F430826

General Info

Members Datasets Scaffolds Average Seq Length
387 285 774 139

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10286298|Ga0157376_102862981
Length 153
Sequence MPHRANQEDLLMTIQSVDVLYTAVATAENGRDGRVATDDGKLDVVVNPPKELGGNGAGTNPEQLFAAGYSACFQGALGVVARQAKADISGSRVTAKVGLGKTEAGGFGLTVELAVSIPNVDAATAQQLVEAAHQVCPYSNATRGNIAVELTVV

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
73 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
76 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
86 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
93 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
94 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
95 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
96 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
97 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
98 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
99 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
100 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
101 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
102 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
103 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
104 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
105 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
106 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
107 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
135 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
136 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
137 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
167 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
174 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
209 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
210 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
211 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
212 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
213 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
214 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
215 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
216 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
217 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
218 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
219 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
220 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
222 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
223 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
224 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
225 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
226 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
227 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
228 2643221647 Streptomyces sp. Root369 Isolate Unclassified
229 2643221670 Streptomyces sp. Root431 Isolate Unclassified
230 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
231 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
232 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
233 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
234 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
235 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
236 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
237 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
238 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
239 2808606448 Streptomyces sp. 193411 Isolate Unclassified
240 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
241 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
242 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
243 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
244 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
245 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
246 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
247 2858868258 Micromonospora sp. MH33 Isolate Unclassified
248 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
249 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
250 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
251 2862574272 Streptomyces sp. AcE210 Isolate Nodule
252 2867369537 Streptomyces sp. Z26 Isolate Unclassified
253 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
