F430865

General Info

Members Datasets Scaffolds Average Seq Length
387 225 774 330

Family's Representative Sequence

Representative Sequence 3300031507|Ga0307509_10014948|Ga0307509_100149488
Length 359
Sequence VPETAPRFLIGHPRERVHKHPPTMDPVPNVTRADVVAAVRNPLAFIAARWTPDPRTVQRAALAALVMSVVIVVTGGAVRLTGSGLGCPTWPKCTDDSLTTTSAMGFHGAIEFGNRMLTYVLCAAVGWAIIAARSEKPYRRSLTRLGWAQFWIVMSNAILGGIVVLVGLNPYTVAAHFLLSSALIAVATLMWQRSREGDAESKPLVGKAVRQLVWFLVTASVLLIAVGTVVTGAGPHAGDSKEVDRIPIDWETVAKLHAVLAWIVVTLTFALWFVLKAVDAPKGPLDRTRELFLILLSQGVIGYVQYFTNLPEALVAVHMLGSCLVWIGVLRVLLSLRERPDVLADLPGPSAEQSVPTRA

Samples

Sample ID Description Type Environment
1 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
11 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
12 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
13 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
14 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
15 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
16 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
17 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
19 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
20 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
21 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
22 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
23 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
24 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
25 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
26 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
27 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
28 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
29 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
30 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
31 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
32 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
33 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
34 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
35 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
36 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
37 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
38 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
39 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
40 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
41 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
42 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
43 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
44 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
45 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
46 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
47 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
48 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
49 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
50 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
51 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
52 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
53 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
54 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
55 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
56 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
57 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
58 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
59 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
60 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
61 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
62 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
63 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
64 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
65 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
66 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
67 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
68 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
69 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
70 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
71 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
72 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
73 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
74 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
75 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
78 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
79 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
80 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
81 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
82 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
83 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
84 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
85 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
