F430680

General Info

Members Datasets Scaffolds Average Seq Length
386 241 772 167

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2547132111|2547406519
Length 182
Sequence LIVLVGPMGVGKSTVGQLLAERLGTGYRDTDADIVAAQGRTIAEIFVDDGESAFRALEKEAVRTALAEHEGVLALGGGAILDADTRGLLAGRQVVYLSMDVEEAVRRTGLNTARPLLAVNPRKQWRELMEARRHLYEEVATVVVATDGRTPEEVTRAALDALESKSVSPGDAPGTPGRRTLR

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
5 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
6 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
7 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
8 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
9 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
10 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
11 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
12 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
13 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
14 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
17 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
18 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
19 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
20 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
21 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
22 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
23 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
24 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
25 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
26 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
27 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
28 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
29 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
30 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
31 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
32 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
33 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
34 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
35 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
36 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
37 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
38 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
39 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
40 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
41 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
42 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
43 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
44 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
45 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
46 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
47 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
48 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
49 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
50 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
51 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
52 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
53 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
54 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
55 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
56 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
57 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
58 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
59 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
60 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
61 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
62 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
63 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
64 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
65 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
66 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
71 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
72 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
73 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
74 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
75 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
76 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
77 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
78 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
79 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
80 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
81 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
82 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
83 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
84 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
85 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
86 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
87 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
88 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
