F430850

General Info

Members Datasets Scaffolds Average Seq Length
387 164 774 336

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10163097|Ga0207678_101630972
Length 378
Sequence MRRARRRASPTLSTSGRSDALIEGTLYDGTTGHPHGVRVATDGGRLDLRQDGGWSDSVDAALLKRVEGPGLRLGRIDRPGWRLLLPAQAEAELGTLVGSHERYGRWIDRIGLVPALVSGAIITAXXVGVGYLAPAWIAPHVPMSWERNVGGAIVGDFGKMRCRNAAGQRALEALVERVAPGATKGPNGIKVAALDVPVFNAAALPGGYIVVFKPAITETNPEALAGVLAHEVAHVRRRHVTEALIRELGIGALIRMFAGNIGANAEQIVSLSFTRQNEAQADSDAIAMLKRADISPKPTAALFARLSKEAPEFSAAFLNSHPSSSSRAAKFAASFDPRAHYQQATPGLAKRVVSAWVERAEAYALRWSDHAPATAVCR

Samples

Sample ID Description Type Environment
1 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
134 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
164 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 3.62
Rhizosphere 95.61
Stem 0
Stem Tuber 0
Unclassified 9.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207678_10163097 3300026067 Bacteria 1903
2 JGI24741J21665_1005308 3300001915 Unclassified 2721
3 JGI24740J21852_10010645 3300001979 Bacteria 3531
4 JGI24740J21852_10043151 3300001979 Bacteria 1347
5 JGI24737J22298_10002269 3300001990 Bacteria 6848
6 JGI24735J21928_10023577 3300002067 Bacteria 1866
7 Ga0070658_10000571 3300005327 Bacteria 32039
8 Ga0070658_10028741 3300005327 Bacteria 4464
9 Ga0070658_10083388 3300005327 Bacteria 2627
10 Ga0070658_10132842 3300005327 Bacteria 2075
11 Ga0070658_10140523 3300005327 Bacteria 2017
12 Ga0070658_10421103 3300005327 Bacteria 1148
13 Ga0070676_10004152 3300005328 Bacteria 7606
14 Ga0070683_100025110 3300005329 Bacteria 5347
15 Ga0070683_100060589 3300005329 Bacteria 3517
16 Ga0070683_100101346 3300005329 Bacteria 2711
17 Ga0070690_100018493 3300005330 Bacteria 4211
18 Ga0070690_100031729 3300005330 Bacteria 3294
19 Ga0070670_100041709 3300005331 Bacteria 3943
20 Ga0070666_10002899 3300005335 Bacteria 10361
21 Ga0070680_100001246 3300005336 Bacteria 18362
22 Ga0070680_100015150 3300005336 Bacteria 6038
23 Ga0070680_100113360 3300005336 Unclassified 2258
24 Ga0070682_100025713 3300005337 Bacteria 3516
25 Ga0068868_100094485 3300005338 Bacteria 2412
26 Ga0068868_100157064 3300005338 Unclassified 1876
27 Ga0070660_100000116 3300005339 Bacteria 49715
28 Ga0070660_100004453 3300005339 Bacteria 9681
29 Ga0070660_100005183 3300005339 Bacteria 9014
30 Ga0070660_100019740 3300005339 Bacteria 4943
31 Ga0070660_100038724 3300005339 Bacteria 3620
32 Ga0070660_100040886 3300005339 Bacteria 3531
33 Ga0070660_100052961 3300005339 Bacteria 3130
34 Ga0070661_100024273 3300005344 Bacteria 4349
35 Ga0070661_100037266 3300005344 Bacteria 3537
36 Ga0070692_10000864 3300005345 Bacteria 10185
37 Ga0070692_10009275 3300005345 Bacteria 4433
38 Ga0070692_10050615 3300005345 Unclassified 2158
39 Ga0070692_10088348 3300005345 Bacteria 1681
40 Ga0070668_100002259 3300005347 Bacteria 14188
41 Ga0070668_100025208 3300005347 Bacteria 4508
42 Ga0070668_100074508 3300005347 Bacteria 2648
43 Ga0070669_100018671 3300005353 Bacteria 4956
44 Ga0070669_100134764 3300005353 Bacteria 1899
45 Ga0070675_100042345 3300005354 Bacteria 3720
46 Ga0070671_100001153 3300005355 Bacteria 19660
47 Ga0070671_100049472 3300005355 Bacteria 3497
48 Ga0070671_100070507 3300005355 Bacteria 2916
49 Ga0070674_100060582 3300005356 Bacteria 2638
50 Ga0070673_100020611 3300005364 Bacteria 4757
51 Ga0070673_100025784 3300005364 Bacteria 4332
52 Ga0070659_100004455 3300005366 Bacteria 10005
53 Ga0070659_100005251 3300005366 Bacteria 9293
54 Ga0070659_100014684 3300005366 Bacteria 5856
55 Ga0070659_100021887 3300005366 Bacteria 4876
56 Ga0070659_100084895 3300005366 Bacteria 2532
57 Ga0070659_100253345 3300005366 Bacteria 1459
58 Ga0070667_100003244 3300005367 Bacteria 13908
59 Ga0070667_100040101 3300005367 Bacteria 3926
60 Ga0070667_100041106 3300005367 Bacteria 3879
