F430732

General Info

Members Datasets Scaffolds Average Seq Length
387 187 774 70

Family's Representative Sequence

Representative Sequence 3300005343|Ga0070687_100091203|Ga0070687_1000912033
Length 84
Sequence LRIYLQPIGFSNKNEMVEVFKTNVQKKTQSKMLLSVLSEAFPSFKINFDLSDCDKVLRVEGDNIEALRIMILVKEYGVKCEILD

Samples

Sample ID Description Type Environment
1 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
148 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
149 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
150 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 1.81
Rhizosphere 96.9
Stem 0
Stem Tuber 0
Unclassified 8.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070687_100091203 3300005343 Bacteria 1686
2 rootL2_10168281 3300003322 Bacteria 3138
3 rootL2_10275753 3300003322 Bacteria 1026
4 Ga0055529_1026171 3300003763 Bacteria 720
5 Ga0065704_10184065 3300005289 Bacteria 1222
6 Ga0065712_10071173 3300005290 Bacteria 5439
7 Ga0065715_10271997 3300005293 Bacteria 1108
8 Ga0070676_10039013 3300005328 Bacteria 2745
9 Ga0070676_10123414 3300005328 Bacteria 1629
10 Ga0070676_10697886 3300005328 Bacteria 741
11 Ga0070676_11599381 3300005328 Bacteria 503
12 Ga0070683_100033081 3300005329 Bacteria 4712
13 Ga0070683_100792796 3300005329 Bacteria 908
14 Ga0070690_100006529 3300005330 Bacteria 6619
15 Ga0070670_100104606 3300005331 Bacteria 2438
16 Ga0070670_100392176 3300005331 Bacteria 1224
17 Ga0070670_100499509 3300005331 Bacteria 1081
18 Ga0070677_10321002 3300005333 Bacteria 793
19 Ga0070677_10609003 3300005333 Bacteria 606
20 Ga0068869_100053632 3300005334 Bacteria 2932
21 Ga0068869_100258860 3300005334 Bacteria 1392
22 Ga0068869_100611159 3300005334 Bacteria 922
23 Ga0068869_101226836 3300005334 Unclassified 660
24 Ga0070666_10044304 3300005335 Bacteria 2980
25 Ga0070682_100895006 3300005337 Bacteria 729
26 Ga0068868_100064681 3300005338 Bacteria 2904
27 Ga0068868_100273980 3300005338 Bacteria 1426
28 Ga0068868_102169782 3300005338 Bacteria 529
29 Ga0070689_100038671 3300005340 Bacteria 3651
30 Ga0070689_101585185 3300005340 Unclassified 594
31 Ga0070687_100115906 3300005343 Bacteria 1524
32 Ga0070687_101421402 3300005343 Bacteria 519
33 Ga0070661_100178446 3300005344 Bacteria 1615
34 Ga0070661_100833568 3300005344 Bacteria 758
35 Ga0070661_101168542 3300005344 Unclassified 643
36 Ga0070668_100214123 3300005347 Bacteria 1586
37 Ga0070668_101277523 3300005347 Bacteria 667
38 Ga0070669_100143350 3300005353 Bacteria 1844
39 Ga0070669_100565892 3300005353 Bacteria 949
40 Ga0070675_100596105 3300005354 Bacteria 1002
41 Ga0070675_101166649 3300005354 Bacteria 709
42 Ga0070671_100038014 3300005355 Bacteria 3994
43 Ga0070671_100116921 3300005355 Bacteria 2242
44 Ga0070674_100112043 3300005356 Bacteria 2005
45 Ga0070673_100100534 3300005364 Bacteria 2381
46 Ga0070673_100468381 3300005364 Bacteria 1136
47 Ga0070673_100949786 3300005364 Bacteria 799
48 Ga0070673_101709595 3300005364 Bacteria 595
49 Ga0070688_100051357 3300005365 Bacteria 2572
50 Ga0070688_100058786 3300005365 Unclassified 2422
51 Ga0070688_101581937 3300005365 Bacteria 535
52 Ga0070659_100223701 3300005366 Bacteria 1554
53 Ga0070659_100964406 3300005366 Unclassified 747
54 Ga0070667_100188830 3300005367 Bacteria 1825
55 Ga0070667_100296146 3300005367 Bacteria 1456
56 Ga0070667_100299553 3300005367 Bacteria 1447
57 Ga0070667_100375388 3300005367 Bacteria 1291
58 Ga0070667_100865157 3300005367 Bacteria 841
59 Ga0070667_101738348 3300005367 Bacteria 587
60 Ga0070713_100927468 3300005436 Bacteria 838
61 Ga0070701_10106131 3300005438 Bacteria 1563
62 Ga0070700_100441594 3300005441 Bacteria 988
63 Ga0070700_101676449 3300005441 Bacteria 545
64 Ga0070663_100109934 3300005455 Bacteria 2070