89 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
90 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
91 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
92 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
93 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
94 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
95 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
96 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
97 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
98 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
99 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
104 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
105 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
106 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
107 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
108 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
117 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
124 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
125 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
126 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
127 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
132 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
133 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
137 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
143 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
147 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
148 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
176 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
177 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
178 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
179 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
180 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
181 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
182 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
183 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
184 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
185 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
186 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
187 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
188 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
189 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
190 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
191 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
192 2643221647 Streptomyces sp. Root369 Isolate Unclassified
193 2643221670 Streptomyces sp. Root431 Isolate Unclassified
194 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
195 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
196 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
197 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
198 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
199 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
200 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
201 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
202 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
203 2808606448 Streptomyces sp. 193411 Isolate Unclassified
204 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
205 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
206 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
207 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
208 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
209 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
210 2862574272 Streptomyces sp. AcE210 Isolate Nodule
211 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
212 2867428634 Streptomyces sp. RP5T Isolate Unclassified
213 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
214 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
215 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
216 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
217 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
218 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
219 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
220 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
221 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
222 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
223 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
224 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
225 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
226 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
227 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
228 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
229 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
230 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
231 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
232 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
233 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
234 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
235 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
236 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
237 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
238 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
239 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
240 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
241 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.97
Metatranscriptomes 0.26
Isolates 14.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.15
Nodule 1.04
Rhizoplane 1.04
Rhizosphere 79.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10033897 3300001990 Bacteria 1585
2 Ga0006562J51391_1114890 3300003578 Bacteria 3750
3 Ga0068869_100673347 3300005334 Bacteria 880
4 Ga0075365_10099608 3300006038 Bacteria 1989
5 Ga0075363_100041901 3300006048 Bacteria 2416
6 Ga0075367_10008484 3300006178 Bacteria 5325
7 Ga0099826_10022112 3300006948 Bacteria 4757
8 Ga0105239_11472660 3300010375 Bacteria 786
9 Ga0105246_10005653 3300011119 Bacteria 7629
10 Ga0157369_10844502 3300013105 Bacteria 940
11 Ga0182008_10000988 3300014497 Bacteria 19736
12 Ga0182006_1038947 3300015261 Bacteria 1878
13 Ga0182007_10000233 3300015262 Bacteria 37325
14 Ga0207702_10374464 3300026078 Bacteria 1368
15 Ga0207674_10675884 3300026116 Bacteria 997
16 Ga0209371_1019129 3300027312 Bacteria 1716
17 Ga0209371_1044935 3300027312 Bacteria 876
18 Ga0307517_10006575 3300028786 Bacteria 17165
19 Ga0307515_10002608 3300028794 Bacteria 38833
20 Ga0307515_10242460 3300028794 Bacteria 1570
21 Ga0268256_1020870 3300030500 Bacteria 1756
22 Ga0268256_1028431 3300030500 Bacteria 1381
23 Ga0307511_10004244 3300030521 Bacteria 14631
24 Ga0307511_10052842 3300030521 Bacteria 3230
25 Ga0307511_10167312 3300030521 Bacteria 1217
26 Ga0307512_10022223 3300030522 Bacteria 5705
27 Ga0307512_10041864 3300030522 Bacteria 3802
28 Ga0307513_10033849 3300031456 Bacteria 5739
29 Ga0307509_10034363 3300031507 Bacteria 5570
30 Ga0307509_10035488 3300031507 Bacteria 5472
31 Ga0307509_10036407 3300031507 Bacteria 5388
32 Ga0307408_101230013 3300031548 Bacteria 700
33 Ga0307508_10004671 3300031616 Bacteria 13285
34 Ga0307508_10014305 3300031616 Bacteria 7239
35 Ga0307508_10037263 3300031616 Bacteria 4375
36 Ga0307508_10350424 3300031616 Bacteria 1068
37 Ga0307514_10130546 3300031649 Bacteria 1731
38 Ga0307516_10017376 3300031730 Bacteria 7502
39 Ga0307516_10244157 3300031730 Bacteria 1493
40 Ga0307518_10019613 3300031838 Bacteria 4856
41 Ga0307518_10043040 3300031838 Bacteria 3287
42 Ga0307410_10493761 3300031852 Bacteria 1006
43 Ga0307507_10023054 3300033179 Bacteria 6851
44 Ga0307507_10091054 3300033179 Bacteria 2613
45 Ga0307510_10025621 3300033180 Bacteria 6797
46 Ga0307510_10027250 3300033180 Bacteria 6551
47 Ga0307510_10213641 3300033180 Bacteria 1448
48 Ga0307510_10265060 3300033180 Bacteria 1197
49 Ga0373945_0422976 3300035116 Bacteria 586
50 Ga0395899_0284038 3300037312 Bacteria 1125
51 Ga0395900_0295853 3300037418 Bacteria 1606
52 Ga0395905_0125650 3300037471 Bacteria 2412
53 Ga0439436_0002040 3300041404 Bacteria 6011
54 Ga0439439_0001308 3300041406 Bacteria 4887
55 Ga0439439_0006978 3300041406 Bacteria 2628
56 Ga0451789_1015524 3300041443 Bacteria 737
57 Ga0451807_2695814 3300041486 Bacteria 1163
58 Ga0451853_3387313 3300041512 Bacteria 1708
59 Ga0439433_0029887 3300041999 Bacteria 1244
60 Ga0439442_044454 3300042002 Bacteria 936
61 Ga0439442_047235 3300042002 Bacteria 907
62 Ga0439448_0005783 3300042005 Bacteria 3533
63 Ga0439448_0043136 3300042005 Bacteria 1464
64 Ga0439449_0001359 3300042007 Bacteria 9582
65 Ga0439455_0006207 3300042012 Bacteria 2469
66 Ga0439457_000613 3300042014 Bacteria 10525
67 Ga0439457_001721 3300042014 Bacteria 6485
68 Ga0439457_052178 3300042014 Bacteria 919
69 Ga0439462_0011495 3300042015 Bacteria 2254
70 Ga0450890_021744 3300042127 Bacteria 874
71 Ga0450894_003830 3300042131 Bacteria 1966
72 Ga0450896_010669 3300042133 Bacteria 1289
73 Ga0450898_031418 3300042134 Bacteria 976
74 Ga0450899_002545 3300042135 Bacteria 1967
75 Ga0450903_000035 3300042138 Bacteria 27336
76 Ga0450906_004484 3300042145 Bacteria 2923
77 Ga0439458_0069479 3300042157 Bacteria 888
78 Ga0466969_0047446 3300044656 Bacteria 2126
79 Ga0466972_0000856 3300044658 Bacteria 14601
80 Ga0466972_0007453 3300044658 Bacteria 5499
81 Ga0466972_0009861 3300044658 Bacteria 4796
82 Ga0466972_0231009 3300044658 Bacteria 866
83 Ga0466966_0013191 3300044684 Bacteria 5472
84 Ga0466966_0060650 3300044684 Bacteria 2387
85 Ga0466966_0133283 3300044684 Bacteria 1520
86 Ga0466961_0019498 3300044693 Bacteria 4362
87 Ga0466961_0034774 3300044693 Bacteria 3235
88 Ga0466961_0481359 3300044693 Bacteria 750
89 Ga0466963_0003307 3300044694 Bacteria 9197
90 Ga0466963_0012550 3300044694 Bacteria 5190
91 Ga0466963_0054879 3300044694 Bacteria 2649