254 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
255 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
256 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
257 2902582711 Micromonospora sp. AP08 Isolate Unclassified
258 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
259 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
260 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
261 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
262 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
263 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
264 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
265 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
266 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
267 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
268 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
269 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
270 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
271 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
272 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
273 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
274 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
275 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
276 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
277 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
278 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
279 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
280 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
281 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
282 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
283 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
284 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
285 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.69
Metatranscriptomes 0.78
Isolates 16.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.91
Nodule 0.26
Rhizoplane 1.29
Rhizosphere 82.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_10286298 3300014969 Bacteria 1554
2 JGI24740J21852_10010173 3300001979 Bacteria 3636
3 JGI24739J22299_10004166 3300001989 Bacteria 5531
4 JGI24737J22298_10006362 3300001990 Bacteria 4038
5 JGI24737J22298_10071189 3300001990 Bacteria 1038
6 JGI24735J21928_10204933 3300002067 Bacteria 572
7 JGI24738J21930_10031393 3300002075 Bacteria 1083
8 JGI25160J50197_1025930 3300003354 Bacteria 1626
9 Ga0070690_101664221 3300005330 Bacteria 518
10 Ga0070666_10308716 3300005335 Bacteria 1127
11 Ga0070714_100239074 3300005435 Bacteria 1676
12 Ga0070713_100005945 3300005436 Bacteria 8391
13 Ga0070663_100575971 3300005455 Bacteria 944
14 Ga0070681_10144560 3300005458 Bacteria 2308
15 Ga0070681_10515689 3300005458 Bacteria 1109
16 Ga0070685_10144554 3300005466 Bacteria 1501
17 Ga0070706_100122372 3300005467 Bacteria 2425
18 Ga0070706_100985199 3300005467 Bacteria 778
19 Ga0070706_101427568 3300005467 Bacteria 633
20 Ga0070697_100278408 3300005536 Bacteria 1435
21 Ga0070665_102233396 3300005548 Bacteria 551
22 Ga0068855_100094329 3300005563 Bacteria 3451
23 Ga0068857_100024491 3300005577 Bacteria 5314
24 Ga0068854_100613425 3300005578 Bacteria 930
25 Ga0068856_100378407 3300005614 Bacteria 1435
26 Ga0068852_101666532 3300005616 Bacteria 660
27 Ga0068859_100097479 3300005617 Bacteria 2994
28 Ga0068870_10415291 3300005840 Bacteria 879
29 Ga0068863_100199384 3300005841 Bacteria 1925
30 Ga0068858_100873477 3300005842 Bacteria 879
31 Ga0068860_100020798 3300005843 Bacteria 6357
32 Ga0068860_100697201 3300005843 Bacteria 1025
33 Ga0068860_101067203 3300005843 Bacteria 827
34 Ga0081455_10154910 3300005937 Bacteria 1763
35 Ga0081455_10460094 3300005937 Bacteria 866
36 Ga0081540_1064706 3300005983 Bacteria 1724
37 Ga0070717_10002820 3300006028 Bacteria 12295
38 Ga0070715_10082536 3300006163 Bacteria 1462
39 Ga0070716_100149915 3300006173 Bacteria 1499
40 Ga0070712_100266408 3300006175 Bacteria 1375
41 Ga0075428_100080039 3300006844 Bacteria 3565
42 Ga0075428_101199556 3300006844 Bacteria 800
43 Ga0075430_100025733 3300006846 Bacteria 5007
44 Ga0075431_100214484 3300006847 Bacteria 1965
45 Ga0075429_100000166 3300006880 Bacteria 42055
46 Ga0097620_100097478 3300006931 Bacteria 2994
47 Ga0111539_10218041 3300009094 Bacteria 2222
48 Ga0105247_10511808 3300009101 Bacteria 876