61 Ga0070667_100058415 3300005367 Bacteria 3261
62 Ga0070663_100008628 3300005455 Bacteria 6282
63 Ga0070663_100101372 3300005455 Bacteria 2148
64 Ga0070678_100078164 3300005456 Unclassified 2499
65 Ga0070662_100041806 3300005457 Bacteria 3272
66 Ga0070662_100070374 3300005457 Bacteria 2578
67 Ga0070662_100091889 3300005457 Bacteria 2280
68 Ga0070662_100199915 3300005457 Bacteria 1585
69 Ga0070681_10010659 3300005458 Bacteria 9085
70 Ga0070681_10168054 3300005458 Bacteria 2115
71 Ga0070679_100001131 3300005530 Bacteria 23316
72 Ga0070679_100008460 3300005530 Bacteria 9687
73 Ga0070679_100030956 3300005530 Bacteria 5285
74 Ga0070679_100067549 3300005530 Unclassified 3565
75 Ga0070684_100125733 3300005535 Bacteria 2309
76 Ga0068853_100229670 3300005539 Bacteria 1697
77 Ga0070672_100018138 3300005543 Bacteria 5081
78 Ga0070686_100059431 3300005544 Bacteria 2463
79 Ga0070686_100063961 3300005544 Bacteria 2385
80 Ga0070665_100003398 3300005548 Bacteria 17014
81 Ga0070665_100114458 3300005548 Bacteria 2700
82 Ga0068855_100000129 3300005563 Bacteria 96519
83 Ga0068855_100003232 3300005563 Bacteria 19944
84 Ga0068855_100205252 3300005563 Bacteria 2217
85 Ga0068855_100206276 3300005563 Bacteria 2211
86 Ga0068855_100237983 3300005563 Bacteria 2035
87 Ga0068855_100248161 3300005563 Bacteria 1986
88 Ga0070664_100019497 3300005564 Bacteria 5581
89 Ga0070664_100095635 3300005564 Unclassified 2576
90 Ga0070664_100114328 3300005564 Bacteria 2358
91 Ga0070664_100223416 3300005564 Bacteria 1686
92 Ga0068857_100070010 3300005577 Bacteria 3124
93 Ga0068857_100123307 3300005577 Bacteria 2334
94 Ga0068857_100264969 3300005577 Unclassified 1578
95 Ga0068854_100026482 3300005578 Bacteria 3986
96 Ga0068854_100121739 3300005578 Bacteria 1982
97 Ga0068852_100001683 3300005616 Bacteria 15057
98 Ga0068852_100002073 3300005616 Bacteria 13696
99 Ga0068852_100077995 3300005616 Bacteria 2930
100 Ga0068852_100085797 3300005616 Bacteria 2805
101 Ga0068852_100118212 3300005616 Bacteria 2422
102 Ga0068852_100133398 3300005616 Unclassified 2289
103 Ga0068859_100000685 3300005617 Bacteria 34047
104 Ga0068859_100186673 3300005617 Bacteria 2157
105 Ga0068864_100000847 3300005618 Bacteria 25807
106 Ga0068864_100001341 3300005618 Bacteria 20455
107 Ga0068861_100336574 3300005719 Unclassified 1320
108 Ga0068863_100114534 3300005841 Bacteria 2569
109 Ga0068858_100000971 3300005842 Bacteria 29668
110 Ga0068858_100010689 3300005842 Bacteria 8682
111 Ga0068860_100001106 3300005843 Bacteria 29651
112 Ga0068860_100004855 3300005843 Bacteria 13707
113 Ga0068860_100276265 3300005843 Bacteria 1641
114 Ga0068862_100023488 3300005844 Bacteria 5167
115 Ga0068862_100039203 3300005844 Bacteria 4023
116 Ga0097621_100007830 3300006237 Bacteria 7662
117 Ga0068865_100019333 3300006881 Bacteria 4407
118 Ga0068865_100093329 3300006881 Unclassified 2188
119 Ga0097620_100000685 3300006931 Bacteria 34047
120 Ga0097620_100186694 3300006931 Bacteria 2157
121 Ga0105250_10006549 3300009092 Bacteria 5080
122 Ga0105240_10104097 3300009093 Bacteria 3447
123 Ga0105245_10106799 3300009098 Bacteria 2598
124 Ga0105245_10153841 3300009098 Unclassified 2177
125 Ga0105247_10020609 3300009101 Bacteria 3964
126 Ga0105248_10000660 3300009177 Bacteria 39185
127 Ga0105248_10001290 3300009177 Bacteria 27898
128 Ga0105248_10013782 3300009177 Bacteria 8898
129 Ga0105248_10023859 3300009177 Bacteria 6799
130 Ga0105248_10088835 3300009177 Bacteria 3478
131 Ga0105248_10118186 3300009177 Bacteria 2990
132 Ga0105248_10157603 3300009177 Bacteria 2561
133 Ga0105238_10005371 3300009551 Bacteria 12662
134 Ga0105238_10194104 3300009551 Bacteria 2006
135 Ga0105249_10065493 3300009553 Bacteria 3342
136 Ga0105239_10110490 3300010375 Bacteria 3047
137 Ga0157373_10019454 3300013100 Bacteria 4940
138 Ga0157371_10006785 3300013102 Bacteria 9357