86 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
87 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
88 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
89 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
90 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
91 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
92 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
93 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
94 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
95 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
96 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
97 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
98 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
99 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
100 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
107 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
108 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
109 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
110 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
111 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
112 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
113 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
114 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
115 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
118 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
148 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
149 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
150 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
151 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
152 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
153 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
154 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
155 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
156 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
157 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
158 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
159 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
163 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
164 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
165 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
166 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
167 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
168 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
169 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
170 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
171 2643221647 Streptomyces sp. Root369 Isolate Unclassified
172 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
173 2643221714 Streptomyces sp. Root264 Isolate Unclassified
174 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
175 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
176 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
177 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
178 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
179 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
180 2808606448 Streptomyces sp. 193411 Isolate Unclassified
181 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
182 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
183 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
184 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
185 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
186 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
187 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
188 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
189 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
190 2862574272 Streptomyces sp. AcE210 Isolate Nodule
191 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
192 2867369537 Streptomyces sp. Z26 Isolate Unclassified
193 2867428634 Streptomyces sp. RP5T Isolate Unclassified
194 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
195 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
196 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
197 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
198 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
199 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
200 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
201 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
202 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
203 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
204 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
205 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
206 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
207 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
208 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
209 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
210 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
211 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
212 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
213 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
214 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
215 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
216 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
217 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
218 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
219 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
220 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
221 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
222 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
223 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
224 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
225 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.46
Metatranscriptomes 0.26
Isolates 16.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.65
Nodule 1.03
Rhizoplane 0.52
Rhizosphere 78.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307509_10014948 3300031507 Bacteria 9091
2 JGI25153J46596_10021723 3300003215 Bacteria 2385
3 rootH1_10020104 3300003316 Bacteria 6133
4 rootH1_10020105 3300003316 Bacteria 2567
5 rootH2_10014169 3300003320 Bacteria 5653
6 rootH1_10008253 3300003323 Bacteria 8364
7 rootH1_10027052 3300003323 Bacteria 4661
8 rootH1_10170799 3300003323 Bacteria 2466
9 Ga0006562J51391_1107976 3300003578 Bacteria 2338
10 Ga0068856_100074462 3300005614 Bacteria 3362
11 Ga0081455_10179046 3300005937 Bacteria 1607
12 Ga0081540_1003689 3300005983 Bacteria 12007
13 Ga0099826_10016493 3300006948 Bacteria 5579
14 Ga0105251_10037514 3300009011 Bacteria 2378
15 Ga0105238_10415662 3300009551 Bacteria 1339
16 Ga0182008_10002339 3300014497 Bacteria 11936
17 Ga0182007_10000188 3300015262 Bacteria 41467
18 Ga0183367_1007 3300015688 Bacteria 498079
19 Ga0209758_1005571 3300025297 Bacteria 9586
20 Ga0207713_1036125 3300025735 Bacteria 2123
21 Ga0209371_1024247 3300027312 Bacteria 1414
22 Ga0307517_10007569 3300028786 Bacteria 15786
23 Ga0307517_10053404 3300028786 Bacteria 4024
24 Ga0307515_10012174 3300028794 Bacteria 16221
25 Ga0307515_10053313 3300028794 Bacteria 5971
26 Ga0307511_10014557 3300030521 Bacteria 7651
27 Ga0307512_10009973 3300030522 Bacteria 9101
28 Ga0307512_10024425 3300030522 Bacteria 5378
29 Ga0307512_10047399 3300030522 Bacteria 3493
30 Ga0307513_10030402 3300031456 Bacteria 6136
31 Ga0307513_10035331 3300031456 Bacteria 5593
32 Ga0307509_10007936 3300031507 Bacteria 13696
33 Ga0307509_10035343 3300031507 Bacteria 5485
34 Ga0307509_10062644 3300031507 Bacteria 3921
35 Ga0307508_10021647 3300031616 Bacteria 5846
36 Ga0307508_10041002 3300031616 Bacteria 4155
37 Ga0307514_10025695 3300031649 Bacteria 4764
38 Ga0307514_10027295 3300031649 Bacteria 4612
39 Ga0307514_10062542 3300031649 Bacteria 2830
40 Ga0307516_10011576 3300031730 Bacteria 9573
41 Ga0307516_10154007 3300031730 Bacteria 2056
42 Ga0307518_10182977 3300031838 Bacteria 1414
43 Ga0307507_10032680 3300033179 Bacteria 5425
44 Ga0307510_10021914 3300033180 Bacteria 7432
45 Ga0307510_10033471 3300033180 Bacteria 5771
46 Ga0395898_0013946 3300037466 Bacteria 8259
47 Ga0395898_0062332 3300037466 Bacteria 3621
48 Ga0395898_0083077 3300037466 Bacteria 3087
49 Ga0439436_0000166 3300041404 Bacteria 15489
50 Ga0439436_0000957 3300041404 Bacteria 7968
51 Ga0439436_0014813 3300041404 Bacteria 2349
52 Ga0451789_1170417 3300041443 Bacteria 1610
53 Ga0451853_0588066 3300041512 Bacteria 4291
54 Ga0451853_1353965 3300041512 Bacteria 2105
55 Ga0439433_0001100 3300041999 Bacteria 5509
56 Ga0439448_0025671 3300042005 Bacteria 1849
57 Ga0439448_0062416 3300042005 Bacteria 1233
58 Ga0439449_0001137 3300042007 Bacteria 10443
59 Ga0439449_0032937 3300042007 Bacteria 1931
60 Ga0439450_005556 3300042008 Bacteria 2225
61 Ga0439455_0018131 3300042012 Bacteria 1648
62 Ga0439457_000826 3300042014 Bacteria 9296
63 Ga0439457_002937 3300042014 Bacteria 4738
64 Ga0450894_000154 3300042131 Bacteria 12033
65 Ga0450903_000034 3300042138 Bacteria 27428
66 Ga0439458_0000173 3300042157 Bacteria 14578
67 Ga0466969_0017467 3300044656 Bacteria 3745
68 Ga0466972_0002698 3300044658 Bacteria 8786
69 Ga0466972_0005235 3300044658 Bacteria 6493
70 Ga0466972_0007315 3300044658 Bacteria 5542
71 Ga0466972_0008910 3300044658 Bacteria 5033
72 Ga0466965_0005935 3300044683 Bacteria 5518
73 Ga0466965_0009707 3300044683 Bacteria 4475
74 Ga0466965_0086398 3300044683 Bacteria 1591
75 Ga0466966_0002968 3300044684 Bacteria 11163
76 Ga0466966_0022720 3300044684 Bacteria 4112
77 Ga0466966_0207402 3300044684 Bacteria 1185
78 Ga0466961_0000891 3300044693 Bacteria 18585
79 Ga0466961_0095014 3300044693 Bacteria 1880