49 Ga0114129_10021500 3300009147 Bacteria 9158
50 Ga0105243_10889703 3300009148 Bacteria 885
51 Ga0105243_11052844 3300009148 Bacteria 819
52 Ga0105248_11090906 3300009177 Bacteria 902
53 Ga0105237_11006029 3300009545 Bacteria 840
54 Ga0105238_10283925 3300009551 Bacteria 1637
55 Ga0105246_10011196 3300011119 Bacteria 5560
56 Ga0157369_11511554 3300013105 Bacteria 683
57 Ga0157374_11778830 3300013296 Bacteria 641
58 Ga0157372_10189959 3300013307 Bacteria 2379
59 Ga0157372_11992156 3300013307 Bacteria 667
60 Ga0163163_11691141 3300014325 Bacteria 693
61 Ga0183367_1009 3300015688 Bacteria 484598
62 Ga0213876_10174402 3300021384 Bacteria 1144
63 Ga0207426_1001749 3300025302 Bacteria 16525
64 Ga0207426_1064667 3300025302 Bacteria 1039
65 Ga0207647_10018537 3300025904 Bacteria 4703
66 Ga0207647_10093914 3300025904 Bacteria 1787
67 Ga0207685_10048250 3300025905 Bacteria 1630
68 Ga0207684_10794563 3300025910 Bacteria 800
69 Ga0207671_11333422 3300025914 Bacteria 558
70 Ga0207694_10788366 3300025924 Bacteria 803
71 Ga0207650_10560444 3300025925 Bacteria 958
72 Ga0207700_10019958 3300025928 Bacteria 4539
73 Ga0207664_10145440 3300025929 Bacteria 2009
74 Ga0207665_10158037 3300025939 Bacteria 1628
75 Ga0207667_10161458 3300025949 Bacteria 2305
76 Ga0207703_10835490 3300026035 Bacteria 880
77 Ga0207639_10116614 3300026041 Bacteria 2187
78 Ga0207674_10024342 3300026116 Bacteria 6473
79 Ga0209371_1011240 3300027312 Bacteria 2672
80 Ga0268265_10611301 3300028380 Bacteria 1043
81 Ga0268264_10009537 3300028381 Bacteria 8041
82 Ga0268264_10651671 3300028381 Bacteria 1042
83 Ga0307517_10187138 3300028786 Bacteria 1323
84 Ga0307515_10202518 3300028794 Bacteria 1856
85 Ga0268256_1017375 3300030500 Bacteria 2027
86 Ga0307512_10008769 3300030522 Bacteria 9819
87 Ga0307512_10023023 3300030522 Bacteria 5575
88 Ga0307513_10528950 3300031456 Bacteria 893
89 Ga0307513_10614592 3300031456 Bacteria 795
90 Ga0307508_10212633 3300031616 Bacteria 1534
91 Ga0307508_10263232 3300031616 Bacteria 1318
92 Ga0307514_10099168 3300031649 Bacteria 2097
93 Ga0307514_10175838 3300031649 Bacteria 1389
94 Ga0307514_10219744 3300031649 Bacteria 1167
95 Ga0265314_10196948 3300031711 Bacteria 1194
96 Ga0307516_10421939 3300031730 Bacteria 992
97 Ga0307413_10070181 3300031824 Bacteria 2202
98 Ga0307518_10258007 3300031838 Bacteria 1101
99 Ga0307406_11025973 3300031901 Bacteria 709
100 Ga0307407_10670013 3300031903 Bacteria 779
101 Ga0307416_101203795 3300032002 Bacteria 863
102 Ga0307415_100839048 3300032126 Bacteria 842
103 Ga0307415_101555360 3300032126 Bacteria 634
104 Ga0307507_10112657 3300033179 Bacteria 2215
105 Ga0307507_10302780 3300033179 Bacteria 978
106 Ga0373960_0263082 3300035121 Bacteria 630
107 Ga0373931_0167687 3300035691 Bacteria 1291
108 Ga0395900_0116256 3300037418 Bacteria 2745
109 Ga0395900_0250846 3300037418 Bacteria 1771
110 Ga0395900_0501820 3300037418 Bacteria 1164
111 Ga0395898_0013495 3300037466 Bacteria 8412
112 Ga0395898_0133203 3300037466 Bacteria 2380
113 Ga0395905_0434281 3300037471 Bacteria 1210
114 Ga0436365_1369722 3300039437 Bacteria 2215
115 Ga0439436_0013730 3300041404 Bacteria 2449
116 Ga0439439_0020381 3300041406 Bacteria 1648
117 Ga0451791_0585469 3300041451 Bacteria 743
118 Ga0439433_0005633 3300041999 Bacteria 2688
119 Ga0439442_028626 3300042002 Bacteria 1162
120 Ga0439445_0206779 3300042004 Bacteria 581
121 Ga0439448_0001042 3300042005 Bacteria 6935
122 Ga0439449_0180331 3300042007 Bacteria 789
123 Ga0439454_003050 3300042011 Bacteria 1832
124 Ga0439455_0003187 3300042012 Bacteria 3101
125 Ga0439456_000011 3300042013 Bacteria 74739
126 Ga0439457_000686 3300042014 Bacteria 10018
127 Ga0439462_0017682 3300042015 Bacteria 1847
128 Ga0450903_000036 3300042138 Bacteria 26817
129 Ga0439458_0000129 3300042157 Bacteria 15799
130 Ga0466965_0217369 3300044683 Bacteria 1018
131 Ga0466961_0154329 3300044693 Bacteria 1433
132 Ga0466961_0170088 3300044693 Bacteria 1355
133 Ga0466961_0534745 3300044693 Bacteria 706
134 Ga0466963_0220688 3300044694 Bacteria 1328
135 Ga0466964_0117564 3300044706 Bacteria 1194
136 Ga0466970_0176785 3300044765 Bacteria 1184
137 Ga0466957_0218359 3300044842 Bacteria 1258
138 Ga0466960_0055878 3300044901 Bacteria 1920
139 Ga0466958_0130141 3300045836 Bacteria 1580
140 Ga0466967_0014113 3300045976 Bacteria 6207