139 Ga0157371_10020108 3300013102 Bacteria 4914
140 Ga0157371_10099998 3300013102 Bacteria 2057
141 Ga0157370_10000497 3300013104 Bacteria 48916
142 Ga0157370_10027322 3300013104 Bacteria 5627
143 Ga0157370_10043351 3300013104 Bacteria 4331
144 Ga0157369_10010429 3300013105 Bacteria 10588
145 Ga0157369_10036311 3300013105 Bacteria 5400
146 Ga0157369_10121269 3300013105 Bacteria 2774
147 Ga0157369_10476151 3300013105 Bacteria 1292
148 Ga0157374_10098697 3300013296 Bacteria 2797
149 Ga0157378_10085424 3300013297 Bacteria 2858
150 Ga0163162_10056723 3300013306 Bacteria 3944
151 Ga0163162_10161802 3300013306 Bacteria 2360
152 Ga0157372_10046441 3300013307 Bacteria 4821
153 Ga0157372_10362578 3300013307 Bacteria 1689
154 Ga0157372_10573622 3300013307 Bacteria 1315
155 Ga0157375_10220292 3300013308 Bacteria 2056
156 Ga0157375_10240937 3300013308 Bacteria 1968
157 Ga0157375_10304405 3300013308 Unclassified 1758
158 Ga0157375_10496664 3300013308 Bacteria 1384
159 Ga0163163_10000307 3300014325 Bacteria 48168
160 Ga0163163_10361053 3300014325 Unclassified 1509
161 Ga0157377_10014489 3300014745 Bacteria 4013
162 Ga0157379_10047530 3300014968 Bacteria 3828
163 Ga0157379_10058716 3300014968 Bacteria 3440
164 Ga0157379_10173948 3300014968 Unclassified 1944
165 Ga0206353_12005941 3300020082 Bacteria 1907
166 Ga0213875_10009443 3300021388 Bacteria 4941
167 Ga0207696_1011921 3300025711 Bacteria 3102
168 Ga0207688_10015540 3300025901 Bacteria 4128
169 Ga0207688_10024294 3300025901 Bacteria 3322
170 Ga0207680_10000328 3300025903 Bacteria 22845
171 Ga0207647_10002633 3300025904 Bacteria 13570
172 Ga0207647_10005793 3300025904 Bacteria 9011
173 Ga0207647_10057842 3300025904 Unclassified 2376
174 Ga0207699_10028247 3300025906 Bacteria 3116
175 Ga0207645_10004212 3300025907 Bacteria 10680
176 Ga0207705_10000091 3300025909 Bacteria 110768
177 Ga0207705_10000123 3300025909 Bacteria 85382
178 Ga0207705_10002133 3300025909 Bacteria 15351
179 Ga0207705_10014071 3300025909 Bacteria 5764
180 Ga0207705_10022479 3300025909 Bacteria 4496
181 Ga0207705_10046932 3300025909 Bacteria 3105
182 Ga0207705_10074776 3300025909 Bacteria 2460
183 Ga0207705_10148606 3300025909 Unclassified 1754
184 Ga0207705_10197390 3300025909 Bacteria 1524
185 Ga0207705_10255147 3300025909 Bacteria 1338
186 Ga0207707_10091406 3300025912 Unclassified 2660
187 Ga0207707_10139829 3300025912 Unclassified 2117
188 Ga0207707_10183100 3300025912 Bacteria 1828
189 Ga0207695_10373213 3300025913 Bacteria 1313
190 Ga0207660_10011295 3300025917 Bacteria 5807
191 Ga0207660_10031409 3300025917 Bacteria 3657
192 Ga0207660_10072847 3300025917 Unclassified 2503
193 Ga0207657_10000092 3300025919 Bacteria 85665
194 Ga0207657_10000252 3300025919 Bacteria 57036
195 Ga0207657_10002156 3300025919 Bacteria 21325
196 Ga0207657_10014760 3300025919 Bacteria 7606
197 Ga0207657_10015699 3300025919 Bacteria 7324
198 Ga0207657_10037432 3300025919 Bacteria 4332
199 Ga0207657_10045664 3300025919 Bacteria 3842
200 Ga0207657_10053392 3300025919 Bacteria 3501
201 Ga0207657_10062053 3300025919 Bacteria 3202
202 Ga0207657_10097290 3300025919 Bacteria 2447
203 Ga0207657_10135803 3300025919 Bacteria 2013
204 Ga0207657_10149735 3300025919 Bacteria 1901
205 Ga0207649_10017786 3300025920 Bacteria 4031
206 Ga0207649_10067710 3300025920 Bacteria 2268
207 Ga0207649_10070736 3300025920 Unclassified 2226
208 Ga0207652_10000034 3300025921 Bacteria 138571
209 Ga0207652_10011538 3300025921 Bacteria 7123
210 Ga0207652_10017787 3300025921 Bacteria 5823
211 Ga0207652_10080346 3300025921 Unclassified 2850
212 Ga0207681_10027341 3300025923 Bacteria 3687
213 Ga0207681_10053570 3300025923 Bacteria 2739
214 Ga0207694_10230214 3300025924 Unclassified 1513
215 Ga0207650_10114988 3300025925 Bacteria 2088
216 Ga0207664_10217563 3300025929 Bacteria 1655
217 Ga0207644_10003915 3300025931 Bacteria 9657