80 Ga0466963_0000977 3300044694 Bacteria 14709
81 Ga0466963_0038636 3300044694 Bacteria 3122
82 Ga0466964_0008117 3300044706 Bacteria 3939
83 Ga0466971_0002577 3300044719 Bacteria 7662
84 Ga0466968_0019194 3300044735 Bacteria 2750
85 Ga0466957_0000245 3300044842 Bacteria 26013
86 Ga0466957_0317777 3300044842 Bacteria 1050
87 Ga0466960_0010303 3300044901 Bacteria 3879
88 Ga0466959_0000355 3300045049 Bacteria 27014
89 Ga0466959_0122720 3300045049 Bacteria 1845
90 Ga0466958_0000252 3300045836 Bacteria 20716
91 Ga0466958_0062680 3300045836 Bacteria 2267
92 Ga0466967_0008668 3300045976 Bacteria 7480
93 Ga0466967_0037167 3300045976 Bacteria 4164
94 Ga0466967_0303528 3300045976 Bacteria 1536
95 Ga0495617_015140 3300046452 Bacteria 2616
96 Ga0495627_016332 3300046453 Bacteria 2543
97 Ga0495603_0004047 3300046455 Bacteria 8726
98 Ga0495603_0004835 3300046455 Bacteria 8055
99 Ga0495603_0006850 3300046455 Bacteria 6836
100 Ga0495603_0007228 3300046455 Bacteria 6666
101 Ga0495603_0021989 3300046455 Bacteria 3861
102 Ga0495603_0023421 3300046455 Bacteria 3736
103 Ga0495629_0002991 3300046459 Bacteria 12852
104 Ga0495629_0004681 3300046459 Bacteria 10249
105 Ga0495629_0006101 3300046459 Bacteria 8955
106 Ga0495629_0018376 3300046459 Bacteria 5005
107 Ga0495629_0022077 3300046459 Bacteria 4538
108 Ga0495629_0029714 3300046459 Bacteria 3875
109 Ga0495629_0057125 3300046459 Bacteria 2729
110 Ga0495629_0138902 3300046459 Bacteria 1691
111 Ga0495651_0097848 3300046462 Bacteria 2190
112 Ga0495651_0098551 3300046462 Bacteria 2181
113 Ga0495580_0077186 3300046472 Bacteria 2323
114 Ga0495582_0237163 3300046473 Bacteria 1045
115 Ga0495605_0037894 3300046474 Bacteria 2422
116 Ga0495662_0004999 3300046476 Bacteria 6643
117 Ga0495662_0014275 3300046476 Bacteria 3863
118 Ga0495662_0096155 3300046476 Bacteria 1447
119 Ga0495664_0017922 3300046477 Bacteria 4050
120 Ga0495585_0005237 3300046492 Bacteria 8217
121 Ga0495585_0013952 3300046492 Bacteria 4693
122 Ga0495594_0000550 3300046499 Bacteria 19188
123 Ga0495594_0015711 3300046499 Bacteria 3980
124 Ga0495594_0022266 3300046499 Bacteria 3388
125 Ga0495607_0061063 3300046501 Bacteria 2142
126 Ga0495583_0009989 3300046506 Bacteria 5594
127 Ga0495606_0021644 3300046507 Bacteria 4704
128 Ga0495608_0056339 3300046511 Bacteria 2596
129 Ga0495616_0001635 3300046513 Bacteria 15364
130 Ga0495620_0017076 3300046515 Bacteria 3626
131 Ga0495620_0078361 3300046515 Bacteria 1340
132 Ga0495628_0031736 3300046516 Bacteria 4272
133 Ga0495630_0099549 3300046517 Bacteria 2200
134 Ga0495631_0002123 3300046518 Bacteria 11479
135 Ga0495643_0001512 3300046522 Bacteria 21014
136 Ga0495643_0002349 3300046522 Bacteria 15174
137 Ga0495666_0010212 3300046526 Bacteria 4684
138 Ga0495666_0110566 3300046526 Bacteria 1291
139 Ga0495652_0047140 3300046529 Bacteria 3696
140 Ga0495640_0041924 3300046533 Bacteria 3196
141 Ga0495640_0054259 3300046533 Bacteria 2746
142 Ga0495609_0041029 3300046538 Bacteria 2081
143 Ga0495622_0024924 3300046557 Bacteria 2793
144 Ga0495668_0004214 3300046616 Bacteria 10358
145 Ga0495634_0003316 3300046642 Bacteria 12963
146 Ga0495634_0005469 3300046642 Bacteria 9767
147 Ga0495634_0137655 3300046642 Bacteria 1552
148 Ga0495611_0131434 3300046648 Bacteria 1168
149 Ga0495625_0010300 3300046660 Bacteria 7750
150 Ga0495625_0020149 3300046660 Bacteria 5154
151 Ga0495635_0064203 3300046663 Bacteria 2521
152 Ga0495635_0085229 3300046663 Bacteria 2161
153 Ga0495588_0001136 3300046674 Bacteria 11462
154 Ga0495588_0024329 3300046674 Bacteria 3007
155 Ga0495588_0030468 3300046674 Bacteria 2712
156 Ga0495657_0007375 3300046675 Bacteria 8499
157 Ga0495657_0010479 3300046675 Bacteria 6974
158 Ga0495657_0015065 3300046675 Bacteria 5667
159 Ga0495623_0076460 3300046679 Bacteria 2077
160 Ga0495623_0102180 3300046679 Bacteria 1746
161 Ga0495646_0001970 3300046680 Bacteria 12382
162 Ga0495646_0020576 3300046680 Bacteria 4175
163 Ga0495613_0001173 3300046689 Bacteria 19990
164 Ga0495613_0001204 3300046689 Bacteria 19772
165 Ga0495613_0001595 3300046689 Bacteria 17192
166 Ga0495613_0012146 3300046689 Bacteria 6401
167 Ga0495613_0044780 3300046689 Bacteria 3272
168 Ga0495670_0034956 3300046691 Bacteria 2504
169 Ga0495671_0007634 3300046692 Bacteria 6144
170 Ga0495649_0008060 3300046694 Bacteria 6362
171 Ga0495649_0246666 3300046694 Bacteria 918
172 Ga0495589_0007141 3300046794 Bacteria 5852
173 Ga0495589_0015976 3300046794 Bacteria 3859
174 Ga0495589_0185517 3300046794 Bacteria 985
175 Ga0495600_0012598 3300046809 Bacteria 5292
176 Ga0495600_0051820 3300046809 Bacteria 2679
177 Ga0495660_0020380 3300046810 Bacteria 3801
178 Ga0495660_0042387 3300046810 Bacteria 2515
179 Ga0495581_0241028 3300047315 Bacteria 1057
180 Ga0495604_0002050 3300047317 Bacteria 16275
181 Ga0495604_0003302 3300047317 Bacteria 12883