65 Ga0070663_101424376 3300005455 Bacteria 614
66 Ga0070678_100075223 3300005456 Bacteria 2540
67 Ga0070678_102364620 3300005456 Bacteria 505
68 Ga0070662_100365309 3300005457 Bacteria 1185
69 Ga0068867_100083780 3300005459 Bacteria 2407
70 Ga0068867_100156278 3300005459 Bacteria 1795
71 Ga0068867_100780091 3300005459 Bacteria 850
72 Ga0068867_101210810 3300005459 Bacteria 694
73 Ga0068867_101962847 3300005459 Bacteria 553
74 Ga0070685_10020865 3300005466 Bacteria 3551
75 Ga0070707_101867571 3300005468 Bacteria 568
76 Ga0070698_100160632 3300005471 Bacteria 2191
77 Ga0070699_100034126 3300005518 Bacteria 4397
78 Ga0070684_100516151 3300005535 Bacteria 1107
79 Ga0068853_100136897 3300005539 Bacteria 2196
80 Ga0068853_101920454 3300005539 Bacteria 574
81 Ga0070672_100032457 3300005543 Bacteria 3940
82 Ga0070672_100966772 3300005543 Bacteria 754
83 Ga0070686_100040959 3300005544 Bacteria 2892
84 Ga0070686_100236535 3300005544 Bacteria 1328
85 Ga0070693_100931868 3300005547 Bacteria 653
86 Ga0070665_100950493 3300005548 Bacteria 872
87 Ga0068855_101021272 3300005563 Bacteria 868
88 Ga0070664_100010649 3300005564 Bacteria 7451
89 Ga0070664_100015837 3300005564 Bacteria 6172
90 Ga0070664_100514204 3300005564 Bacteria 1105
91 Ga0070664_101238821 3300005564 Bacteria 704
92 Ga0068857_100231281 3300005577 Bacteria 1691
93 Ga0068857_101121929 3300005577 Unclassified 760
94 Ga0068857_101794662 3300005577 Bacteria 600
95 Ga0068857_101988804 3300005577 Bacteria 570
96 Ga0068854_100146844 3300005578 Bacteria 1815
97 Ga0068854_100160032 3300005578 Bacteria 1743
98 Ga0068854_100259451 3300005578 Bacteria 1391
99 Ga0068856_101244321 3300005614 Bacteria 760
100 Ga0070702_100279759 3300005615 Bacteria 1145
101 Ga0068852_100189926 3300005616 Bacteria 1938
102 Ga0068852_101250325 3300005616 Bacteria 764
103 Ga0068852_101447261 3300005616 Unclassified 709
104 Ga0068852_101470738 3300005616 Bacteria 703
105 Ga0068852_101702409 3300005616 Bacteria 653
106 Ga0068859_100171730 3300005617 Bacteria 2249
107 Ga0068859_100489003 3300005617 Bacteria 1326
108 Ga0068859_102277137 3300005617 Bacteria 598
109 Ga0068864_100077337 3300005618 Bacteria 2909
110 Ga0068864_100188696 3300005618 Bacteria 1888
111 Ga0068864_100395917 3300005618 Bacteria 1312
112 Ga0068864_101100437 3300005618 Bacteria 791
113 Ga0068866_11133940 3300005718 Bacteria 562
114 Ga0068861_100023101 3300005719 Bacteria 4483
115 Ga0068861_100052171 3300005719 Bacteria 3108
116 Ga0068861_100259484 3300005719 Bacteria 1487
117 Ga0068851_10092173 3300005834 Bacteria 1596
118 Ga0068863_100009065 3300005841 Bacteria 9715
119 Ga0068863_100015623 3300005841 Bacteria 7292
120 Ga0068863_100147532 3300005841 Bacteria 2250
121 Ga0068863_100553641 3300005841 Bacteria 1136
122 Ga0068863_100834637 3300005841 Bacteria 920
123 Ga0068863_101308479 3300005841 Unclassified 732
124 Ga0068858_100378691 3300005842 Bacteria 1358
125 Ga0068860_100084074 3300005843 Bacteria 3027
126 Ga0068860_100109260 3300005843 Bacteria 2643
127 Ga0068862_100299411 3300005844 Bacteria 1479
128 Ga0068862_100465713 3300005844 Bacteria 1194
129 Ga0068862_102154684 3300005844 Bacteria 569
130 Ga0070715_10081641 3300006163 Bacteria 1469
131 Ga0097621_100000603 3300006237 Bacteria 25339
132 Ga0097621_100013530 3300006237 Bacteria 6084
133 Ga0097621_100250070 3300006237 Bacteria 1552
134 Ga0097621_100792581 3300006237 Bacteria 877
135 Ga0097621_101154083 3300006237 Bacteria 729
136 Ga0097621_102101969 3300006237 Bacteria 540
137 Ga0068871_100001339 3300006358 Bacteria 16493
138 Ga0068871_100011948 3300006358 Bacteria 6391
139 Ga0068871_100024849 3300006358 Bacteria 4652
140 Ga0068871_100453614 3300006358 Bacteria 1150