218 Ga0207644_10061594 3300025931 Bacteria 2718
219 Ga0207690_10005597 3300025932 Bacteria 7424
220 Ga0207690_10016900 3300025932 Bacteria 4448
221 Ga0207690_10028610 3300025932 Bacteria 3533
222 Ga0207690_10044284 3300025932 Bacteria 2933
223 Ga0207706_10011160 3300025933 Bacteria 8190
224 Ga0207706_10023269 3300025933 Bacteria 5564
225 Ga0207706_10060620 3300025933 Bacteria 3332
226 Ga0207706_10117206 3300025933 Bacteria 2342
227 Ga0207706_10260708 3300025933 Bacteria 1513
228 Ga0207706_10333583 3300025933 Bacteria 1319
229 Ga0207669_10006676 3300025937 Bacteria 5290
230 Ga0207704_10046084 3300025938 Bacteria 2596
231 Ga0207665_10038743 3300025939 Bacteria 3176
232 Ga0207691_10034291 3300025940 Bacteria 4721
233 Ga0207691_10040667 3300025940 Bacteria 4295
234 Ga0207711_10000831 3300025941 Bacteria 30006
235 Ga0207711_10004092 3300025941 Bacteria 12505
236 Ga0207711_10012307 3300025941 Bacteria 7112
237 Ga0207711_10020862 3300025941 Bacteria 5468
238 Ga0207711_10030746 3300025941 Bacteria 4530
239 Ga0207711_10123196 3300025941 Bacteria 2316
240 Ga0207689_10196860 3300025942 Unclassified 1663
241 Ga0207661_10015809 3300025944 Bacteria 5559
242 Ga0207661_10034351 3300025944 Bacteria 3942
243 Ga0207661_10146394 3300025944 Bacteria 2038
244 Ga0207661_10455843 3300025944 Bacteria 1165
245 Ga0207679_10172594 3300025945 Unclassified 1781
246 Ga0207679_10260338 3300025945 Bacteria 1479
247 Ga0207667_10001226 3300025949 Bacteria 32150
248 Ga0207667_10005320 3300025949 Bacteria 15684
249 Ga0207667_10005995 3300025949 Bacteria 14785
250 Ga0207667_10019667 3300025949 Bacteria 7528
251 Ga0207667_10180615 3300025949 Bacteria 2167
252 Ga0207667_10469148 3300025949 Bacteria 1278
253 Ga0207651_10014974 3300025960 Bacteria 4493
254 Ga0207712_10003002 3300025961 Bacteria 10784
255 Ga0207712_10043575 3300025961 Bacteria 3096
256 Ga0207668_10000050 3300025972 Bacteria 98767
257 Ga0207668_10025749 3300025972 Bacteria 3811
258 Ga0207658_10004510 3300025986 Bacteria 9674
259 Ga0207658_10007914 3300025986 Bacteria 7240
260 Ga0207658_10038374 3300025986 Bacteria 3450
261 Ga0207677_10037814 3300026023 Bacteria 3158
262 Ga0207677_10066637 3300026023 Bacteria 2518
263 Ga0207703_10001930 3300026035 Bacteria 18356
264 Ga0207703_10006083 3300026035 Bacteria 9650
265 Ga0207678_10000117 3300026067 Bacteria 65678
266 Ga0207678_10009013 3300026067 Bacteria 8782
267 Ga0207678_10077360 3300026067 Bacteria 2850
268 Ga0207678_10133747 3300026067 Unclassified 2116
269 Ga0207702_10088737 3300026078 Bacteria 2702
270 Ga0207702_10146482 3300026078 Bacteria 2143
271 Ga0207702_10227891 3300026078 Unclassified 1740
272 Ga0207702_10297996 3300026078 Bacteria 1530
273 Ga0207641_10000887 3300026088 Bacteria 31227
274 Ga0207641_10004662 3300026088 Bacteria 11829
275 Ga0207641_10012915 3300026088 Bacteria 6853
276 Ga0207641_10285416 3300026088 Bacteria 1554
277 Ga0207676_10000253 3300026095 Bacteria 46261
278 Ga0207676_10008921 3300026095 Bacteria 7134
279 Ga0207674_10018200 3300026116 Bacteria 7645
280 Ga0207674_10094962 3300026116 Bacteria 2968
281 Ga0207674_10151611 3300026116 Unclassified 2275
282 Ga0207675_100090379 3300026118 Bacteria 2879
283 Ga0207683_10054626 3300026121 Bacteria 3502
284 Ga0207698_10001717 3300026142 Bacteria 12776
285 Ga0207698_10004003 3300026142 Bacteria 8937
286 Ga0207698_10066765 3300026142 Bacteria 2833
287 Ga0207698_10403237 3300026142 Unclassified 1307
288 Ga0268266_10002799 3300028379 Bacteria 18189
289 Ga0268265_10002045 3300028380 Bacteria 15816
290 Ga0268265_10046610 3300028380 Bacteria 3241
291 Ga0268265_10068082 3300028380 Bacteria 2759
292 Ga0268265_10102809 3300028380 Bacteria 2312
293 Ga0268264_10000410 3300028381 Bacteria 60680
294 Ga0268264_10000418 3300028381 Bacteria 59942
295 Ga0268264_10003670 3300028381 Bacteria 13190