141 Ga0466967_0481560 3300045976 Bacteria 1216
142 Ga0466967_0621364 3300045976 Bacteria 1067
143 Ga0466967_1678433 3300045976 Bacteria 633
144 Ga0495617_237026 3300046452 Bacteria 564
145 Ga0495592_0086791 3300046454 Bacteria 2252
146 Ga0495592_0138968 3300046454 Bacteria 1691
147 Ga0495603_0000340 3300046455 Bacteria 25092
148 Ga0495603_0026865 3300046455 Bacteria 3476
149 Ga0495603_0027535 3300046455 Bacteria 3430
150 Ga0495629_0000842 3300046459 Bacteria 24860
151 Ga0495629_0030054 3300046459 Bacteria 3852
152 Ga0495629_0054193 3300046459 Bacteria 2805
153 Ga0495629_0063396 3300046459 Bacteria 2581
154 Ga0495638_0334498 3300046460 Bacteria 805
155 Ga0495638_0426623 3300046460 Bacteria 682
156 Ga0495651_0018324 3300046462 Bacteria 5421
157 Ga0495651_0044882 3300046462 Bacteria 3425
158 Ga0495651_0566063 3300046462 Bacteria 720
159 Ga0495653_0019281 3300046463 Bacteria 5532
160 Ga0495605_0179293 3300046474 Bacteria 932
161 Ga0495662_0201232 3300046476 Bacteria 982
162 Ga0495662_0328575 3300046476 Bacteria 752
163 Ga0495664_0221436 3300046477 Bacteria 1145
164 Ga0495585_0027421 3300046492 Bacteria 3251
165 Ga0495585_0112968 3300046492 Bacteria 1443
166 Ga0495585_0180544 3300046492 Bacteria 1085
167 Ga0495594_0272452 3300046499 Bacteria 964
168 Ga0495594_0475100 3300046499 Bacteria 710
169 Ga0495606_0086139 3300046507 Bacteria 1942
170 Ga0495616_0441047 3300046513 Bacteria 529
171 Ga0495618_0174000 3300046514 Bacteria 1369
172 Ga0495618_0221174 3300046514 Bacteria 1194
173 Ga0495620_0035138 3300046515 Bacteria 2257
174 Ga0495620_0066040 3300046515 Bacteria 1491
175 Ga0495628_0111993 3300046516 Bacteria 2098
176 Ga0495628_0304784 3300046516 Bacteria 1178
177 Ga0495628_0761873 3300046516 Bacteria 680
178 Ga0495630_0227234 3300046517 Bacteria 1425
179 Ga0495631_0037135 3300046518 Bacteria 2172
180 Ga0495644_0032280 3300046523 Bacteria 1979
181 Ga0495666_0142853 3300046526 Bacteria 1115
182 Ga0495666_0314364 3300046526 Bacteria 707
183 Ga0495642_0565106 3300046528 Bacteria 505
184 Ga0495652_0037708 3300046529 Bacteria 4191
185 Ga0495652_0176562 3300046529 Bacteria 1644
186 Ga0495652_0984168 3300046529 Bacteria 552
187 Ga0495640_0017052 3300046533 Bacteria 5420
188 Ga0495640_0025211 3300046533 Bacteria 4316
189 Ga0495586_0751913 3300046535 Bacteria 563
190 Ga0495667_0080076 3300046559 Bacteria 2123
191 Ga0495668_0064491 3300046616 Bacteria 2016
192 Ga0495634_0010122 3300046642 Bacteria 6919
193 Ga0495634_0134836 3300046642 Bacteria 1571
194 Ga0495611_0331927 3300046648 Bacteria 699
195 Ga0495625_0109916 3300046660 Bacteria 1885
196 Ga0495625_0117335 3300046660 Bacteria 1814
197 Ga0495625_0280311 3300046660 Bacteria 1073
198 Ga0495661_0230237 3300046665 Bacteria 956
199 Ga0495657_0087140 3300046675 Bacteria 2009
200 Ga0495657_0158068 3300046675 Bacteria 1403
201 Ga0495657_0854314 3300046675 Bacteria 518
202 Ga0495599_0093350 3300046678 Bacteria 1878
203 Ga0495599_0529413 3300046678 Bacteria 692
204 Ga0495623_0312325 3300046679 Bacteria 865
205 Ga0495646_0063575 3300046680 Bacteria 2191
206 Ga0495669_0639415 3300046684 Bacteria 517
207 Ga0495613_0014174 3300046689 Bacteria 5913
208 Ga0495613_0085608 3300046689 Bacteria 2286
209 Ga0495613_0173843 3300046689 Bacteria 1527
210 Ga0495613_0957885 3300046689 Bacteria 551
211 Ga0495613_1069664 3300046689 Bacteria 516
212 Ga0495624_0023246 3300046690 Bacteria 4089
213 Ga0495624_0056308 3300046690 Bacteria 2474
214 Ga0495624_0208646 3300046690 Bacteria 1185
215 Ga0495624_0613177 3300046690 Bacteria 648
216 Ga0495670_0034511 3300046691 Bacteria 2520
217 Ga0495670_0273963 3300046691 Bacteria 902
218 Ga0495649_0041102 3300046694 Bacteria 2529
219 Ga0495649_0268043 3300046694 Bacteria 874
220 Ga0495589_0053468 3300046794 Bacteria 1992
221 Ga0495600_0073210 3300046809 Bacteria 2237
222 Ga0495600_0448932 3300046809 Bacteria 798
223 Ga0495660_0178344 3300046810 Bacteria 1029
224 Ga0495581_0782323 3300047315 Bacteria 548
225 Ga0495604_0069838 3300047317 Bacteria 2662
226 Ga0495604_0610637 3300047317 Bacteria 698
227 Ga0495636_0030890 3300047318 Bacteria 2193
228 Ga0495636_0507593 3300047318 Bacteria 583
229 Ga0495636_0524320 3300047318 Bacteria 574
230 Ga0495674_0035236 3300047319 Bacteria 4517
231 Ga0495674_1471758 3300047319 Bacteria 505
232 Ga0495672_0082093 3300047320 Bacteria 1793