141 Ga0068871_101159942 3300006358 Bacteria 724
142 Ga0075428_100090426 3300006844 Bacteria 3339
143 Ga0075428_101754769 3300006844 Unclassified 647
144 Ga0075430_101013181 3300006846 Bacteria 684
145 Ga0075431_100222812 3300006847 Bacteria 1924
146 Ga0075429_100010254 3300006880 Bacteria 8110
147 Ga0068865_100150910 3300006881 Bacteria 1763
148 Ga0068865_100296280 3300006881 Bacteria 1293
149 Ga0068865_100984166 3300006881 Bacteria 738
150 Ga0068865_101933847 3300006881 Bacteria 534
151 Ga0068865_102068492 3300006881 Bacteria 517
152 Ga0097620_100171738 3300006931 Bacteria 2249
153 Ga0097620_100488983 3300006931 Bacteria 1326
154 Ga0097620_102277156 3300006931 Bacteria 598
155 Ga0099795_10523564 3300007788 Bacteria 555
156 Ga0105240_10000020 3300009093 Bacteria 399699
157 Ga0105240_12265091 3300009093 Bacteria 563
158 Ga0111539_10324025 3300009094 Bacteria 1793
159 Ga0105241_12256670 3300009174 Unclassified 541
160 Ga0105242_10101319 3300009176 Bacteria 2440
161 Ga0105242_10253161 3300009176 Bacteria 1588
162 Ga0105242_10407435 3300009176 Bacteria 1271
163 Ga0105242_10419440 3300009176 Bacteria 1254
164 Ga0105242_10803208 3300009176 Unclassified 931
165 Ga0105242_11079187 3300009176 Bacteria 816
166 Ga0105242_11914987 3300009176 Bacteria 634
167 Ga0105248_10158918 3300009177 Bacteria 2550
168 Ga0105248_10174783 3300009177 Bacteria 2421
169 Ga0105238_10461989 3300009551 Bacteria 1267
170 Ga0105249_10002726 3300009553 Bacteria 15275
171 Ga0105249_10007861 3300009553 Bacteria 9289
172 Ga0105249_10685951 3300009553 Bacteria 1084
173 Ga0105249_12093086 3300009553 Bacteria 639
174 Ga0105239_10000631 3300010375 Bacteria 50176
175 Ga0105239_10493205 3300010375 Bacteria 1392
176 Ga0105239_13634949 3300010375 Bacteria 501
177 Ga0105246_10849176 3300011119 Bacteria 814
178 Ga0157373_11323124 3300013100 Bacteria 546
179 Ga0157371_10175117 3300013102 Unclassified 1534
180 Ga0157370_10063164 3300013104 Bacteria 3510
181 Ga0157374_10366834 3300013296 Bacteria 1433
182 Ga0157378_10010236 3300013297 Bacteria 8186
183 Ga0157378_10013577 3300013297 Bacteria 7123
184 Ga0157378_10083322 3300013297 Bacteria 2893
185 Ga0157378_10140393 3300013297 Bacteria 2243
186 Ga0163162_10001153 3300013306 Bacteria 24668
187 Ga0163162_10054907 3300013306 Bacteria 4008
188 Ga0163162_10275931 3300013306 Bacteria 1813
189 Ga0163162_10465585 3300013306 Bacteria 1396
190 Ga0157372_12062267 3300013307 Bacteria 655
191 Ga0157372_12394896 3300013307 Bacteria 606
192 Ga0157375_10001470 3300013308 Bacteria 20276
193 Ga0157375_10019913 3300013308 Bacteria 6118
194 Ga0157375_10033149 3300013308 Bacteria 4905
195 Ga0157375_10443450 3300013308 Bacteria 1464
196 Ga0157375_10506497 3300013308 Bacteria 1371
197 Ga0157375_10866654 3300013308 Bacteria 1049
198 Ga0157375_11209478 3300013308 Bacteria 887
199 Ga0157375_11351939 3300013308 Bacteria 838
200 Ga0157375_13051561 3300013308 Bacteria 559
201 Ga0163163_10283276 3300014325 Bacteria 1709
202 Ga0163163_11296318 3300014325 Unclassified 790
203 Ga0163163_12445313 3300014325 Bacteria 580
204 Ga0157380_10067892 3300014326 Bacteria 2872
205 Ga0157380_10800871 3300014326 Bacteria 959
206 Ga0157380_11097086 3300014326 Bacteria 835
207 Ga0157380_12481580 3300014326 Bacteria 584
208 Ga0157380_12846703 3300014326 Bacteria 550
209 Ga0157377_10037018 3300014745 Bacteria 2687
210 Ga0157377_10326165 3300014745 Bacteria 1022
211 Ga0157377_10983804 3300014745 Bacteria 637
212 Ga0157379_10014266 3300014968 Bacteria 6968
213 Ga0157379_10491430 3300014968 Bacteria 1137
214 Ga0157379_10792062 3300014968 Bacteria 894
215 Ga0157379_10968733 3300014968 Bacteria 810
216 Ga0157376_10000499 3300014969 Bacteria 25358
217 Ga0157376_10146603 3300014969 Bacteria 2124