296 Ga0268264_10033869 3300028381 Bacteria 4199
297 Ga0268264_10179913 3300028381 Bacteria 1919
298 Ga0307405_10108527 3300031731 Unclassified 1876
299 Ga0307413_10061292 3300031824 Bacteria 2320
300 Ga0307406_10045973 3300031901 Bacteria 2744
301 Ga0307406_10356639 3300031901 Bacteria 1145
302 Ga0307412_10309570 3300031911 Bacteria 1252
303 Ga0307409_100113321 3300031995 Bacteria 2279
304 Ga0307416_100008135 3300032002 Bacteria 6736
305 Ga0307416_100020091 3300032002 Bacteria 4757
306 Ga0307414_10060016 3300032004 Bacteria 2688
307 Ga0307414_10396869 3300032004 Bacteria 1197
308 Ga0307415_100102951 3300032126 Bacteria 2099
309 Ga0373935_0040021 3300035692 Bacteria 2940
310 Ga0395899_0000132 3300037312 Bacteria 115455
311 Ga0395899_0004923 3300037312 Bacteria 10387
312 Ga0395899_0062003 3300037312 Bacteria 2753
313 Ga0395899_0092660 3300037312 Bacteria 2188
314 Ga0395900_0000477 3300037418 Bacteria 56791
315 Ga0395900_0002700 3300037418 Bacteria 19400
316 Ga0395900_0064290 3300037418 Bacteria 3771
317 Ga0395900_0104002 3300037418 Bacteria 2917
318 Ga0395900_0111042 3300037418 Bacteria 2816
319 Ga0395900_0197275 3300037418 Bacteria 2038
320 Ga0395898_0002701 3300037466 Bacteria 20519
321 Ga0395898_0026335 3300037466 Bacteria 5853
322 Ga0395898_0028233 3300037466 Bacteria 5626
323 Ga0395898_0033884 3300037466 Bacteria 5093
324 Ga0395898_0208138 3300037466 Bacteria 1866
325 Ga0395905_0004472 3300037471 Bacteria 14505
326 Ga0395905_0006469 3300037471 Bacteria 11789
327 Ga0395905_0009366 3300037471 Bacteria 9576
328 Ga0395905_0022535 3300037471 Bacteria 5957
329 Ga0395905_0033426 3300037471 Bacteria 4831
330 Ga0395905_0092876 3300037471 Bacteria 2830
331 Ga0436364_0561934 3300037853 Bacteria 21949
332 Ga0395901_0000275 3300038443 Bacteria 63659
333 Ga0395901_0007731 3300038443 Bacteria 10845
334 Ga0395901_0039114 3300038443 Bacteria 4907
335 Ga0395901_0152111 3300038443 Bacteria 2431
336 Ga0395901_0236222 3300038443 Unclassified 1907
337 Ga0395901_0554125 3300038443 Unclassified 1165
338 Ga0439458_0000109 3300042157 Bacteria 16485
339 Ga0439464_0005469 3300042439 Bacteria 3287
340 Ga0466972_0086067 3300044658 Bacteria 1494
341 Ga0466966_0000026 3300044684 Bacteria 106896
342 Ga0466961_0037313 3300044693 Bacteria 3118
343 Ga0466963_0054486 3300044694 Bacteria 2658
344 Ga0466963_0077171 3300044694 Bacteria 2250
345 Ga0466963_0156380 3300044694 Bacteria 1585
346 Ga0466964_0003619 3300044706 Bacteria 5647
347 Ga0466964_0008959 3300044706 Unclassified 3765
348 Ga0466971_0011770 3300044719 Bacteria 3832
349 Ga0466968_0003696 3300044735 Bacteria 5678
350 Ga0466970_0010711 3300044765 Bacteria 4660
351 Ga0466957_0008842 3300044842 Bacteria 5736
352 Ga0466957_0015180 3300044842 Bacteria 4497
353 Ga0466957_0048772 3300044842 Bacteria 2573
354 Ga0466960_0006242 3300044901 Bacteria 4773
355 Ga0466959_0014316 3300045049 Bacteria 5758
356 Ga0466958_0008261 3300045836 Bacteria 5764
357 Ga0466958_0022729 3300045836 Unclassified 3676
358 Ga0466958_0049661 3300045836 Bacteria 2538
359 Ga0466967_0037525 3300045976 Bacteria 4148
360 Ga0466967_0050648 3300045976 Bacteria 3637
361 Ga0466967_0062140 3300045976 Bacteria 3315
362 Ga0466967_0244765 3300045976 Bacteria 1711
363 Ga0466967_0292516 3300045976 Bacteria 1565
364 Ga0495663_0024882 3300046525 Bacteria 1743
365 Ga0495668_0012795 3300046616 Bacteria 4968
366 Ga0495668_0016954 3300046616 Bacteria 4230
367 Ga0495668_0036250 3300046616 Bacteria 2763
368 Ga0495669_0000774 3300046684 Bacteria 13678
369 Ga0495669_0001712 3300046684 Bacteria 8984
370 Ga0495672_0093246 3300047320 Bacteria 1649
371 Ga0496103_0230385 3300048906 Unclassified 1192
372 Ga0496104_0102305 3300048907 Bacteria 2744
373 Ga0496106_0033725 3300048909 Bacteria 3821
374 Ga0496107_0011020 3300048910 Bacteria 6289
375 Ga0496107_0012597 3300048910 Bacteria 5904