233 Ga0495676_0000208 3300047321 Bacteria 46581
234 Ga0495676_0001933 3300047321 Bacteria 18179
235 Ga0495676_0042761 3300047321 Bacteria 3715
236 Ga0495676_0043504 3300047321 Bacteria 3673
237 Ga0495676_0141899 3300047321 Bacteria 1721
238 Ga0495676_0385166 3300047321 Bacteria 932
239 Ga0495680_0094151 3300047322 Bacteria 2242
240 Ga0495683_0026377 3300047323 Bacteria 2974
241 Ga0495687_039469 3300047443 Bacteria 2088
242 Ga0495687_094265 3300047443 Bacteria 1138
243 Ga0495675_0181515 3300047444 Bacteria 1288
244 Ga0495675_0232759 3300047444 Bacteria 1111
245 Ga0495685_001606 3300047447 Bacteria 6971
246 Ga0495685_006066 3300047447 Bacteria 3953
247 Ga0495685_016046 3300047447 Bacteria 2559
248 Ga0495685_023311 3300047447 Bacteria 2131
249 Ga0495684_0101163 3300047471 Bacteria 2179
250 Ga0495684_0352721 3300047471 Bacteria 1044
251 Ga0495593_0488120 3300047673 Bacteria 617
252 Ga0495602_0429969 3300048088 Bacteria 936
253 Ga0495614_0000170 3300048089 Bacteria 24060
254 Ga0495614_0091219 3300048089 Bacteria 1325
255 Ga0495614_0102622 3300048089 Bacteria 1251
256 Ga0495614_0132977 3300048089 Bacteria 1102
257 Ga0495626_0072327 3300048091 Bacteria 1547
258 Ga0496102_0596717 3300048905 Bacteria 1027
259 Ga0496106_0220153 3300048909 Bacteria 1514
260 Ga0496109_0158360 3300048912 Bacteria 2121
261 Ga0496110_0527619 3300048913 Bacteria 1074
262 Ga0496121_0114717 3300048924 Bacteria 2047
263 Ga0496126_0635561 3300048929 Bacteria 837
264 Ga0501316_022290 3300049532 Bacteria 806
265 Ga0501319_000813 3300049535 Bacteria 1631
266 Ga0501323_037322 3300049539 Bacteria 702
267 Ga0501031_0010673 3300049568 Bacteria 5984
268 Ga0501031_0100757 3300049568 Bacteria 1885
269 Ga0501032_0090247 3300049569 Bacteria 2034
270 Ga0501033_0044082 3300049570 Bacteria 3320
271 Ga0501034_0620247 3300049571 Bacteria 985
272 Ga0501036_0083258 3300049572 Bacteria 2704
273 Ga0501036_0702936 3300049572 Bacteria 835
274 Ga0501037_0127732 3300049573 Bacteria 1824
275 Ga0501037_1131355 3300049573 Bacteria 506
276 Ga0501038_0007090 3300049574 Bacteria 10349
277 Ga0501039_0583367 3300049575 Bacteria 877
278 Ga0501042_0125201 3300049578 Bacteria 1850
279 Ga0501043_0091887 3300049579 Bacteria 2386
280 Ga0501043_0879045 3300049579 Bacteria 644
281 Ga0501047_0000056 3300049581 Bacteria 143501
282 Ga0501047_0017293 3300049581 Bacteria 6905
283 Ga0501047_0076388 3300049581 Bacteria 3223
284 Ga0501047_0081942 3300049581 Bacteria 3102
285 Ga0501067_0865258 3300049583 Bacteria 510
286 Ga0501070_0973325 3300049586 Bacteria 659
287 Ga0501070_1074132 3300049586 Bacteria 622
288 Ga0501070_1111465 3300049586 Bacteria 609
289 Ga0501071_0409233 3300049587 Bacteria 1036
290 Ga0501074_0531558 3300049590 Bacteria 833
291 Ga0501083_0240279 3300049744 Bacteria 1179
292 Ga0501035_0021410 3300049822 Bacteria 5944
293 Ga0501035_0045804 3300049822 Bacteria 3934
294 Ga0501035_0120740 3300049822 Bacteria 2291
295 Ga0501044_0041206 3300049823 Bacteria 4808
296 Ga0501044_0052001 3300049823 Bacteria 4224
297 Ga0501044_0070662 3300049823 Bacteria 3550
298 Ga0501044_0262215 3300049823 Bacteria 1666
299 Ga0501044_0406988 3300049823 Bacteria 1272
300 Ga0501044_0766957 3300049823 Bacteria 846
301 Ga0501044_0842344 3300049823 Bacteria 794
302 nmdc:mga03n38_157263_c1 3300050490 Bacteria 1148
303 nmdc:mga03n38_54638_c1 3300050490 Bacteria 1796
304 nmdc:mga05p37_64618_c1 3300050507 Bacteria 4503
305 nmdc:mga09592_163778_c1 3300050508 Bacteria 1922
306 nmdc:mga0qj67_316460_c1 3300050509 Bacteria 1264
307 nmdc:mga06r32_2200_c1 3300050510 Bacteria 17458
308 nmdc:mga08y16_399370_c1 3300050511 Bacteria 1407
309 Ga0500646_0018813 3300053090 Bacteria 1823
310 Ga0500647_0025677 3300053091 Bacteria 2777
311 Ga0500566_0000243 3300053094 Bacteria 29193
312 Ga0500640_025563 3300053095 Bacteria 2568
313 Ga0500556_0265118 3300053104 Bacteria 675
314 Ga0500572_003827 3300053111 Bacteria 3419
315 Ga0500614_002653 3300053123 Bacteria 3960
316 Ga0500618_049034 3300053125 Bacteria 958
317 Ga0500638_220396 3300053162 Bacteria 787
318 Ga0500639_004002 3300053163 Bacteria 7465
319 Ga0500639_293679 3300053163 Bacteria 616
320 Ga0500576_164924 3300053725 Bacteria 806
321 Ga0500596_004098 3300053735 Bacteria 2700
322 Ga0500601_015886 3300053737 Bacteria 857
323 Ga0466962_0042408 3300061719 Bacteria 2178