218 Ga0157376_10379149 3300014969 Bacteria 1362
219 Ga0163161_10010043 3300017792 Bacteria 6554
220 Ga0163161_10067029 3300017792 Bacteria 2621
221 Ga0209148_1050291 3300025254 Unclassified 539
222 Ga0207666_1025028 3300025271 Bacteria 894
223 Ga0209455_1007389 3300025272 Bacteria 3106
224 Ga0207656_10058696 3300025321 Bacteria 1682
225 Ga0207656_10246694 3300025321 Bacteria 874
226 Ga0207682_10059805 3300025893 Bacteria 1593
227 Ga0207688_10115240 3300025901 Bacteria 1564
228 Ga0207688_10429020 3300025901 Bacteria 822
229 Ga0207680_10030924 3300025903 Bacteria 3027
230 Ga0207680_10924335 3300025903 Bacteria 625
231 Ga0207645_10152936 3300025907 Bacteria 1507
232 Ga0207645_10432032 3300025907 Bacteria 888
233 Ga0207684_10987653 3300025910 Bacteria 705
234 Ga0207695_10000020 3300025913 Bacteria 723025
235 Ga0207662_10027454 3300025918 Bacteria 3284
236 Ga0207662_10131201 3300025918 Bacteria 1580
237 Ga0207662_10486600 3300025918 Bacteria 848
238 Ga0207649_10506513 3300025920 Bacteria 919
239 Ga0207649_10599419 3300025920 Bacteria 847
240 Ga0207649_11125060 3300025920 Unclassified 620
241 Ga0207681_10036449 3300025923 Bacteria 3245
242 Ga0207681_11703647 3300025923 Bacteria 527
243 Ga0207650_10083588 3300025925 Bacteria 2425
244 Ga0207650_10346321 3300025925 Unclassified 1221
245 Ga0207650_11101025 3300025925 Unclassified 676
246 Ga0207659_10645528 3300025926 Bacteria 904
247 Ga0207659_10812276 3300025926 Bacteria 803
248 Ga0207644_10016691 3300025931 Bacteria 4943
249 Ga0207644_10027330 3300025931 Bacteria 3941
250 Ga0207690_10689187 3300025932 Unclassified 839
251 Ga0207706_10299480 3300025933 Bacteria 1401
252 Ga0207686_10261304 3300025934 Bacteria 1269
253 Ga0207686_10521713 3300025934 Unclassified 925
254 Ga0207686_10728280 3300025934 Bacteria 790
255 Ga0207686_11814029 3300025934 Bacteria 505
256 Ga0207709_11201308 3300025935 Bacteria 625
257 Ga0207670_10026209 3300025936 Bacteria 3671
258 Ga0207670_10737149 3300025936 Bacteria 818
259 Ga0207704_10230288 3300025938 Bacteria 1377
260 Ga0207704_11129199 3300025938 Unclassified 667
261 Ga0207704_11726318 3300025938 Unclassified 538
262 Ga0207691_10153186 3300025940 Unclassified 2026
263 Ga0207691_10365999 3300025940 Bacteria 1232
264 Ga0207691_10509492 3300025940 Bacteria 1022
265 Ga0207711_10101179 3300025941 Bacteria 2550
266 Ga0207711_10449064 3300025941 Bacteria 1200
267 Ga0207689_10025526 3300025942 Bacteria 4952
268 Ga0207689_10067625 3300025942 Bacteria 2936
269 Ga0207689_10115148 3300025942 Bacteria 2210
270 Ga0207689_10600194 3300025942 Bacteria 926
271 Ga0207661_10094851 3300025944 Bacteria 2493
272 Ga0207679_10015360 3300025945 Bacteria 5058
273 Ga0207679_10045098 3300025945 Bacteria 3186
274 Ga0207679_10940991 3300025945 Bacteria 791
275 Ga0207651_10313768 3300025960 Bacteria 1308
276 Ga0207651_10946788 3300025960 Bacteria 768
277 Ga0207651_11397762 3300025960 Bacteria 630
278 Ga0207712_10001133 3300025961 Bacteria 18560
279 Ga0207712_10645280 3300025961 Bacteria 920
280 Ga0207668_10198324 3300025972 Bacteria 1596
281 Ga0207640_10724901 3300025981 Bacteria 855
282 Ga0207640_12024564 3300025981 Bacteria 522
283 Ga0207658_10140244 3300025986 Bacteria 1955
284 Ga0207658_10421898 3300025986 Unclassified 1176
285 Ga0207658_10475863 3300025986 Bacteria 1109
286 Ga0207658_10513920 3300025986 Bacteria 1068
287 Ga0207658_10691033 3300025986 Bacteria 922
288 Ga0207658_11112437 3300025986 Unclassified 722
289 Ga0207658_11153846 3300025986 Unclassified 708
290 Ga0207677_10011228 3300026023 Bacteria 5098
291 Ga0207677_10074716 3300026023 Bacteria 2406
292 Ga0207703_10313061 3300026035 Bacteria 1435
293 Ga0207703_10435910 3300026035 Bacteria 1222
294 Ga0207639_11300302 3300026041 Bacteria 682