376 Ga0496107_0076872 3300048910 Bacteria 2432
377 Ga0496108_0020041 3300048911 Bacteria 5496
378 Ga0496109_0065559 3300048912 Bacteria 3325
379 Ga0496109_0098759 3300048912 Bacteria 2707
380 Ga0496110_0010023 3300048913 Bacteria 7688
381 Ga0496110_0105071 3300048913 Bacteria 2534
382 Ga0496111_0048499 3300048914 Bacteria 3059
383 Ga0496112_0003824 3300048915 Bacteria 12577
384 Ga0496114_0000016 3300048917 Bacteria 274656
385 nmdc:mga0a205_7550_c1 3300050515 Bacteria 9853
386 Ga0500658_0000150 3300053134 Bacteria 33225
387 Ga0466962_0001650 3300061719 Bacteria 10467
388 Ga0207678_10163097
389 JGI24741J21665_1005308
390 JGI24740J21852_10010645
391 JGI24740J21852_10043151
392 JGI24737J22298_10002269
393 JGI24735J21928_10023577
394 Ga0070658_10000571
395 Ga0070658_10028741
396 Ga0070658_10083388
397 Ga0070658_10132842
398 Ga0070658_10140523
399 Ga0070658_10421103
400 Ga0070676_10004152
401 Ga0070683_100025110
402 Ga0070683_100060589
403 Ga0070683_100101346
404 Ga0070690_100018493
405 Ga0070690_100031729
406 Ga0070670_100041709
407 Ga0070666_10002899
408 Ga0070680_100001246
409 Ga0070680_100015150
410 Ga0070680_100113360
411 Ga0070682_100025713
412 Ga0068868_100094485
413 Ga0068868_100157064
414 Ga0070660_100000116
415 Ga0070660_100004453
416 Ga0070660_100005183
417 Ga0070660_100019740
418 Ga0070660_100038724
419 Ga0070660_100040886
420 Ga0070660_100052961
421 Ga0070661_100024273
422 Ga0070661_100037266
423 Ga0070692_10000864
424 Ga0070692_10009275
425 Ga0070692_10050615
426 Ga0070692_10088348
427 Ga0070668_100002259
428 Ga0070668_100025208
429 Ga0070668_100074508
430 Ga0070669_100018671
431 Ga0070669_100134764
432 Ga0070675_100042345
433 Ga0070671_100001153
434 Ga0070671_100049472
435 Ga0070671_100070507
436 Ga0070674_100060582
437 Ga0070673_100020611
438 Ga0070673_100025784
439 Ga0070659_100004455
440 Ga0070659_100005251
441 Ga0070659_100014684
442 Ga0070659_100021887
443 Ga0070659_100084895
444 Ga0070659_100253345
445 Ga0070667_100003244
446 Ga0070667_100040101
447 Ga0070667_100041106
448 Ga0070667_100058415
449 Ga0070663_100008628
450 Ga0070663_100101372
451 Ga0070678_100078164
452 Ga0070662_100041806
453 Ga0070662_100070374
454 Ga0070662_100091889
455 Ga0070662_100199915
456 Ga0070681_10010659
457 Ga0070681_10168054
458 Ga0070679_100001131
459 Ga0070679_100008460
460 Ga0070679_100030956
461 Ga0070679_100067549
462 Ga0070684_100125733
463 Ga0068853_100229670
464 Ga0070672_100018138
465 Ga0070686_100059431
466 Ga0070686_100063961
467 Ga0070665_100003398
468 Ga0070665_100114458
469 Ga0068855_100000129
470 Ga0068855_100003232
471 Ga0068855_100205252
472 Ga0068855_100206276
473 Ga0068855_100237983
474 Ga0068855_100248161
475 Ga0070664_100019497
476 Ga0070664_100095635
477 Ga0070664_100114328
478 Ga0070664_100223416
479 Ga0068857_100070010
480 Ga0068857_100123307
481 Ga0068857_100264969
482 Ga0068854_100026482
483 Ga0068854_100121739
484 Ga0068852_100001683
485 Ga0068852_100002073
486 Ga0068852_100077995
487 Ga0068852_100085797
488 Ga0068852_100118212
489 Ga0068852_100133398
490 Ga0068859_100000685
491 Ga0068859_100186673
492 Ga0068864_100000847
493 Ga0068864_100001341
494 Ga0068861_100336574
495 Ga0068863_100114534
496 Ga0068858_100000971
497 Ga0068858_100010689
498 Ga0068860_100001106
499 Ga0068860_100004855
500 Ga0068860_100276265
501 Ga0068862_100023488
502 Ga0068862_100039203
503 Ga0097621_100007830
504 Ga0068865_100019333
505 Ga0068865_100093329
506 Ga0097620_100000685
507 Ga0097620_100186694
508 Ga0105250_10006549
509 Ga0105240_10104097
510 Ga0105245_10106799
511 Ga0105245_10153841
512 Ga0105247_10020609
513 Ga0105248_10000660
514 Ga0105248_10001290
515 Ga0105248_10013782
516 Ga0105248_10023859
517 Ga0105248_10088835
518 Ga0105248_10118186
519 Ga0105248_10157603
520 Ga0105238_10005371
521 Ga0105238_10194104
522 Ga0105249_10065493