92 Ga0466963_0236250 3300044694 Bacteria 1281
93 Ga0466963_0649802 3300044694 Bacteria 744
94 Ga0466963_0935916 3300044694 Bacteria 610
95 Ga0466964_0204602 3300044706 Bacteria 950
96 Ga0466971_0037422 3300044719 Bacteria 2174
97 Ga0466968_0075657 3300044735 Bacteria 1472
98 Ga0466970_0018751 3300044765 Bacteria 3585
99 Ga0466970_0200098 3300044765 Bacteria 1111
100 Ga0466970_0485812 3300044765 Bacteria 710
101 Ga0466957_0396166 3300044842 Bacteria 944
102 Ga0466957_0594151 3300044842 Bacteria 774
103 Ga0466960_0008149 3300044901 Bacteria 4282
104 Ga0466960_0127543 3300044901 Bacteria 1339
105 Ga0466960_0624065 3300044901 Bacteria 641
106 Ga0466959_0137694 3300045049 Bacteria 1727
107 Ga0466959_0241667 3300045049 Bacteria 1247
108 Ga0466958_0064603 3300045836 Bacteria 2233
109 Ga0466958_0079839 3300045836 Bacteria 2012
110 Ga0466967_0042786 3300045976 Bacteria 3917
111 Ga0466967_0257385 3300045976 Bacteria 1669
112 Ga0466967_0296999 3300045976 Bacteria 1553
113 Ga0466967_0371191 3300045976 Bacteria 1388
114 Ga0466967_0407000 3300045976 Bacteria 1324
115 Ga0466967_0552631 3300045976 Bacteria 1133
116 Ga0495592_0016299 3300046454 Bacteria 5639
117 Ga0495592_0038153 3300046454 Bacteria 3615
118 Ga0495603_0013742 3300046455 Bacteria 4898
119 Ga0495603_0020755 3300046455 Bacteria 3978
120 Ga0495590_0019395 3300046457 Bacteria 2424
121 Ga0495629_0016734 3300046459 Bacteria 5262
122 Ga0495629_0026156 3300046459 Bacteria 4146
123 Ga0495629_0105827 3300046459 Bacteria 1962
124 Ga0495629_0118395 3300046459 Bacteria 1845
125 Ga0495638_0084987 3300046460 Bacteria 1914
126 Ga0495638_0125867 3300046460 Bacteria 1510
127 Ga0495651_0000887 3300046462 Bacteria 23316
128 Ga0495651_0035341 3300046462 Bacteria 3891
129 Ga0495580_0088769 3300046472 Bacteria 2153
130 Ga0495582_0092498 3300046473 Bacteria 1687
131 Ga0495582_0212677 3300046473 Bacteria 1105
132 Ga0495605_0001852 3300046474 Bacteria 13530
133 Ga0495605_0129384 3300046474 Bacteria 1139
134 Ga0495662_0008535 3300046476 Bacteria 5035
135 Ga0495662_0087749 3300046476 Bacteria 1515
136 Ga0495662_0162240 3300046476 Bacteria 1101
137 Ga0495662_0169559 3300046476 Bacteria 1075
138 Ga0495664_0003842 3300046477 Bacteria 8202
139 Ga0495664_0065712 3300046477 Bacteria 2162
140 Ga0495594_0018848 3300046499 Bacteria 3661
141 Ga0495594_0684091 3300046499 Bacteria 580
142 Ga0495596_0018788 3300046500 Bacteria 2847
143 Ga0495607_0029640 3300046501 Bacteria 3366
144 Ga0495583_0076761 3300046506 Bacteria 1458
145 Ga0495583_0082244 3300046506 Bacteria 1397
146 Ga0495606_0099060 3300046507 Bacteria 1777
147 Ga0495608_0149242 3300046511 Bacteria 1490
148 Ga0495610_0041496 3300046512 Bacteria 2309
149 Ga0495610_0245626 3300046512 Bacteria 711
150 Ga0495616_0002501 3300046513 Bacteria 12156
151 Ga0495618_0010566 3300046514 Bacteria 5586
152 Ga0495618_0114535 3300046514 Bacteria 1726
153 Ga0495620_0019145 3300046515 Bacteria 3374
154 Ga0495620_0101550 3300046515 Bacteria 1146
155 Ga0495620_0160529 3300046515 Bacteria 873
156 Ga0495628_0058184 3300046516 Bacteria 3038
157 Ga0495628_0426987 3300046516 Bacteria 965
158 Ga0495630_0046585 3300046517 Bacteria 3241
159 Ga0495631_0021852 3300046518 Bacteria 2978
160 Ga0495632_0214694 3300046519 Bacteria 872
161 Ga0495637_0052614 3300046520 Bacteria 1699
162 Ga0495643_0005887 3300046522 Bacteria 8196
163 Ga0495643_0092229 3300046522 Bacteria 1561
164 Ga0495643_0360549 3300046522 Bacteria 649
165 Ga0495648_0039275 3300046524 Bacteria 3013
166 Ga0495648_0149414 3300046524 Bacteria 1220
167 Ga0495666_0017505 3300046526 Bacteria 3568
168 Ga0495642_0049231 3300046528 Bacteria 1730
169 Ga0495652_0049938 3300046529 Bacteria 3579
170 Ga0495654_0020771 3300046530 Bacteria 3420
171 Ga0495640_0108701 3300046533 Bacteria 1814
172 Ga0495586_0447311 3300046535 Bacteria 745
173 Ga0495587_0003878 3300046536 Bacteria 9922
174 Ga0495587_0064611 3300046536 Bacteria 2138
175 Ga0495609_0019727 3300046538 Bacteria 3117
176 Ga0495597_0017372 3300046542 Bacteria 3387
177 Ga0495622_0083888 3300046557 Bacteria 1465
178 Ga0495633_0018949 3300046558 Bacteria 3484
179 Ga0495633_0077727 3300046558 Bacteria 1545
180 Ga0495667_0106172 3300046559 Bacteria 1815
181 Ga0495656_0023279 3300046615 Bacteria 2437
182 Ga0495668_0008702 3300046616 Bacteria 6305
183 Ga0495634_0008624 3300046642 Bacteria 7565
184 Ga0495634_0255089 3300046642 Bacteria 1071
185 Ga0495611_0103159 3300046648 Bacteria 1325
186 Ga0495625_0158674 3300046660 Bacteria 1516
187 Ga0495635_0037077 3300046663 Bacteria 3375
188 Ga0495635_0053285 3300046663 Bacteria 2787
189 Ga0495635_0126478 3300046663 Bacteria 1743
190 Ga0495661_0012164 3300046665 Bacteria 5812
191 Ga0495661_0285717 3300046665 Bacteria 830
192 Ga0495588_0171797 3300046674 Bacteria 1146
193 Ga0495657_0002935 3300046675 Bacteria 14138
194 Ga0495657_0016035 3300046675 Bacteria 5466
195 Ga0495657_0264450 3300046675 Bacteria 1032
196 Ga0495599_0080511 3300046678 Bacteria 2034
