga0207653_1000013345 438
236 3300025900 Ga0207710_10000808 Ga0207710_100008082 438
237 3300025910 Ga0207684_10000075 Ga0207684_1000007572 438
238 3300025910 Ga0207684_10044488 Ga0207684_100444883 438
239 3300025923 Ga0207681_10010828 Ga0207681_100108285 438
240 3300025923 Ga0207681_10056980 Ga0207681_100569802 438
241 3300025924 Ga0207694_10008843 Ga0207694_100088432 438
242 3300025925 Ga0207650_10000007 Ga0207650_10000007287 438
243 3300025933 Ga0207706_10152066 Ga0207706_101520662 438
244 3300025934 Ga0207686_10079652 Ga0207686_100796521 438
245 3300025935 Ga0207709_10001732 Ga0207709_100017324 438
246 3300025981 Ga0207640_10122374 Ga0207640_101223742 438
247 3300026116 Ga0207674_10041265 Ga0207674_100412653 438
248 3300049576 Ga0501040_0142368 Ga0501040_0142368_72_1409 438
249 3300050507 nmdc:mga05p37_4069_c1 nmdc:mga05p37_4069_c1_13811_15145 438
250 3300050510 nmdc:mga06r32_51317_c1 nmdc:mga06r32_51317_c1_2024_3361 438
251 3300050511 nmdc:mga08y16_5499_c1 nmdc:mga08y16_5499_c1_8720_10057 438
252 3300005547 Ga0070693_100053955 Ga0070693_1000539552 439
253 3300006852 Ga0075433_10117750 Ga0075433_101177503 439
254 3300014745 Ga0157377_10031395 Ga0157377_100313952 439
255 3300025910 Ga0207684_10000053 Ga0207684_1000005382 439
256 3300042157 Ga0439458_0021101 Ga0439458_0021101_79_1416 439
257 3300044673 Ga0453683_0011215 Ga0453683_0011215_1283_2638 439
258 3300045051 Ga0451576_0009797 Ga0451576_0009797_9371_10726 439
259 3300050515 nmdc:mga0a205_59534_c1 nmdc:mga0a205_59534_c1_645_2003 439
260 3300005293 Ga0065715_10012850 Ga0065715_100128502 440
261 3300005347 Ga0070668_100008204 Ga0070668_1000082045 440
262 3300005441 Ga0070700_100000248 Ga0070700_1000002487 440
263 3300005441 Ga0070700_100052342 Ga0070700_1000523422 440
264 3300005518 Ga0070699_100001084 Ga0070699_1000010845 440
265 3300005547 Ga0070693_100019543 Ga0070693_1000195432 440
266 3300005843 Ga0068860_100081740 Ga0068860_1000817402 440
267 3300006237 Ga0097621_100007343 Ga0097621_1000073431 440
268 3300006358 Ga0068871_100010860 Ga0068871_1000108602 440
269 3300006852 Ga0075433_10169261 Ga0075433_101692612 440
270 3300009101 Ga0105247_10070983 Ga0105247_100709832 440
271 3300009553 Ga0105249_10000201 Ga0105249_1000020147 440
272 3300013306 Ga0163162_10000128 Ga0163162_1000012847 440
273 3300014326 Ga0157380_10005594 Ga0157380_100055948 440
274 3300017792 Ga0163161_10032068 Ga0163161_100320682 440
275 3300025904 Ga0207647_10008624 Ga0207647_100086248 440
276 3300025960 Ga0207651_10009797 Ga0207651_100097972 440
277 3300025961 Ga0207712_10000259 Ga0207712_1000025916 440
278 3300025972 Ga0207668_10002115 Ga0207668_1000211513 440
279 3300026041 Ga0207639_10062044 Ga0207639_100620442 440
280 3300026075 Ga0207708_10000471 Ga0207708_100004716 440
281 3300026075 Ga0207708_10086213 Ga0207708_100862132 440
282 3300035091 Ga0373951_0000704 Ga0373951_0000704_1125_2474 440
283 3300046475 Ga0495639_0087801 Ga0495639_0087801_57_1391 440
284 3300005337 Ga0070682_100000210 Ga0070682_10000021012 441
285 3300006173 Ga0070716_100000001 Ga0070716_100000001306 441
286 3300025939 Ga0207665_10000002 Ga0207665_10000002178 441
287 3300005445 Ga0070708_100000042 Ga0070708_10000004225 442
288 3300005468 Ga0070707_100241925 Ga0070707_1002419251 442
289 3300005471 Ga0070698_100015537 Ga0070698_1000155375 442
290 3300005518 Ga0070699_100003703 Ga0070699_1000037036 442
291 3300005536 Ga0070697_100011445 Ga0070697_1000114459 442
292 3300006914 Ga0075436_100000002 Ga0075436_10000000224 442
293 3300007076 Ga0075435_100000689 Ga0075435_1000006893 442
294 3300025922 Ga0207646_10083499 Ga0207646_100834992 442
295 3300050513 nmdc:mga0rr50_3567_c1 nmdc:mga0rr50_3567_c1_6693_8051 442
296 3300050514 nmdc:mga08x19_9_c1 nmdc:mga08x19_9_c1_387417_388775 442
297 3300005295 Ga0065707_10005134 Ga0065707_100051342 443
298 3300005467 Ga0070706_100006976 Ga0070706_1000069765 443
299 3300005471 Ga0070698_100076457 Ga0070698_1000764573 443
300 3300005518 Ga0070699_100045879 Ga0070699_1000458794 443
301 3300005518 Ga0070699_100146622 Ga0070699_1001466221 443
302 3300005536 Ga0070697_100001859 Ga0070697_1000018591 443
303 3300005536 Ga0070697_100002202 Ga0070697_1000022029 443
304 3300005536 Ga0070697_100064289 Ga0070697_1000642892 443
305 3300005546 Ga0070696_100097777 Ga0070696_1000977772 443
306 3300005615 Ga0070702_100007963 Ga0070702_1000079632 443
307 3300005617 Ga0068859_100081413 Ga0068859_1000814132 443
308 3300005841 Ga0068863_100029208 Ga0068863_1000292082 443
309 3300005841 Ga0068863_100148694 Ga0068863_1001486942 443
310 3300005842 Ga0068858_100036853 Ga0068858_1000368532 443