295 Ga0207678_10110181 3300026067 Bacteria 2349
296 Ga0207678_11219564 3300026067 Bacteria 666
297 Ga0207708_10493342 3300026075 Bacteria 1025
298 Ga0207641_10000368 3300026088 Bacteria 53493
299 Ga0207641_10017117 3300026088 Bacteria 5931
300 Ga0207641_10705448 3300026088 Bacteria 994
301 Ga0207641_10768904 3300026088 Bacteria 951
302 Ga0207641_10874932 3300026088 Bacteria 891
303 Ga0207641_11750845 3300026088 Unclassified 623
304 Ga0207641_12053988 3300026088 Bacteria 573
305 Ga0207648_10072014 3300026089 Bacteria 3012
306 Ga0207648_10119769 3300026089 Bacteria 2314
307 Ga0207648_10156907 3300026089 Bacteria 2009
308 Ga0207648_10412023 3300026089 Bacteria 1226
309 Ga0207648_10519738 3300026089 Bacteria 1091
310 Ga0207676_10564858 3300026095 Bacteria 1089
311 Ga0207676_10967719 3300026095 Bacteria 837
312 Ga0207676_11117696 3300026095 Bacteria 779
313 Ga0207676_11891069 3300026095 Bacteria 595
314 Ga0207674_11242025 3300026116 Unclassified 715
315 Ga0207674_11849967 3300026116 Bacteria 570
316 Ga0207675_100006349 3300026118 Bacteria 11206
317 Ga0207675_100110326 3300026118 Bacteria 2596
318 Ga0207675_100288667 3300026118 Bacteria 1596
319 Ga0207675_100567887 3300026118 Bacteria 1135
320 Ga0207675_100722026 3300026118 Bacteria 1006
321 Ga0207675_102484558 3300026118 Bacteria 529
322 Ga0207683_10022162 3300026121 Bacteria 5451
323 Ga0207683_11701066 3300026121 Bacteria 580
324 Ga0207698_10607257 3300026142 Bacteria 1079
325 Ga0207698_11257242 3300026142 Unclassified 755
326 Ga0268266_11685219 3300028379 Bacteria 609
327 Ga0268265_10632930 3300028380 Bacteria 1026
328 Ga0268264_10089335 3300028381 Bacteria 2653
329 Ga0268264_10173165 3300028381 Bacteria 1954
330 Ga0268264_10938804 3300028381 Bacteria 870
331 Ga0268264_11830756 3300028381 Bacteria 617
332 Ga0265334_10089834 3300028573 Bacteria 1122
333 Ga0265340_10046042 3300031247 Bacteria 2129
334 Ga0265340_10342519 3300031247 Bacteria 661
335 Ga0265327_10000452 3300031251 Bacteria 73846
336 Ga0265313_10235054 3300031595 Bacteria 752
337 Ga0373957_0154611 3300035120 Bacteria 943
338 Ga0373955_0369904 3300035172 Bacteria 869
339 Ga0373937_0350451 3300036401 Bacteria 1398
340 Ga0373937_0365383 3300036401 Bacteria 1368
341 Ga0373937_1039449 3300036401 Bacteria 768
342 Ga0451800_0856371 3300041459 Unclassified 702
343 Ga0439443_115986 3300042003 Bacteria 523
344 Ga0450923_003673 3300042125 Bacteria 2345
345 Ga0439435_0190297 3300042436 Bacteria 673
346 Ga0453684_0660939 3300044712 Bacteria 1139
347 Ga0495592_0198618 3300046454 Bacteria 1355
348 Ga0495592_0246152 3300046454 Bacteria 1184
349 Ga0495664_0283105 3300046477 Unclassified 1002
350 Ga0495606_0015092 3300046507 Bacteria 5978
351 Ga0495608_0725897 3300046511 Unclassified 590
352 Ga0495628_0017613 3300046516 Bacteria 5942
353 Ga0495630_0100432 3300046517 Bacteria 2189
354 Ga0495652_0665839 3300046529 Bacteria 703
355 Ga0495586_0043647 3300046535 Bacteria 2415
356 Ga0495587_0025513 3300046536 Bacteria 3612
357 Ga0495645_0441021 3300046543 Bacteria 823
358 Ga0495667_0183794 3300046559 Bacteria 1341
359 Ga0495625_0167123 3300046660 Bacteria 1470
360 Ga0495657_0360711 3300046675 Bacteria 859
361 Ga0495599_0214999 3300046678 Bacteria 1178
362 Ga0495613_0461358 3300046689 Bacteria 860
363 Ga0495600_0315648 3300046809 Bacteria 984
364 Ga0495674_0330697 3300047319 Bacteria 1240
365 Ga0495674_0655017 3300047319 Bacteria 828
366 Ga0495672_0400041 3300047320 Bacteria 628
367 Ga0495680_0520802 3300047322 Bacteria 805
368 Ga0495680_0651215 3300047322 Bacteria 700
369 Ga0495675_0241603 3300047444 Bacteria 1087
370 Ga0495675_0420100 3300047444 Unclassified 777
371 Ga0495684_0162720 3300047471 Bacteria 1664
372 Ga0495684_0547190 3300047471 Bacteria 789