324 2547407813 2547132111 Bacteria 8013147
325 2585308376 2582581313 Bacteria 10042643
326 2585313190 2582581314 Bacteria 11452267
327 2616694654 2616644814 Bacteria 11555299
328 2616899761 2616644941 Bacteria 8510691
329 2643944851 2643221587 Bacteria 7586415
330 2644268905 2643221647 Bacteria 10741251
331 2644385200 2643221670 Bacteria 6497041
332 2644431750 2643221677 Bacteria 7584031
333 2676477696 2675903058 Bacteria 6822861
334 2740033466 2739367866 Bacteria 4215900
335 2784587667 2784132148 Bacteria 8627943
336 2785368300 2784746768 Bacteria 10036182
337 2786669299 2786546132 Bacteria 10419719
338 2795786560 2795385470 Bacteria 8317180
339 2804844705 2802429296 Bacteria 7227771
340 2808919531 2808606375 Bacteria 9466072
341 2809231234 2808606448 Bacteria 8656184
342 2811847967 2808606982 Bacteria 7791042
343 2812359247 2811994879 Bacteria 9313447
344 2816425670 2816332119 Bacteria 8120218
345 2827634387 2827628540 Bacteria 6858585
346 2852640804 2852635781 Bacteria 8251373
347 2857481836 2857481737 Bacteria 4761446
348 2857609115 2857604169 Bacteria 5111450
349 2858875547 2858868258 Bacteria 7683772
350 2862182657 2862178590 Bacteria 8583590
351 2862288373 2862281513 Bacteria 9621493
352 2862291164 2862290372 Bacteria 7471434
353 2862582586 2862574272 Bacteria 10567477
354 2867370901 2867369537 Bacteria 6501581
355 2873156732 2873151551 Bacteria 8625867
356 2877682278 2877676314 Bacteria 9512378
357 2883580250 2883577096 Bacteria 4709178
358 2895438015 2895427314 Bacteria 13147766
359 2902583474 2902582711 Bacteria 6187705
360 2912721176 2912715099 Bacteria 9460473
361 2912725203 2912723979 Bacteria 8557534
362 2912967572 2912963787 Bacteria 5646108
363 2935394015 2935390628 Bacteria 7043367
364 2946066637 2946064051 Bacteria 8957905
365 2954675762 2954673503 Bacteria 9685905
366 2954688502 2954682443 Bacteria 9862841
367 2954698240 2954691527 Bacteria 10720516
368 2954703987 2954701450 Bacteria 10834262
369 2954717263 2954711539 Bacteria 10867210
370 2954727231 2954721474 Bacteria 10456478
371 2954734561 2954731030 Bacteria 10243860
372 2954746137 2954740390 Bacteria 10229294
373 2954753458 2954749733 Bacteria 10366972
374 2954765104 2954759201 Bacteria 9358192
375 2990093712 2990088156 Bacteria 6657676
376 2996227609 2996221748 Bacteria 6799777
377 2997456379 2997451912 Bacteria 8492419
378 3006487203 3006486233 Bacteria 8157040
379 3006501931 3006493962 Bacteria 8825450
380 8008579799 8008574985 Bacteria 7815457
381 8023630404 8023623736 Bacteria 8593882
382 8025416219 8025413630 Bacteria 7014048
383 8025531179 8025530807 Bacteria 8495698
384 8054165779 8054160619 Bacteria 7783213
385 8056453210 8056447290 Bacteria 7680491
386 8056673390 8056667051 Bacteria 6953971
387 8056836735 8056829672 Bacteria 9045328
388 Ga0157376_10286298
389 JGI24740J21852_10010173
390 JGI24739J22299_10004166
391 JGI24737J22298_10006362
392 JGI24737J22298_10071189
393 JGI24735J21928_10204933
394 JGI24738J21930_10031393
395 JGI25160J50197_1025930
396 Ga0070690_101664221
397 Ga0070666_10308716
398 Ga0070714_100239074
399 Ga0070713_100005945
400 Ga0070663_100575971
401 Ga0070681_10144560
402 Ga0070681_10515689
403 Ga0070685_10144554
404 Ga0070706_100122372
405 Ga0070706_100985199
406 Ga0070706_101427568
407 Ga0070697_100278408
408 Ga0070665_102233396
409 Ga0068855_100094329
410 Ga0068857_100024491
411 Ga0068854_100613425
412 Ga0068856_100378407
413 Ga0068852_101666532
414 Ga0068859_100097479
415 Ga0068870_10415291
416 Ga0068863_100199384
417 Ga0068858_100873477
418 Ga0068860_100020798
419 Ga0068860_100697201
420 Ga0068860_101067203
421 Ga0081455_10154910
422 Ga0081455_10460094
423 Ga0081540_1064706
424 Ga0070717_10002820
425 Ga0070715_10082536
426 Ga0070716_100149915
427 Ga0070712_100266408
428 Ga0075428_100080039
429 Ga0075428_101199556
430 Ga0075430_100025733
431 Ga0075431_100214484
432 Ga0075429_100000166
433 Ga0097620_100097478
434 Ga0111539_10218041
435 Ga0105247_10511808
436 Ga0114129_10021500
437 Ga0105243_10889703
438 Ga0105243_11052844
439 Ga0105248_11090906
440 Ga0105237_11006029
441 Ga0105238_10283925
442 Ga0105246_10011196
443 Ga0157369_11511554
444 Ga0157374_11778830
445 Ga0157372_10189959
446 Ga0157372_11992156
447 Ga0163163_11691141
448 Ga0183367_1009
449 Ga0213876_10174402
450 Ga0207426_1001749
451 Ga0207426_1064667