311 3300005843 Ga0068860_100025612 Ga0068860_1000256123 443
312 3300006852 Ga0075433_10081714 Ga0075433_100817142 443
313 3300006931 Ga0097620_100081410 Ga0097620_1000814102 443
314 3300009094 Ga0111539_10002073 Ga0111539_100020734 443
315 3300009101 Ga0105247_10010710 Ga0105247_100107102 443
316 3300009148 Ga0105243_10135246 Ga0105243_101352462 443
317 3300013306 Ga0163162_10003297 Ga0163162_100032974 443
318 3300014325 Ga0163163_10023389 Ga0163163_100233895 443
319 3300025910 Ga0207684_10007834 Ga0207684_100078345 443
320 3300025936 Ga0207670_10134188 Ga0207670_101341881 443
321 3300028381 Ga0268264_10047490 Ga0268264_100474902 443
322 3300042439 Ga0439464_0015452 Ga0439464_0015452_353_1828 443
323 3300050515 nmdc:mga0a205_127484_c1 nmdc:mga0a205_127484_c1_616_2004 443
324 3300025910 Ga0207684_10026162 Ga0207684_100261623 444
325 3300025910 Ga0207684_10076008 Ga0207684_100760083 444
326 3300005331 Ga0070670_100000223 Ga0070670_10000022311 445
327 3300005353 Ga0070669_100002272 Ga0070669_1000022723 445
328 3300025925 Ga0207650_10005207 Ga0207650_100052075 445
329 3300005445 Ga0070708_100020297 Ga0070708_1000202973 446
330 3300025934 Ga0207686_10000127 Ga0207686_1000012749 447
331 3300005295 Ga0065707_10132970 Ga0065707_101329702 448
332 3300005471 Ga0070698_100000593 Ga0070698_10000059311 448
333 3300005617 Ga0068859_100012145 Ga0068859_1000121458 448
334 3300005844 Ga0068862_100056733 Ga0068862_1000567335 448
335 3300006844 Ga0075428_100106388 Ga0075428_1001063885 448
336 3300006880 Ga0075429_100188636 Ga0075429_1001886362 448
337 3300006931 Ga0097620_100012145 Ga0097620_1000121458 448
338 3300009148 Ga0105243_10001856 Ga0105243_100018562 448
339 3300009176 Ga0105242_10002534 Ga0105242_100025343 448
340 3300009177 Ga0105248_10170707 Ga0105248_101707072 448
341 3300009553 Ga0105249_10033991 Ga0105249_100339911 448
342 3300013297 Ga0157378_10000003 Ga0157378_10000003101 448
343 3300013308 Ga0157375_10004533 Ga0157375_100045338 448
344 3300025934 Ga0207686_10001296 Ga0207686_1000129613 448
345 3300025935 Ga0207709_10012319 Ga0207709_100123192 448
346 3300027907 Ga0207428_10147730 Ga0207428_101477301 448
347 3300048909 Ga0496106_0000699 Ga0496106_0000699_1591_2994 448
348 3300005440 Ga0070705_100034495 Ga0070705_1000344952 449
349 3300009147 Ga0114129_10110930 Ga0114129_101109304 449
350 3300009147 Ga0114129_10168975 Ga0114129_101689751 449
351 3300009148 Ga0105243_10000037 Ga0105243_1000003778 449
352 3300009176 Ga0105242_10000276 Ga0105242_1000027634 449
353 3300025934 Ga0207686_10000003 Ga0207686_10000003265 449
354 3300025935 Ga0207709_10000017 Ga0207709_10000017324 449
355 3300005365 Ga0070688_100072480 Ga0070688_1000724802 450
356 3300005406 Ga0070703_10000014 Ga0070703_1000001479 450
357 3300005441 Ga0070700_100006305 Ga0070700_1000063053 450
358 3300006163 Ga0070715_10000024 Ga0070715_1000002489 450
359 3300025885 Ga0207653_10000307 Ga0207653_1000030726 450
360 3300025905 Ga0207685_10000018 Ga0207685_1000001885 450
361 3300025939 Ga0207665_10096970 Ga0207665_100969703 450
362 3300026075 Ga0207708_10010429 Ga0207708_100104295 450
363 3300005444 Ga0070694_100007275 Ga0070694_1000072752 451
364 3300013297 Ga0157378_10041609 Ga0157378_100416092 451
365 3300005549 Ga0070704_100052919 Ga0070704_1000529193 453
366 3300005843 Ga0068860_100197071 Ga0068860_1001970712 453
367 3300025910 Ga0207684_10014046 Ga0207684_100140464 453
368 3300005328 Ga0070676_10071350 Ga0070676_100713502 454
369 3300005334 Ga0068869_100015163 Ga0068869_1000151633 454
370 3300005468 Ga0070707_100000054 Ga0070707_10000005412 454
371 3300005518 Ga0070699_100038324 Ga0070699_1000383243 454
372 3300005549 Ga0070704_100002716 Ga0070704_1000027162 454
373 3300007265 Ga0099794_10070388 Ga0099794_100703882 454
374 3300013297 Ga0157378_10003542 Ga0157378_100035427 454
375 3300025922 Ga0207646_10000900 Ga0207646_1000090011 454
376 3300025926 Ga0207659_10230710 Ga0207659_102307101 454
377 3300026118 Ga0207675_100018476 Ga0207675_1000184764 454
378 3300002074 JGI24748J21848_1000004 JGI24748J21848_1000004227 466
379 3300002239 JGI24034J26672_10000001 JGI24034J26672_10000001695 466
380 3300005842 Ga0068858_100000005 Ga0068858_10000000544 466
381 3300006871 Ga0075434_100156208 Ga0075434_1001562082 466
382 3300009101 Ga0105247_10000002 Ga0105247_10000002303 466
383 3300009553 Ga0105249_10126065 Ga0105249_101260651 466
384 3300025223 Ga0207672_1000084 Ga0207672_100008410 466
385 3300025900 Ga0207710_10000002 Ga0207710_10000002302 466
386 3300025931 Ga0207644_10000636 Ga0207644_1000063620 466
387 3300026035 Ga0207703_10000158 Ga0207703_1000015841 466