373 Ga0496100_0064140 3300048903 Bacteria 2430
374 Ga0496101_0049862 3300048904 Bacteria 3012
375 Ga0496102_1815910 3300048905 Bacteria 527
376 Ga0496105_0354680 3300048908 Bacteria 1171
377 Ga0496107_0372377 3300048910 Bacteria 1062
378 Ga0496114_0067507 3300048917 Bacteria 3000
379 Ga0501034_0511384 3300049571 Bacteria 1114
380 Ga0501046_1104572 3300049580 Bacteria 548
381 Ga0501047_0006115 3300049581 Bacteria 11312
382 Ga0501044_0490958 3300049823 Bacteria 1130
383 nmdc:mga09592_8533_c1 3300050508 Bacteria 8335
384 nmdc:mga06r32_282076_c1 3300050510 Bacteria 1648
385 nmdc:mga08y16_1876000_c1 3300050511 Unclassified 551
386 nmdc:mga08x19_960398_c1 3300050514 Bacteria 607
387 Ga0495619_0896625 3300053085 Unclassified 597
388 Ga0070687_100091203
389 rootL2_10168281
390 rootL2_10275753
391 Ga0055529_1026171
392 Ga0065704_10184065
393 Ga0065712_10071173
394 Ga0065715_10271997
395 Ga0070676_10039013
396 Ga0070676_10123414
397 Ga0070676_10697886
398 Ga0070676_11599381
399 Ga0070683_100033081
400 Ga0070683_100792796
401 Ga0070690_100006529
402 Ga0070670_100104606
403 Ga0070670_100392176
404 Ga0070670_100499509
405 Ga0070677_10321002
406 Ga0070677_10609003
407 Ga0068869_100053632
408 Ga0068869_100258860
409 Ga0068869_100611159
410 Ga0068869_101226836
411 Ga0070666_10044304
412 Ga0070682_100895006
413 Ga0068868_100064681
414 Ga0068868_100273980
415 Ga0068868_102169782
416 Ga0070689_100038671
417 Ga0070689_101585185
418 Ga0070687_100115906
419 Ga0070687_101421402
420 Ga0070661_100178446
421 Ga0070661_100833568
422 Ga0070661_101168542
423 Ga0070668_100214123
424 Ga0070668_101277523
425 Ga0070669_100143350
426 Ga0070669_100565892
427 Ga0070675_100596105
428 Ga0070675_101166649
429 Ga0070671_100038014
430 Ga0070671_100116921
431 Ga0070674_100112043
432 Ga0070673_100100534
433 Ga0070673_100468381
434 Ga0070673_100949786
435 Ga0070673_101709595
436 Ga0070688_100051357
437 Ga0070688_100058786
438 Ga0070688_101581937
439 Ga0070659_100223701
440 Ga0070659_100964406
441 Ga0070667_100188830
442 Ga0070667_100296146
443 Ga0070667_100299553
444 Ga0070667_100375388
445 Ga0070667_100865157
446 Ga0070667_101738348
447 Ga0070713_100927468
448 Ga0070701_10106131
449 Ga0070700_100441594
450 Ga0070700_101676449
451 Ga0070663_100109934
452 Ga0070663_101424376
453 Ga0070678_100075223
454 Ga0070678_102364620
455 Ga0070662_100365309
456 Ga0068867_100083780
457 Ga0068867_100156278
458 Ga0068867_100780091
459 Ga0068867_101210810
460 Ga0068867_101962847
461 Ga0070685_10020865
462 Ga0070707_101867571
463 Ga0070698_100160632
464 Ga0070699_100034126
465 Ga0070684_100516151
466 Ga0068853_100136897
467 Ga0068853_101920454
468 Ga0070672_100032457
469 Ga0070672_100966772
470 Ga0070686_100040959
471 Ga0070686_100236535
472 Ga0070693_100931868
473 Ga0070665_100950493
474 Ga0068855_101021272
475 Ga0070664_100010649
476 Ga0070664_100015837
477 Ga0070664_100514204
478 Ga0070664_101238821
479 Ga0068857_100231281
480 Ga0068857_101121929
481 Ga0068857_101794662
482 Ga0068857_101988804
483 Ga0068854_100146844
484 Ga0068854_100160032
485 Ga0068854_100259451
486 Ga0068856_101244321
487 Ga0070702_100279759
488 Ga0068852_100189926
489 Ga0068852_101250325
490 Ga0068852_101447261
491 Ga0068852_101470738
492 Ga0068852_101702409
493 Ga0068859_100171730
494 Ga0068859_100489003
495 Ga0068859_102277137
496 Ga0068864_100077337
497 Ga0068864_100188696
498 Ga0068864_100395917
499 Ga0068864_101100437
500 Ga0068866_11133940
501 Ga0068861_100023101
502 Ga0068861_100052171
503 Ga0068861_100259484
504 Ga0068851_10092173
505 Ga0068863_100009065
506 Ga0068863_100015623
507 Ga0068863_100147532
508 Ga0068863_100553641
509 Ga0068863_100834637
510 Ga0068863_101308479
511 Ga0068858_100378691
512 Ga0068860_100084074