182 Ga0495604_0020829 3300047317 Bacteria 5234
183 Ga0495604_0033780 3300047317 Bacteria 4048
184 Ga0495604_0255339 3300047317 Bacteria 1193
185 Ga0495636_0002929 3300047318 Bacteria 6602
186 Ga0495636_0003866 3300047318 Bacteria 5843
187 Ga0495636_0008604 3300047318 Bacteria 4027
188 Ga0495636_0010581 3300047318 Bacteria 3645
189 Ga0495636_0080324 3300047318 Bacteria 1403
190 Ga0495674_0257840 3300047319 Bacteria 1433
191 Ga0495676_0003250 3300047321 Bacteria 14695
192 Ga0495676_0008160 3300047321 Bacteria 9605
193 Ga0495676_0010811 3300047321 Bacteria 8256
194 Ga0495676_0044593 3300047321 Bacteria 3618
195 Ga0495676_0063856 3300047321 Bacteria 2868
196 Ga0495676_0086112 3300047321 Bacteria 2365
197 Ga0495680_0019834 3300047322 Bacteria 5668
198 Ga0495683_0038202 3300047323 Bacteria 2432
199 Ga0495687_003997 3300047443 Bacteria 10268
200 Ga0495687_049648 3300047443 Bacteria 1792
201 Ga0495687_074433 3300047443 Bacteria 1350
202 Ga0495675_0024707 3300047444 Bacteria 3832
203 Ga0495675_0060552 3300047444 Bacteria 2399
204 Ga0495675_0125365 3300047444 Bacteria 1598
205 Ga0495685_000221 3300047447 Bacteria 19406
206 Ga0495685_005945 3300047447 Bacteria 3983
207 Ga0495685_007522 3300047447 Bacteria 3599
208 Ga0495685_009267 3300047447 Bacteria 3283
209 Ga0495685_026885 3300047447 Bacteria 1979
210 Ga0495681_0007004 3300047470 Bacteria 7285
211 Ga0495681_0077157 3300047470 Bacteria 1496
212 Ga0495684_0228630 3300047471 Bacteria 1361
213 Ga0495686_0025271 3300047472 Bacteria 3896
214 Ga0495686_0033188 3300047472 Bacteria 3335
215 Ga0495593_0016736 3300047673 Bacteria 4131
216 Ga0495602_0178664 3300048088 Bacteria 1640
217 Ga0495614_0001082 3300048089 Bacteria 11659
218 Ga0495614_0003951 3300048089 Bacteria 6655
219 Ga0495614_0030819 3300048089 Bacteria 2308
220 Ga0496105_0252097 3300048908 Bacteria 1430
221 Ga0495678_041171 3300049459 Bacteria 1851
222 Ga0501031_0002122 3300049568 Bacteria 12510
223 Ga0501031_0080786 3300049568 Bacteria 2119
224 Ga0501031_0126078 3300049568 Bacteria 1673
225 Ga0501031_0133740 3300049568 Bacteria 1620
226 Ga0501032_0004871 3300049569 Bacteria 10047
227 Ga0501032_0006735 3300049569 Bacteria 8433
228 Ga0501032_0023497 3300049569 Bacteria 4258
229 Ga0501032_0071113 3300049569 Bacteria 2319
230 Ga0501033_0005286 3300049570 Bacteria 10240
231 Ga0501033_0042248 3300049570 Bacteria 3399
232 Ga0501033_0172053 3300049570 Bacteria 1555
233 Ga0501034_0002507 3300049571 Bacteria 22041
234 Ga0501034_0023301 3300049571 Bacteria 6309
235 Ga0501034_0040880 3300049571 Bacteria 4692
236 Ga0501034_0365577 3300049571 Bacteria 1369
237 Ga0501036_0003898 3300049572 Bacteria 11971
238 Ga0501036_0006155 3300049572 Bacteria 9734
239 Ga0501036_0041438 3300049572 Bacteria 3896
240 Ga0501036_0231308 3300049572 Bacteria 1551
241 Ga0501037_0039057 3300049573 Bacteria 3495
242 Ga0501037_0042487 3300049573 Bacteria 3340
243 Ga0501037_0054851 3300049573 Bacteria 2914
244 Ga0501038_0002232 3300049574 Bacteria 18005
245 Ga0501038_0014158 3300049574 Bacteria 7267
246 Ga0501038_0045907 3300049574 Bacteria 3790
247 Ga0501038_0059922 3300049574 Bacteria 3259
248 Ga0501038_0075521 3300049574 Bacteria 2848
249 Ga0501038_0101112 3300049574 Bacteria 2400
250 Ga0501038_0138896 3300049574 Bacteria 1989
251 Ga0501038_0200404 3300049574 Bacteria 1602
252 Ga0501039_0009523 3300049575 Bacteria 7403
253 Ga0501039_0106803 3300049575 Bacteria 2186
254 Ga0501039_0118639 3300049575 Bacteria 2072
255 Ga0501040_0003567 3300049576 Bacteria 10063
256 Ga0501041_0001812 3300049577 Bacteria 11980
257 Ga0501042_0081291 3300049578 Bacteria 2322
258 Ga0501042_0168035 3300049578 Bacteria 1582
259 Ga0501043_0003102 3300049579 Bacteria 13774
260 Ga0501043_0008825 3300049579 Bacteria 7935
261 Ga0501043_0015110 3300049579 Bacteria 6042
262 Ga0501043_0038031 3300049579 Bacteria 3784
263 Ga0501046_0004264 3300049580 Bacteria 13020
264 Ga0501046_0014283 3300049580 Bacteria 6706
265 Ga0501046_0034813 3300049580 Bacteria 4062
266 Ga0501047_0000055 3300049581 Bacteria 144149
267 Ga0501047_0001611 3300049581 Bacteria 22008
268 Ga0501047_0009073 3300049581 Bacteria 9392
269 Ga0501047_0061785 3300049581 Bacteria 3615
270 Ga0501047_0124062 3300049581 Bacteria 2463
271 Ga0501047_0126109 3300049581 Bacteria 2440
272 Ga0501047_0182684 3300049581 Bacteria 1963
273 Ga0501047_0305517 3300049581 Bacteria 1432
274 Ga0501047_0333153 3300049581 Bacteria 1356
275 Ga0501048_0006692 3300049582 Bacteria 8754
276 Ga0501067_0001685 3300049583 Bacteria 12149
277 Ga0501068_0000061 3300049584 Bacteria 42895
278 Ga0501069_0068203 3300049585 Bacteria 1990
279 Ga0501070_0006072 3300049586 Bacteria 10292
280 Ga0501070_0011229 3300049586 Bacteria 7563
281 Ga0501070_0212443 3300049586 Bacteria 1588
282 Ga0501071_0000111 3300049587 Bacteria 32014
283 Ga0501073_0055914 3300049589 Bacteria 2760