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

90

222

0.96

PF03781

FGE-sulfatase

Sulfatase-modifying factor enzyme 1

247

514

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qki-assembly1.cif.gz_B native structure of egtb from chloracidobacterium thermophilum, a type ii sulfoxide synthase 0.8659 16 466
6qki-assembly1.cif.gz_D native structure of egtb from chloracidobacterium thermophilum, a type ii sulfoxide synthase 0.8611 16 466
6qki-assembly1.cif.gz_A native structure of egtb from chloracidobacterium thermophilum, a type ii sulfoxide synthase 0.8604 16 466
6qki-assembly1.cif.gz_C native structure of egtb from chloracidobacterium thermophilum, a type ii sulfoxide synthase 0.8536 16 466
6qki-assembly1.cif.gz_B native structure of egtb from chloracidobacterium thermophilum, a type ii sulfoxide synthase 0.8471 16 466
ID Description Score Start End Superfamily
af_O69671_154_424_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.8829 172 465 3.90.1580.10
af_O69671_154_424_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.8737 172 465 3.90.1580.10
af_A4I4F2_219_492_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.7678 172 466 3.90.1580.10
af_A4I4F2_219_492_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.7574 172 466 3.90.1580.10
af_O94632_506_773_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.6479 172 466 3.90.1580.10
ID Description Score Start End GO Terms
AF-A0A3B9LDR2-F1-model_v4 Ergothioneine biosynthesis protein EgtB 0.9729 238 331
AF-A0A6B3HW62-F1-model_v4 SUMF1/EgtB/PvdO family nonheme iron enzyme 0.9551 215 307
AF-A0A3B9LDR2-F1-model_v4 Ergothioneine biosynthesis protein EgtB 0.9331 238 331
AF-A0A7J9QR03-F1-model_v4 Ergothioneine biosynthesis protein EgtB 0.9327 171 466
AF-A0A4R4S9Z6-F1-model_v4 Ergothioneine biosynthesis protein EgtB 0.9301 185 331

Feature Viewer

pLDDT pTM Quality
78.42 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map