452 Ga0207647_10018537
453 Ga0207647_10093914
454 Ga0207685_10048250
455 Ga0207684_10794563
456 Ga0207671_11333422
457 Ga0207694_10788366
458 Ga0207650_10560444
459 Ga0207700_10019958
460 Ga0207664_10145440
461 Ga0207665_10158037
462 Ga0207667_10161458
463 Ga0207703_10835490
464 Ga0207639_10116614
465 Ga0207674_10024342
466 Ga0209371_1011240
467 Ga0268265_10611301
468 Ga0268264_10009537
469 Ga0268264_10651671
470 Ga0307517_10187138
471 Ga0307515_10202518
472 Ga0268256_1017375
473 Ga0307512_10008769
474 Ga0307512_10023023
475 Ga0307513_10528950
476 Ga0307513_10614592
477 Ga0307508_10212633
478 Ga0307508_10263232
479 Ga0307514_10099168
480 Ga0307514_10175838
481 Ga0307514_10219744
482 Ga0265314_10196948
483 Ga0307516_10421939
484 Ga0307413_10070181
485 Ga0307518_10258007
486 Ga0307406_11025973
487 Ga0307407_10670013
488 Ga0307416_101203795
489 Ga0307415_100839048
490 Ga0307415_101555360
491 Ga0307507_10112657
492 Ga0307507_10302780
493 Ga0373960_0263082
494 Ga0373931_0167687
495 Ga0395900_0116256
496 Ga0395900_0250846
497 Ga0395900_0501820
498 Ga0395898_0013495
499 Ga0395898_0133203
500 Ga0395905_0434281
501 Ga0436365_1369722
502 Ga0439436_0013730
503 Ga0439439_0020381
504 Ga0451791_0585469
505 Ga0439433_0005633
506 Ga0439442_028626
507 Ga0439445_0206779
508 Ga0439448_0001042
509 Ga0439449_0180331
510 Ga0439454_003050
511 Ga0439455_0003187
512 Ga0439456_000011
513 Ga0439457_000686
514 Ga0439462_0017682
515 Ga0450903_000036
516 Ga0439458_0000129
517 Ga0466965_0217369
518 Ga0466961_0154329
519 Ga0466961_0170088
520 Ga0466961_0534745
521 Ga0466963_0220688
522 Ga0466964_0117564
523 Ga0466970_0176785
524 Ga0466957_0218359
525 Ga0466960_0055878
526 Ga0466958_0130141
527 Ga0466967_0014113
528 Ga0466967_0481560
529 Ga0466967_0621364
530 Ga0466967_1678433
531 Ga0495617_237026
532 Ga0495592_0086791
533 Ga0495592_0138968
534 Ga0495603_0000340
535 Ga0495603_0026865
536 Ga0495603_0027535
537 Ga0495629_0000842
538 Ga0495629_0030054
539 Ga0495629_0054193
540 Ga0495629_0063396
541 Ga0495638_0334498
542 Ga0495638_0426623
543 Ga0495651_0018324
544 Ga0495651_0044882
545 Ga0495651_0566063
546 Ga0495653_0019281
547 Ga0495605_0179293
548 Ga0495662_0201232
549 Ga0495662_0328575
550 Ga0495664_0221436
551 Ga0495585_0027421
552 Ga0495585_0112968
553 Ga0495585_0180544
554 Ga0495594_0272452
555 Ga0495594_0475100
556 Ga0495606_0086139
557 Ga0495616_0441047
558 Ga0495618_0174000
559 Ga0495618_0221174
560 Ga0495620_0035138
561 Ga0495620_0066040
562 Ga0495628_0111993
563 Ga0495628_0304784
564 Ga0495628_0761873
565 Ga0495630_0227234
566 Ga0495631_0037135
567 Ga0495644_0032280
568 Ga0495666_0142853
569 Ga0495666_0314364
570 Ga0495642_0565106
571 Ga0495652_0037708
572 Ga0495652_0176562
573 Ga0495652_0984168
574 Ga0495640_0017052
575 Ga0495640_0025211
576 Ga0495586_0751913
577 Ga0495667_0080076
578 Ga0495668_0064491
579 Ga0495634_0010122
580 Ga0495634_0134836
581 Ga0495611_0331927
582 Ga0495625_0109916
583 Ga0495625_0117335
584 Ga0495625_0280311
585 Ga0495661_0230237
586 Ga0495657_0087140
587 Ga0495657_0158068
588 Ga0495657_0854314
589 Ga0495599_0093350
590 Ga0495599_0529413
591 Ga0495623_0312325
592 Ga0495646_0063575
593 Ga0495669_0639415
594 Ga0495613_0014174
595 Ga0495613_0085608
596 Ga0495613_0173843
597 Ga0495613_0957885
598 Ga0495613_1069664
599 Ga0495624_0023246
600 Ga0495624_0056308
601 Ga0495624_0208646
602 Ga0495624_0613177
603 Ga0495670_0034511
604 Ga0495670_0273963
605 Ga0495649_0041102
606 Ga0495649_0268043
607 Ga0495589_0053468
608 Ga0495600_0073210
609 Ga0495600_0448932
610 Ga0495660_0178344
611 Ga0495581_0782323
612 Ga0495604_0069838
613 Ga0495604_0610637
614 Ga0495636_0030890
615 Ga0495636_0507593
616 Ga0495636_0524320
617 Ga0495674_0035236
618 Ga0495674_1471758
619 Ga0495672_0082093
620 Ga0495676_0000208
621 Ga0495676_0001933
622 Ga0495676_0042761
623 Ga0495676_0043504
624 Ga0495676_0141899
625 Ga0495676_0385166
626 Ga0495680_0094151
627 Ga0495683_0026377
628 Ga0495687_039469
629 Ga0495687_094265
630 Ga0495675_0181515
631 Ga0495675_0232759
632 Ga0495685_001606
633 Ga0495685_006066
634 Ga0495685_016046
635 Ga0495685_023311
636 Ga0495684_0101163
637 Ga0495684_0352721
638 Ga0495593_0488120
639 Ga0495602_0429969
640 Ga0495614_0000170
641 Ga0495614_0091219
642 Ga0495614_0102622
643 Ga0495614_0132977
644 Ga0495626_0072327
645 Ga0496102_0596717