284 Ga0501073_0078935 3300049589 Bacteria 2291
285 Ga0501074_0009766 3300049590 Bacteria 6968
286 Ga0501074_0112090 3300049590 Bacteria 1951
287 Ga0501076_0069323 3300049592 Bacteria 2818
288 Ga0501079_0002125 3300049741 Bacteria 14248
289 Ga0501080_0023654 3300049742 Bacteria 5691
290 Ga0501083_0001819 3300049744 Bacteria 14625
291 Ga0501035_0004048 3300049822 Bacteria 13961
292 Ga0501035_0077482 3300049822 Bacteria 2937
293 Ga0501035_0152632 3300049822 Bacteria 2003
294 Ga0501035_0370895 3300049822 Bacteria 1195
295 Ga0501044_0004300 3300049823 Bacteria 15971
296 Ga0501044_0011237 3300049823 Bacteria 9706
297 Ga0501044_0029568 3300049823 Bacteria 5776
298 Ga0501044_0060859 3300049823 Bacteria 3864
299 Ga0501044_0068392 3300049823 Bacteria 3618
300 Ga0501044_0094582 3300049823 Bacteria 3012
301 Ga0501044_0115513 3300049823 Bacteria 2689
302 Ga0501044_0326341 3300049823 Bacteria 1458
303 Ga0501044_0433425 3300049823 Bacteria 1223
304 Ga0501045_0007462 3300049824 Bacteria 7595
305 Ga0501045_0007797 3300049824 Bacteria 7445
306 nmdc:mga03n38_30080_c1 3300050490 Bacteria 2279
307 nmdc:mga06z11_158550_c1 3300050494 Bacteria 1292
308 Ga0500578_0008713 3300053086 Bacteria 6619
309 Ga0500553_041229 3300053101 Bacteria 2262
310 Ga0500556_0052952 3300053104 Bacteria 1474
311 Ga0500560_038095 3300053107 Bacteria 1494
312 Ga0500569_009904 3300053109 Bacteria 2227
313 Ga0500652_012533 3300053131 Bacteria 2978
314 Ga0500573_0006957 3300053140 Bacteria 6143
315 Ga0500573_0027509 3300053140 Bacteria 3271
316 Ga0500600_0006760 3300053149 Bacteria 6861
317 Ga0500600_0062708 3300053149 Bacteria 2066
318 Ga0500600_0134284 3300053149 Bacteria 1255
319 Ga0500603_063134 3300053150 Bacteria 1040
320 Ga0500616_0003149 3300053153 Bacteria 12877
321 Ga0500633_0019476 3300053160 Bacteria 2029
322 Ga0501084_0124148 3300054114 Bacteria 2171
323 Ga0501082_0002411 3300060353 Bacteria 16407
324 Ga0466962_0012682 3300061719 Bacteria 4055
325 2547410963 2547132111 Bacteria 8013147
326 2585298652 2582581312 Bacteria 7308206
327 2585307620 2582581313 Bacteria 10042643
328 2585317771 2582581314 Bacteria 11452267
329 2616694047 2616644814 Bacteria 11555299
330 2616899225 2616644941 Bacteria 8510691
331 2644017888 2643221601 Bacteria 7493239
332 2644180824 2643221631 Bacteria 8168043
333 2644270892 2643221647 Bacteria 10741251
334 2644435559 2643221678 Bacteria 9540101
335 2644630457 2643221714 Bacteria 9015452
336 2784587191 2784132148 Bacteria 8627943
337 2785345185 2784746763 Bacteria 9783172
338 2785367701 2784746768 Bacteria 10036182
339 2786668756 2786546132 Bacteria 10419719
340 2808848177 2808606359 Bacteria 9866990
341 2808918942 2808606375 Bacteria 9466072
342 2809230750 2808606448 Bacteria 8656184
343 2812359825 2811994879 Bacteria 9313447
344 2812481911 2811994917 Bacteria 7761064
345 2819740151 2818991472 Bacteria 10089953
346 2852638197 2852635781 Bacteria 8251373
347 2862183159 2862178590 Bacteria 8583590
348 2862288941 2862281513 Bacteria 9621493
349 2862291556 2862290372 Bacteria 7471434
350 2862389145 2862382967 Bacteria 10317375
351 2862508577 2862507626 Bacteria 9425308
352 2862583189 2862574272 Bacteria 10567477
353 2863406442 2863404153 Bacteria 9672205
354 2867370441 2867369537 Bacteria 6501581
355 2867434508 2867428634 Bacteria 9590268
356 2873157226 2873151551 Bacteria 8625867
357 2877682850 2877676314 Bacteria 9512378
358 2912721870 2912715099 Bacteria 9460473
359 2912725675 2912723979 Bacteria 8557534
360 2919475272 2919468124 Bacteria 9133025
361 2946066083 2946064051 Bacteria 8957905
362 2946074385 2946072368 Bacteria 8999607
363 2947231291 2947224130 Bacteria 9938529
364 2954004574 2954002825 Bacteria 9173742
365 2954388041 2954380949 Bacteria 10050426
366 2954675036 2954673503 Bacteria 9685905
367 2954689099 2954682443 Bacteria 9862841
368 2954698851 2954691527 Bacteria 10720516
369 2954703371 2954701450 Bacteria 10834262
370 2954717829 2954711539 Bacteria 10867210
371 2954727795 2954721474 Bacteria 10456478
372 2954734007 2954731030 Bacteria 10243860
373 2954746695 2954740390 Bacteria 10229294
374 2954752890 2954749733 Bacteria 10366972
375 2954765805 2954759201 Bacteria 9358192
376 2990066310 2990059506 Bacteria 9321252
377 3006323274 3006321560 Bacteria 8247479
378 3006398109 3006393351 Bacteria 6615579
379 3006426392 3006425503 Bacteria 6491253
380 3006496531 3006493962 Bacteria 8825450
381 8008561864 8008558824 Bacteria 10610750
382 8008580293 8008574985 Bacteria 7815457
383 8023628035 8023623736 Bacteria 8593882
384 8025419646 8025413630 Bacteria 7014048
385 8033686169 8033684223 Bacteria 6906479
386 8048407736 8048406513 Bacteria 8936924
387 8056833103 8056829672 Bacteria 9045328
388 Ga0307509_10014948
389 JGI25153J46596_10021723
390 rootH1_10020104
391 rootH1_10020105
392 rootH2_10014169
393 rootH1_10008253
394 rootH1_10027052