523 Ga0105239_10110490
524 Ga0157373_10019454
525 Ga0157371_10006785
526 Ga0157371_10020108
527 Ga0157371_10099998
528 Ga0157370_10000497
529 Ga0157370_10027322
530 Ga0157370_10043351
531 Ga0157369_10010429
532 Ga0157369_10036311
533 Ga0157369_10121269
534 Ga0157369_10476151
535 Ga0157374_10098697
536 Ga0157378_10085424
537 Ga0163162_10056723
538 Ga0163162_10161802
539 Ga0157372_10046441
540 Ga0157372_10362578
541 Ga0157372_10573622
542 Ga0157375_10220292
543 Ga0157375_10240937
544 Ga0157375_10304405
545 Ga0157375_10496664
546 Ga0163163_10000307
547 Ga0163163_10361053
548 Ga0157377_10014489
549 Ga0157379_10047530
550 Ga0157379_10058716
551 Ga0157379_10173948
552 Ga0206353_12005941
553 Ga0213875_10009443
554 Ga0207696_1011921
555 Ga0207688_10015540
556 Ga0207688_10024294
557 Ga0207680_10000328
558 Ga0207647_10002633
559 Ga0207647_10005793
560 Ga0207647_10057842
561 Ga0207699_10028247
562 Ga0207645_10004212
563 Ga0207705_10000091
564 Ga0207705_10000123
565 Ga0207705_10002133
566 Ga0207705_10014071
567 Ga0207705_10022479
568 Ga0207705_10046932
569 Ga0207705_10074776
570 Ga0207705_10148606
571 Ga0207705_10197390
572 Ga0207705_10255147
573 Ga0207707_10091406
574 Ga0207707_10139829
575 Ga0207707_10183100
576 Ga0207695_10373213
577 Ga0207660_10011295
578 Ga0207660_10031409
579 Ga0207660_10072847
580 Ga0207657_10000092
581 Ga0207657_10000252
582 Ga0207657_10002156
583 Ga0207657_10014760
584 Ga0207657_10015699
585 Ga0207657_10037432
586 Ga0207657_10045664
587 Ga0207657_10053392
588 Ga0207657_10062053
589 Ga0207657_10097290
590 Ga0207657_10135803
591 Ga0207657_10149735
592 Ga0207649_10017786
593 Ga0207649_10067710
594 Ga0207649_10070736
595 Ga0207652_10000034
596 Ga0207652_10011538
597 Ga0207652_10017787
598 Ga0207652_10080346
599 Ga0207681_10027341
600 Ga0207681_10053570
601 Ga0207694_10230214
602 Ga0207650_10114988
603 Ga0207664_10217563
604 Ga0207644_10003915
605 Ga0207644_10061594
606 Ga0207690_10005597
607 Ga0207690_10016900
608 Ga0207690_10028610
609 Ga0207690_10044284
610 Ga0207706_10011160
611 Ga0207706_10023269
612 Ga0207706_10060620
613 Ga0207706_10117206
614 Ga0207706_10260708
615 Ga0207706_10333583
616 Ga0207669_10006676
617 Ga0207704_10046084
618 Ga0207665_10038743
619 Ga0207691_10034291
620 Ga0207691_10040667
621 Ga0207711_10000831
622 Ga0207711_10004092
623 Ga0207711_10012307
624 Ga0207711_10020862
625 Ga0207711_10030746
626 Ga0207711_10123196
627 Ga0207689_10196860
628 Ga0207661_10015809
629 Ga0207661_10034351
630 Ga0207661_10146394
631 Ga0207661_10455843
632 Ga0207679_10172594
633 Ga0207679_10260338
634 Ga0207667_10001226
635 Ga0207667_10005320
636 Ga0207667_10005995
637 Ga0207667_10019667
638 Ga0207667_10180615
639 Ga0207667_10469148
640 Ga0207651_10014974
641 Ga0207712_10003002
642 Ga0207712_10043575
643 Ga0207668_10000050
644 Ga0207668_10025749
645 Ga0207658_10004510
646 Ga0207658_10007914
647 Ga0207658_10038374
648 Ga0207677_10037814
649 Ga0207677_10066637
650 Ga0207703_10001930
651 Ga0207703_10006083
652 Ga0207678_10000117
653 Ga0207678_10009013
654 Ga0207678_10077360
655 Ga0207678_10133747
656 Ga0207702_10088737
657 Ga0207702_10146482
658 Ga0207702_10227891
659 Ga0207702_10297996
660 Ga0207641_10000887
661 Ga0207641_10004662
662 Ga0207641_10012915
663 Ga0207641_10285416
664 Ga0207676_10000253
665 Ga0207676_10008921
666 Ga0207674_10018200
667 Ga0207674_10094962
668 Ga0207674_10151611
669 Ga0207675_100090379
670 Ga0207683_10054626
671 Ga0207698_10001717
672 Ga0207698_10004003
673 Ga0207698_10066765
674 Ga0207698_10403237
675 Ga0268266_10002799
676 Ga0268265_10002045
677 Ga0268265_10046610
678 Ga0268265_10068082
679 Ga0268265_10102809
680 Ga0268264_10000410
681 Ga0268264_10000418
682 Ga0268264_10003670
683 Ga0268264_10033869
684 Ga0268264_10179913
685 Ga0307405_10108527
686 Ga0307413_10061292
687 Ga0307406_10045973
688 Ga0307406_10356639