646 Ga0496106_0220153
647 Ga0496109_0158360
648 Ga0496110_0527619
649 Ga0496121_0114717
650 Ga0496126_0635561
651 Ga0501316_022290
652 Ga0501319_000813
653 Ga0501323_037322
654 Ga0501031_0010673
655 Ga0501031_0100757
656 Ga0501032_0090247
657 Ga0501033_0044082
658 Ga0501034_0620247
659 Ga0501036_0083258
660 Ga0501036_0702936
661 Ga0501037_0127732
662 Ga0501037_1131355
663 Ga0501038_0007090
664 Ga0501039_0583367
665 Ga0501042_0125201
666 Ga0501043_0091887
667 Ga0501043_0879045
668 Ga0501047_0000056
669 Ga0501047_0017293
670 Ga0501047_0076388
671 Ga0501047_0081942
672 Ga0501067_0865258
673 Ga0501070_0973325
674 Ga0501070_1074132
675 Ga0501070_1111465
676 Ga0501071_0409233
677 Ga0501074_0531558
678 Ga0501083_0240279
679 Ga0501035_0021410
680 Ga0501035_0045804
681 Ga0501035_0120740
682 Ga0501044_0041206
683 Ga0501044_0052001
684 Ga0501044_0070662
685 Ga0501044_0262215
686 Ga0501044_0406988
687 Ga0501044_0766957
688 Ga0501044_0842344
689 nmdc:mga03n38_157263_c1
690 nmdc:mga03n38_54638_c1
691 nmdc:mga05p37_64618_c1
692 nmdc:mga09592_163778_c1
693 nmdc:mga0qj67_316460_c1
694 nmdc:mga06r32_2200_c1
695 nmdc:mga08y16_399370_c1
696 Ga0500646_0018813
697 Ga0500647_0025677
698 Ga0500566_0000243
699 Ga0500640_025563
700 Ga0500556_0265118
701 Ga0500572_003827
702 Ga0500614_002653
703 Ga0500618_049034
704 Ga0500638_220396
705 Ga0500639_004002
706 Ga0500639_293679
707 Ga0500576_164924
708 Ga0500596_004098
709 Ga0500601_015886
710 Ga0466962_0042408
711 2547407813
712 2585308376
713 2585313190
714 2616694654
715 2616899761
716 2643944851
717 2644268905
718 2644385200
719 2644431750
720 2676477696
721 2740033466
722 2784587667
723 2785368300
724 2786669299
725 2795786560
726 2804844705
727 2808919531
728 2809231234
729 2811847967
730 2812359247
731 2816425670
732 2827634387
733 2852640804
734 2857481836
735 2857609115
736 2858875547
737 2862182657
738 2862288373
739 2862291164
740 2862582586
741 2867370901
742 2873156732
743 2877682278
744 2883580250
745 2895438015
746 2902583474
747 2912721176
748 2912725203
749 2912967572
750 2935394015
751 2946066637
752 2954675762
753 2954688502
754 2954698240
755 2954703987
756 2954717263
757 2954727231
758 2954734561
759 2954746137
760 2954753458
761 2954765104
762 2990093712
763 2996227609
764 2997456379
765 3006487203
766 3006501931
767 8008579799
768 8023630404
769 8025416219
770 8025531179
771 8054165779
772 8056453210
773 8056673390
774 8056836735

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

53

151

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lus-assembly1.cif.gz_A crystal structure of a putative organic hydroperoxide resistance protein with molecule of captopril bound in one of the active sites from vibrio cholerae o1 biovar eltor str. n16961 0.9546 6 142
6ed0-assembly1.cif.gz_B "ohra (organic hydroperoxide resistance protein) mutant (c61s) in the ""open conformation"" from chromobacterium violaceum" 0.9526 2 143
1zb9-assembly1.cif.gz_B crystal structure of xylella fastidiosa organic peroxide resistance protein 0.952 4 143
6ed0-assembly1.cif.gz_A "ohra (organic hydroperoxide resistance protein) mutant (c61s) in the ""open conformation"" from chromobacterium violaceum" 0.9483 4 143
6ed0-assembly1.cif.gz_B "ohra (organic hydroperoxide resistance protein) mutant (c61s) in the ""open conformation"" from chromobacterium violaceum" 0.9461 2 143
ID Description Score Start End Superfamily
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9559 49 143 3.30.300.20
3eerA01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.9548 7 48 2.20.25.10
af_Q2G1T3_42_139_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9523 49 143 3.30.300.20
4xx2A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9439 49 143 3.30.300.20
4xx2A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9342 49 143 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A074N3E9-F1-model_v4 Organic hydroperoxide resistance protein 0.9883 7 143 GO:0006979
AF-A0A163LCI0-F1-model_v4 HTH marR-type domain-containing protein 0.9868 8 143 GO:0003700
GO:0006979
GO:0016628
AF-A0A538PH62-F1-model_v4 Ohr family peroxiredoxin 0.9849 50 143 GO:0006979
AF-A0A4Z0HFY8-F1-model_v4 Organic hydroperoxide resistance protein 0.9848 4 143 GO:0006979
AF-A0A4P9WKD5-F1-model_v4 Organic hydroperoxide resistance protein 0.9846 1 143 GO:0006979

Map