513 Ga0068860_100109260
514 Ga0068862_100299411
515 Ga0068862_100465713
516 Ga0068862_102154684
517 Ga0070715_10081641
518 Ga0097621_100000603
519 Ga0097621_100013530
520 Ga0097621_100250070
521 Ga0097621_100792581
522 Ga0097621_101154083
523 Ga0097621_102101969
524 Ga0068871_100001339
525 Ga0068871_100011948
526 Ga0068871_100024849
527 Ga0068871_100453614
528 Ga0068871_101159942
529 Ga0075428_100090426
530 Ga0075428_101754769
531 Ga0075430_101013181
532 Ga0075431_100222812
533 Ga0075429_100010254
534 Ga0068865_100150910
535 Ga0068865_100296280
536 Ga0068865_100984166
537 Ga0068865_101933847
538 Ga0068865_102068492
539 Ga0097620_100171738
540 Ga0097620_100488983
541 Ga0097620_102277156
542 Ga0099795_10523564
543 Ga0105240_10000020
544 Ga0105240_12265091
545 Ga0111539_10324025
546 Ga0105241_12256670
547 Ga0105242_10101319
548 Ga0105242_10253161
549 Ga0105242_10407435
550 Ga0105242_10419440
551 Ga0105242_10803208
552 Ga0105242_11079187
553 Ga0105242_11914987
554 Ga0105248_10158918
555 Ga0105248_10174783
556 Ga0105238_10461989
557 Ga0105249_10002726
558 Ga0105249_10007861
559 Ga0105249_10685951
560 Ga0105249_12093086
561 Ga0105239_10000631
562 Ga0105239_10493205
563 Ga0105239_13634949
564 Ga0105246_10849176
565 Ga0157373_11323124
566 Ga0157371_10175117
567 Ga0157370_10063164
568 Ga0157374_10366834
569 Ga0157378_10010236
570 Ga0157378_10013577
571 Ga0157378_10083322
572 Ga0157378_10140393
573 Ga0163162_10001153
574 Ga0163162_10054907
575 Ga0163162_10275931
576 Ga0163162_10465585
577 Ga0157372_12062267
578 Ga0157372_12394896
579 Ga0157375_10001470
580 Ga0157375_10019913
581 Ga0157375_10033149
582 Ga0157375_10443450
583 Ga0157375_10506497
584 Ga0157375_10866654
585 Ga0157375_11209478
586 Ga0157375_11351939
587 Ga0157375_13051561
588 Ga0163163_10283276
589 Ga0163163_11296318
590 Ga0163163_12445313
591 Ga0157380_10067892
592 Ga0157380_10800871
593 Ga0157380_11097086
594 Ga0157380_12481580
595 Ga0157380_12846703
596 Ga0157377_10037018
597 Ga0157377_10326165
598 Ga0157377_10983804
599 Ga0157379_10014266
600 Ga0157379_10491430
601 Ga0157379_10792062
602 Ga0157379_10968733
603 Ga0157376_10000499
604 Ga0157376_10146603
605 Ga0157376_10379149
606 Ga0163161_10010043
607 Ga0163161_10067029
608 Ga0209148_1050291
609 Ga0207666_1025028
610 Ga0209455_1007389
611 Ga0207656_10058696
612 Ga0207656_10246694
613 Ga0207682_10059805
614 Ga0207688_10115240
615 Ga0207688_10429020
616 Ga0207680_10030924
617 Ga0207680_10924335
618 Ga0207645_10152936
619 Ga0207645_10432032
620 Ga0207684_10987653
621 Ga0207695_10000020
622 Ga0207662_10027454
623 Ga0207662_10131201
624 Ga0207662_10486600
625 Ga0207649_10506513
626 Ga0207649_10599419
627 Ga0207649_11125060
628 Ga0207681_10036449
629 Ga0207681_11703647
630 Ga0207650_10083588
631 Ga0207650_10346321
632 Ga0207650_11101025
633 Ga0207659_10645528
634 Ga0207659_10812276
635 Ga0207644_10016691
636 Ga0207644_10027330
637 Ga0207690_10689187
638 Ga0207706_10299480
639 Ga0207686_10261304
640 Ga0207686_10521713
641 Ga0207686_10728280
642 Ga0207686_11814029
643 Ga0207709_11201308
644 Ga0207670_10026209
645 Ga0207670_10737149
646 Ga0207704_10230288
647 Ga0207704_11129199
648 Ga0207704_11726318
649 Ga0207691_10153186
650 Ga0207691_10365999
651 Ga0207691_10509492
652 Ga0207711_10101179
653 Ga0207711_10449064
654 Ga0207689_10025526
655 Ga0207689_10067625
656 Ga0207689_10115148
657 Ga0207689_10600194
658 Ga0207661_10094851
659 Ga0207679_10015360
660 Ga0207679_10045098
661 Ga0207679_10940991
662 Ga0207651_10313768
663 Ga0207651_10946788
664 Ga0207651_11397762
665 Ga0207712_10001133
666 Ga0207712_10645280
667 Ga0207668_10198324
668 Ga0207640_10724901
669 Ga0207640_12024564
670 Ga0207658_10140244
671 Ga0207658_10421898
672 Ga0207658_10475863