395 rootH1_10170799
396 Ga0006562J51391_1107976
397 Ga0068856_100074462
398 Ga0081455_10179046
399 Ga0081540_1003689
400 Ga0099826_10016493
401 Ga0105251_10037514
402 Ga0105238_10415662
403 Ga0182008_10002339
404 Ga0182007_10000188
405 Ga0183367_1007
406 Ga0209758_1005571
407 Ga0207713_1036125
408 Ga0209371_1024247
409 Ga0307517_10007569
410 Ga0307517_10053404
411 Ga0307515_10012174
412 Ga0307515_10053313
413 Ga0307511_10014557
414 Ga0307512_10009973
415 Ga0307512_10024425
416 Ga0307512_10047399
417 Ga0307513_10030402
418 Ga0307513_10035331
419 Ga0307509_10007936
420 Ga0307509_10035343
421 Ga0307509_10062644
422 Ga0307508_10021647
423 Ga0307508_10041002
424 Ga0307514_10025695
425 Ga0307514_10027295
426 Ga0307514_10062542
427 Ga0307516_10011576
428 Ga0307516_10154007
429 Ga0307518_10182977
430 Ga0307507_10032680
431 Ga0307510_10021914
432 Ga0307510_10033471
433 Ga0395898_0013946
434 Ga0395898_0062332
435 Ga0395898_0083077
436 Ga0439436_0000166
437 Ga0439436_0000957
438 Ga0439436_0014813
439 Ga0451789_1170417
440 Ga0451853_0588066
441 Ga0451853_1353965
442 Ga0439433_0001100
443 Ga0439448_0025671
444 Ga0439448_0062416
445 Ga0439449_0001137
446 Ga0439449_0032937
447 Ga0439450_005556
448 Ga0439455_0018131
449 Ga0439457_000826
450 Ga0439457_002937
451 Ga0450894_000154
452 Ga0450903_000034
453 Ga0439458_0000173
454 Ga0466969_0017467
455 Ga0466972_0002698
456 Ga0466972_0005235
457 Ga0466972_0007315
458 Ga0466972_0008910
459 Ga0466965_0005935
460 Ga0466965_0009707
461 Ga0466965_0086398
462 Ga0466966_0002968
463 Ga0466966_0022720
464 Ga0466966_0207402
465 Ga0466961_0000891
466 Ga0466961_0095014
467 Ga0466963_0000977
468 Ga0466963_0038636
469 Ga0466964_0008117
470 Ga0466971_0002577
471 Ga0466968_0019194
472 Ga0466957_0000245
473 Ga0466957_0317777
474 Ga0466960_0010303
475 Ga0466959_0000355
476 Ga0466959_0122720
477 Ga0466958_0000252
478 Ga0466958_0062680
479 Ga0466967_0008668
480 Ga0466967_0037167
481 Ga0466967_0303528
482 Ga0495617_015140
483 Ga0495627_016332
484 Ga0495603_0004047
485 Ga0495603_0004835
486 Ga0495603_0006850
487 Ga0495603_0007228
488 Ga0495603_0021989
489 Ga0495603_0023421
490 Ga0495629_0002991
491 Ga0495629_0004681
492 Ga0495629_0006101
493 Ga0495629_0018376
494 Ga0495629_0022077
495 Ga0495629_0029714
496 Ga0495629_0057125
497 Ga0495629_0138902
498 Ga0495651_0097848
499 Ga0495651_0098551
500 Ga0495580_0077186
501 Ga0495582_0237163
502 Ga0495605_0037894
503 Ga0495662_0004999
504 Ga0495662_0014275
505 Ga0495662_0096155
506 Ga0495664_0017922
507 Ga0495585_0005237
508 Ga0495585_0013952
509 Ga0495594_0000550
510 Ga0495594_0015711
511 Ga0495594_0022266
512 Ga0495607_0061063
513 Ga0495583_0009989
514 Ga0495606_0021644
515 Ga0495608_0056339
516 Ga0495616_0001635
517 Ga0495620_0017076
518 Ga0495620_0078361
519 Ga0495628_0031736
520 Ga0495630_0099549
521 Ga0495631_0002123
522 Ga0495643_0001512
523 Ga0495643_0002349
524 Ga0495666_0010212
525 Ga0495666_0110566
526 Ga0495652_0047140
527 Ga0495640_0041924
528 Ga0495640_0054259
529 Ga0495609_0041029
530 Ga0495622_0024924
531 Ga0495668_0004214
532 Ga0495634_0003316
533 Ga0495634_0005469
534 Ga0495634_0137655
535 Ga0495611_0131434
536 Ga0495625_0010300
537 Ga0495625_0020149
538 Ga0495635_0064203
539 Ga0495635_0085229
540 Ga0495588_0001136
541 Ga0495588_0024329
542 Ga0495588_0030468
543 Ga0495657_0007375
544 Ga0495657_0010479
545 Ga0495657_0015065
546 Ga0495623_0076460
547 Ga0495623_0102180
548 Ga0495646_0001970
549 Ga0495646_0020576
550 Ga0495613_0001173
551 Ga0495613_0001204
552 Ga0495613_0001595
553 Ga0495613_0012146
554 Ga0495613_0044780
555 Ga0495670_0034956
556 Ga0495671_0007634
557 Ga0495649_0008060
558 Ga0495649_0246666
559 Ga0495589_0007141
560 Ga0495589_0015976
561 Ga0495589_0185517
562 Ga0495600_0012598
563 Ga0495600_0051820
564 Ga0495660_0020380
565 Ga0495660_0042387
566 Ga0495581_0241028
567 Ga0495604_0002050
568 Ga0495604_0003302
569 Ga0495604_0020829
570 Ga0495604_0033780
571 Ga0495604_0255339
572 Ga0495636_0002929
573 Ga0495636_0003866
574 Ga0495636_0008604
575 Ga0495636_0010581
576 Ga0495636_0080324
577 Ga0495674_0257840
578 Ga0495676_0003250
579 Ga0495676_0008160
580 Ga0495676_0010811
581 Ga0495676_0044593
582 Ga0495676_0063856
583 Ga0495676_0086112
584 Ga0495680_0019834
585 Ga0495683_0038202
586 Ga0495687_003997
587 Ga0495687_049648
588 Ga0495687_074433
589 Ga0495675_0024707
590 Ga0495675_0060552
591 Ga0495675_0125365
592 Ga0495685_000221
593 Ga0495685_005945
594 Ga0495685_007522
595 Ga0495685_009267
596 Ga0495685_026885
597 Ga0495681_0007004
598 Ga0495681_0077157
599 Ga0495684_0228630
600 Ga0495686_0025271
601 Ga0495686_0033188
602 Ga0495593_0016736
603 Ga0495602_0178664
604 Ga0495614_0001082
605 Ga0495614_0003951
606 Ga0495614_0030819
607 Ga0496105_0252097
608 Ga0495678_041171
609 Ga0501031_0002122
610 Ga0501031_0080786
611 Ga0501031_0126078