689 Ga0307412_10309570
690 Ga0307409_100113321
691 Ga0307416_100008135
692 Ga0307416_100020091
693 Ga0307414_10060016
694 Ga0307414_10396869
695 Ga0307415_100102951
696 Ga0373935_0040021
697 Ga0395899_0000132
698 Ga0395899_0004923
699 Ga0395899_0062003
700 Ga0395899_0092660
701 Ga0395900_0000477
702 Ga0395900_0002700
703 Ga0395900_0064290
704 Ga0395900_0104002
705 Ga0395900_0111042
706 Ga0395900_0197275
707 Ga0395898_0002701
708 Ga0395898_0026335
709 Ga0395898_0028233
710 Ga0395898_0033884
711 Ga0395898_0208138
712 Ga0395905_0004472
713 Ga0395905_0006469
714 Ga0395905_0009366
715 Ga0395905_0022535
716 Ga0395905_0033426
717 Ga0395905_0092876
718 Ga0436364_0561934
719 Ga0395901_0000275
720 Ga0395901_0007731
721 Ga0395901_0039114
722 Ga0395901_0152111
723 Ga0395901_0236222
724 Ga0395901_0554125
725 Ga0439458_0000109
726 Ga0439464_0005469
727 Ga0466972_0086067
728 Ga0466966_0000026
729 Ga0466961_0037313
730 Ga0466963_0054486
731 Ga0466963_0077171
732 Ga0466963_0156380
733 Ga0466964_0003619
734 Ga0466964_0008959
735 Ga0466971_0011770
736 Ga0466968_0003696
737 Ga0466970_0010711
738 Ga0466957_0008842
739 Ga0466957_0015180
740 Ga0466957_0048772
741 Ga0466960_0006242
742 Ga0466959_0014316
743 Ga0466958_0008261
744 Ga0466958_0022729
745 Ga0466958_0049661
746 Ga0466967_0037525
747 Ga0466967_0050648
748 Ga0466967_0062140
749 Ga0466967_0244765
750 Ga0466967_0292516
751 Ga0495663_0024882
752 Ga0495668_0012795
753 Ga0495668_0016954
754 Ga0495668_0036250
755 Ga0495669_0000774
756 Ga0495669_0001712
757 Ga0495672_0093246
758 Ga0496103_0230385
759 Ga0496104_0102305
760 Ga0496106_0033725
761 Ga0496107_0011020
762 Ga0496107_0012597
763 Ga0496107_0076872
764 Ga0496108_0020041
765 Ga0496109_0065559
766 Ga0496109_0098759
767 Ga0496110_0010023
768 Ga0496110_0105071
769 Ga0496111_0048499
770 Ga0496112_0003824
771 Ga0496114_0000016
772 nmdc:mga0a205_7550_c1
773 Ga0500658_0000150
774 Ga0466962_0001650

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01435

Peptidase_M48

Peptidase family M48

165

334

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sar-assembly1.cif.gz_A e coli bepa/yfgc 0.8191 102 314
3m0n-assembly1.cif.gz_A plasmodium vivax 6-pyruvoyltetrahydropterin synthase (ptps), e37a catalytic residue mutant 0.8185 17 41
3lze-assembly1.cif.gz_A plasmodium vivax 6-pyruvoyltetrahydropterin synthase (ptps), e37c catalytic residue mutant 0.816 17 41
2a0s-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydropterin synthase (ptps) from plasmodium vivax at 2.2 a resolution 0.8133 17 41
3c37-assembly2.cif.gz_B x-ray structure of the putative zn-dependent peptidase q74d82 at the resolution 1.7 a. northeast structural genomics consortium target gsr143a 0.7961 102 315
ID Description Score Start End Superfamily
af_P66948_73_150_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8462 130 204 3.30.2010.10
af_P25894_60_145_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8448 130 205 3.30.2010.10
af_O53978_67_150_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8275 130 200 3.30.2010.10
1y13C00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8243 17 41 3.30.479.10
af_Q9FLI5_288_365_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8163 147 203 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A4Q2ZV43-F1-model_v4 M48 family metallopeptidase 0.8841 89 318 GO:0004222
GO:0016020
GO:0046872
GO:0051603
AF-A0A1W9RA94-F1-model_v4 Peptidase M48 domain-containing protein 0.875 102 295 GO:0004222
GO:0016020
GO:0046872
GO:0051603
AF-J3I0W4-F1-model_v4 Peptidase family M48 0.8739 95 319 GO:0004222
GO:0016020
GO:0046872
GO:0051603
AF-A0A5C8T830-F1-model_v4 M48 family metallopeptidase 0.872 94 321 GO:0004222
GO:0016020
GO:0046872
GO:0051603
AF-A0A519KG82-F1-model_v4 M48 family metallopeptidase 0.8595 90 320 GO:0004222
GO:0016020
GO:0046872
GO:0051603

Map