673 Ga0207658_10513920
674 Ga0207658_10691033
675 Ga0207658_11112437
676 Ga0207658_11153846
677 Ga0207677_10011228
678 Ga0207677_10074716
679 Ga0207703_10313061
680 Ga0207703_10435910
681 Ga0207639_11300302
682 Ga0207678_10110181
683 Ga0207678_11219564
684 Ga0207708_10493342
685 Ga0207641_10000368
686 Ga0207641_10017117
687 Ga0207641_10705448
688 Ga0207641_10768904
689 Ga0207641_10874932
690 Ga0207641_11750845
691 Ga0207641_12053988
692 Ga0207648_10072014
693 Ga0207648_10119769
694 Ga0207648_10156907
695 Ga0207648_10412023
696 Ga0207648_10519738
697 Ga0207676_10564858
698 Ga0207676_10967719
699 Ga0207676_11117696
700 Ga0207676_11891069
701 Ga0207674_11242025
702 Ga0207674_11849967
703 Ga0207675_100006349
704 Ga0207675_100110326
705 Ga0207675_100288667
706 Ga0207675_100567887
707 Ga0207675_100722026
708 Ga0207675_102484558
709 Ga0207683_10022162
710 Ga0207683_11701066
711 Ga0207698_10607257
712 Ga0207698_11257242
713 Ga0268266_11685219
714 Ga0268265_10632930
715 Ga0268264_10089335
716 Ga0268264_10173165
717 Ga0268264_10938804
718 Ga0268264_11830756
719 Ga0265334_10089834
720 Ga0265340_10046042
721 Ga0265340_10342519
722 Ga0265327_10000452
723 Ga0265313_10235054
724 Ga0373957_0154611
725 Ga0373955_0369904
726 Ga0373937_0350451
727 Ga0373937_0365383
728 Ga0373937_1039449
729 Ga0451800_0856371
730 Ga0439443_115986
731 Ga0450923_003673
732 Ga0439435_0190297
733 Ga0453684_0660939
734 Ga0495592_0198618
735 Ga0495592_0246152
736 Ga0495664_0283105
737 Ga0495606_0015092
738 Ga0495608_0725897
739 Ga0495628_0017613
740 Ga0495630_0100432
741 Ga0495652_0665839
742 Ga0495586_0043647
743 Ga0495587_0025513
744 Ga0495645_0441021
745 Ga0495667_0183794
746 Ga0495625_0167123
747 Ga0495657_0360711
748 Ga0495599_0214999
749 Ga0495613_0461358
750 Ga0495600_0315648
751 Ga0495674_0330697
752 Ga0495674_0655017
753 Ga0495672_0400041
754 Ga0495680_0520802
755 Ga0495680_0651215
756 Ga0495675_0241603
757 Ga0495675_0420100
758 Ga0495684_0162720
759 Ga0495684_0547190
760 Ga0496100_0064140
761 Ga0496101_0049862
762 Ga0496102_1815910
763 Ga0496105_0354680
764 Ga0496107_0372377
765 Ga0496114_0067507
766 Ga0501034_0511384
767 Ga0501046_1104572
768 Ga0501047_0006115
769 Ga0501044_0490958
770 nmdc:mga09592_8533_c1
771 nmdc:mga06r32_282076_c1
772 nmdc:mga08y16_1876000_c1
773 nmdc:mga08x19_960398_c1
774 Ga0495619_0896625

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f0u-assembly1.cif.gz_A crystal structure of gold binding protein 0.899 3 68
7zc3-assembly1.cif.gz_A crystal structure of human copper chaperone atox1 bound to zinc ion by cxxc motif 0.8857 1 69
5f0u-assembly1.cif.gz_A crystal structure of gold binding protein 0.8738 3 68
4a47-assembly1.cif.gz_A crosstalk between cu(i) and zn(ii) homeostasis 0.8554 4 66
7zc3-assembly1.cif.gz_A crystal structure of human copper chaperone atox1 bound to zinc ion by cxxc motif 0.8507 1 69
ID Description Score Start End Superfamily
4y2iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9067 3 68 3.30.70.100
4y2iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8811 3 68 3.30.70.100
af_A0A0R0EEE4_43_107_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8798 1 66 3.30.70.100
af_P35670_53_127_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8776 1 69 3.30.70.100
af_A0A1D6MTC1_251_315_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8737 1 66 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A537HR61-F1-model_v4 Uncharacterized protein 1.003 1 69
AF-A0A1I1PQE1-F1-model_v4 Uncharacterized protein 1.003 1 69
AF-A0A521N7H0-F1-model_v4 Uncharacterized protein 0.9966 1 69
AF-A0A385BTF9-F1-model_v4 HMA domain-containing protein 0.9962 1 69
AF-A0A0Q0RU57-F1-model_v4 Methyltransferase type 11 0.9944 1 69 GO:0008168
GO:0032259

Map