612 Ga0501031_0133740
613 Ga0501032_0004871
614 Ga0501032_0006735
615 Ga0501032_0023497
616 Ga0501032_0071113
617 Ga0501033_0005286
618 Ga0501033_0042248
619 Ga0501033_0172053
620 Ga0501034_0002507
621 Ga0501034_0023301
622 Ga0501034_0040880
623 Ga0501034_0365577
624 Ga0501036_0003898
625 Ga0501036_0006155
626 Ga0501036_0041438
627 Ga0501036_0231308
628 Ga0501037_0039057
629 Ga0501037_0042487
630 Ga0501037_0054851
631 Ga0501038_0002232
632 Ga0501038_0014158
633 Ga0501038_0045907
634 Ga0501038_0059922
635 Ga0501038_0075521
636 Ga0501038_0101112
637 Ga0501038_0138896
638 Ga0501038_0200404
639 Ga0501039_0009523
640 Ga0501039_0106803
641 Ga0501039_0118639
642 Ga0501040_0003567
643 Ga0501041_0001812
644 Ga0501042_0081291
645 Ga0501042_0168035
646 Ga0501043_0003102
647 Ga0501043_0008825
648 Ga0501043_0015110
649 Ga0501043_0038031
650 Ga0501046_0004264
651 Ga0501046_0014283
652 Ga0501046_0034813
653 Ga0501047_0000055
654 Ga0501047_0001611
655 Ga0501047_0009073
656 Ga0501047_0061785
657 Ga0501047_0124062
658 Ga0501047_0126109
659 Ga0501047_0182684
660 Ga0501047_0305517
661 Ga0501047_0333153
662 Ga0501048_0006692
663 Ga0501067_0001685
664 Ga0501068_0000061
665 Ga0501069_0068203
666 Ga0501070_0006072
667 Ga0501070_0011229
668 Ga0501070_0212443
669 Ga0501071_0000111
670 Ga0501073_0055914
671 Ga0501073_0078935
672 Ga0501074_0009766
673 Ga0501074_0112090
674 Ga0501076_0069323
675 Ga0501079_0002125
676 Ga0501080_0023654
677 Ga0501083_0001819
678 Ga0501035_0004048
679 Ga0501035_0077482
680 Ga0501035_0152632
681 Ga0501035_0370895
682 Ga0501044_0004300
683 Ga0501044_0011237
684 Ga0501044_0029568
685 Ga0501044_0060859
686 Ga0501044_0068392
687 Ga0501044_0094582
688 Ga0501044_0115513
689 Ga0501044_0326341
690 Ga0501044_0433425
691 Ga0501045_0007462
692 Ga0501045_0007797
693 nmdc:mga03n38_30080_c1
694 nmdc:mga06z11_158550_c1
695 Ga0500578_0008713
696 Ga0500553_041229
697 Ga0500556_0052952
698 Ga0500560_038095
699 Ga0500569_009904
700 Ga0500652_012533
701 Ga0500573_0006957
702 Ga0500573_0027509
703 Ga0500600_0006760
704 Ga0500600_0062708
705 Ga0500600_0134284
706 Ga0500603_063134
707 Ga0500616_0003149
708 Ga0500633_0019476
709 Ga0501084_0124148
710 Ga0501082_0002411
711 Ga0466962_0012682
712 2547410963
713 2585298652
714 2585307620
715 2585317771
716 2616694047
717 2616899225
718 2644017888
719 2644180824
720 2644270892
721 2644435559
722 2644630457
723 2784587191
724 2785345185
725 2785367701
726 2786668756
727 2808848177
728 2808918942
729 2809230750
730 2812359825
731 2812481911
732 2819740151
733 2852638197
734 2862183159
735 2862288941
736 2862291556
737 2862389145
738 2862508577
739 2862583189
740 2863406442
741 2867370441
742 2867434508
743 2873157226
744 2877682850
745 2912721870
746 2912725675
747 2919475272
748 2946066083
749 2946074385
750 2947231291
751 2954004574
752 2954388041
753 2954675036
754 2954689099
755 2954698851
756 2954703371
757 2954717829
758 2954727795
759 2954734007
760 2954746695
761 2954752890
762 2954765805
763 2990066310
764 3006323274
765 3006398109
766 3006426392
767 3006496531
768 8008561864
769 8008580293
770 8023628035
771 8025419646
772 8033686169
773 8048407736
774 8056833103

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02628

COX15-CtaA

Cytochrome oxidase assembly protein

58

330

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ied-assembly1.cif.gz_A crystal structure of heme a synthase from bacillus subtilis 0.7429 23 306
8aw5-assembly1.cif.gz_A cryo-em structure of heme a synthase trimer from aquifex aeolicus 0.7166 28 306
8aw5-assembly1.cif.gz_A cryo-em structure of heme a synthase trimer from aquifex aeolicus 0.6896 28 306
6ied-assembly1.cif.gz_A crystal structure of heme a synthase from bacillus subtilis 0.6867 23 306
5xfl-assembly2.cif.gz_B crystal structure of the force-sensing device region of alpha n-catenin 0.396 25 307
ID Description Score Start End Superfamily
af_Q08EC4_681_804_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.7329 168 307 1.20.120.230
af_Q08EC4_681_804_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.7229 168 307 1.20.120.230
af_Q10R04_1_472_2.130.10.110 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Clathrin heavy-chain terminal domain 0.6939 178 311 2.130.10.110
af_Q8K385_355_539_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6118 22 168 1.20.120.1770
af_D4A8Z3_354_540_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6001 28 165 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A1C4T9P4-F1-model_v4 deleted 0.949 60 316
AF-A0A6G4WUC6-F1-model_v4 Heme A synthase 0.9466 6 310 GO:0006784
GO:0016020
GO:0016653
AF-A0A4V0ZZ63-F1-model_v4 Heme A synthase 0.9417 2 321 GO:0006784
GO:0016020
GO:0016653
AF-A0A6G4U977-F1-model_v4 Heme A synthase 0.9382 12 313 GO:0006784
GO:0016020
GO:0016653
AF-A0A0S1UUC8-F1-model_v4 deleted 0.9381 3 320

Map