197 Ga0495646_0001643 3300046680 Bacteria 13336
198 Ga0495658_0007199 3300046683 Bacteria 5496
199 Ga0495613_0008134 3300046689 Bacteria 7801
200 Ga0495613_0014244 3300046689 Bacteria 5901
201 Ga0495613_0087120 3300046689 Bacteria 2263
202 Ga0495613_0183468 3300046689 Bacteria 1481
203 Ga0495613_0229582 3300046689 Bacteria 1300
204 Ga0495613_0266733 3300046689 Bacteria 1192
205 Ga0495624_0053443 3300046690 Bacteria 2550
206 Ga0495671_0037972 3300046692 Bacteria 2435
207 Ga0495671_0167634 3300046692 Bacteria 1068
208 Ga0495589_0012487 3300046794 Bacteria 4398
209 Ga0495589_0098133 3300046794 Bacteria 1419
210 Ga0495589_0161407 3300046794 Bacteria 1067
211 Ga0495589_0167090 3300046794 Bacteria 1047
212 Ga0495600_0108265 3300046809 Bacteria 1810
213 Ga0495581_0005916 3300047315 Bacteria 7093
214 Ga0495581_0028712 3300047315 Bacteria 3225
215 Ga0495581_0064174 3300047315 Bacteria 2121
216 Ga0495604_0002330 3300047317 Bacteria 15212
217 Ga0495636_0014419 3300047318 Bacteria 3142
218 Ga0495636_0139147 3300047318 Bacteria 1083
219 Ga0495674_0069109 3300047319 Bacteria 3055
220 Ga0495676_0021284 3300047321 Bacteria 5667
221 Ga0495676_0028426 3300047321 Bacteria 4774
222 Ga0495676_0071319 3300047321 Bacteria 2671
223 Ga0495680_0058865 3300047322 Bacteria 2967
224 Ga0495683_0127363 3300047323 Bacteria 1204
225 Ga0495687_002189 3300047443 Bacteria 16258
226 Ga0495687_009809 3300047443 Bacteria 5316
227 Ga0495675_0021328 3300047444 Bacteria 4125
228 Ga0495675_0098233 3300047444 Bacteria 1834
229 Ga0495685_003632 3300047447 Bacteria 4935
230 Ga0495685_009371 3300047447 Bacteria 3268
231 Ga0495685_034327 3300047447 Bacteria 1742
232 Ga0495685_049364 3300047447 Bacteria 1429
233 Ga0495681_0007185 3300047470 Bacteria 7160
234 Ga0495681_0011826 3300047470 Bacteria 5168
235 Ga0495684_0130506 3300047471 Bacteria 1888
236 Ga0495686_0133763 3300047472 Bacteria 1468
237 Ga0495686_0368427 3300047472 Bacteria 777
238 Ga0495593_0015383 3300047673 Bacteria 4335
239 Ga0495593_0125864 3300047673 Bacteria 1302
240 Ga0495593_0363270 3300047673 Bacteria 723
241 Ga0495602_0032789 3300048088 Bacteria 4886
242 Ga0495614_0017751 3300048089 Bacteria 3088
243 Ga0495614_0358414 3300048089 Bacteria 680
244 Ga0495626_0019475 3300048091 Bacteria 3396
245 Ga0496104_1182591 3300048907 Bacteria 668
246 Ga0496113_0399928 3300048916 Bacteria 1103
247 Ga0496123_0272384 3300048926 Bacteria 823
248 Ga0495678_018241 3300049459 Bacteria 3160
249 Ga0495682_0116951 3300049460 Bacteria 955
250 Ga0501031_0009267 3300049568 Bacteria 6395
251 Ga0501032_0019173 3300049569 Bacteria 4786
252 Ga0501033_0012975 3300049570 Bacteria 6354
253 Ga0501033_0109412 3300049570 Bacteria 2012
254 Ga0501033_0193228 3300049570 Bacteria 1456
255 Ga0501033_0310084 3300049570 Bacteria 1110
256 Ga0501033_0398928 3300049570 Bacteria 959
257 Ga0501034_0002413 3300049571 Bacteria 22626
258 Ga0501034_0097015 3300049571 Bacteria 2943
259 Ga0501034_0122095 3300049571 Bacteria 2591
260 Ga0501034_1037466 3300049571 Bacteria 703
261 Ga0501036_0003697 3300049572 Bacteria 12254
262 Ga0501036_0019650 3300049572 Bacteria 5671
263 Ga0501036_0068704 3300049572 Bacteria 2998
264 Ga0501036_0334123 3300049572 Bacteria 1266
265 Ga0501037_0052751 3300049573 Bacteria 2973
266 Ga0501037_0374720 3300049573 Bacteria 979
267 Ga0501038_0021236 3300049574 Bacteria 5829
268 Ga0501038_0062919 3300049574 Bacteria 3169
269 Ga0501038_0095286 3300049574 Bacteria 2486
270 Ga0501039_0007760 3300049575 Bacteria 8187
271 Ga0501039_0887537 3300049575 Bacteria 694
272 Ga0501042_0032102 3300049578 Bacteria 3717
273 Ga0501042_0603357 3300049578 Bacteria 798
274 Ga0501043_0000622 3300049579 Bacteria 31276
275 Ga0501043_0011247 3300049579 Bacteria 7008
276 Ga0501043_0154904 3300049579 Bacteria 1792
277 Ga0501043_0270297 3300049579 Bacteria 1305
278 Ga0501046_0001707 3300049580 Bacteria 20974
279 Ga0501046_0079698 3300049580 Bacteria 2531
280 Ga0501046_0424326 3300049580 Bacteria 958
281 Ga0501047_0007343 3300049581 Bacteria 10362
282 Ga0501047_0049327 3300049581 Bacteria 4065
283 Ga0501047_0088343 3300049581 Bacteria 2976
284 Ga0501048_0020957 3300049582 Bacteria 4788
285 Ga0501048_0152565 3300049582 Bacteria 1634
286 Ga0501048_0533730 3300049582 Bacteria 842
287 Ga0501069_0162901 3300049585 Bacteria 1285
288 Ga0501070_0002372 3300049586 Bacteria 16524
289 Ga0501070_0152512 3300049586 Bacteria 1906
290 Ga0501070_0222554 3300049586 Bacteria 1547
291 Ga0501070_0506370 3300049586 Bacteria 970
292 Ga0501070_0851154 3300049586 Bacteria 714
293 Ga0501071_0253014 3300049587 Bacteria 1330
294 Ga0501073_0352215 3300049589 Bacteria 1017
295 Ga0501074_0006744 3300049590 Bacteria 8284
296 Ga0501080_0113219 3300049742 Bacteria 2515
297 Ga0501080_0163280 3300049742 Bacteria 2056
298 Ga0501083_0280561 3300049744 Bacteria 1084
299 Ga0501083_0593608 3300049744 Bacteria 721
300 Ga0501035_0003716 3300049822 Bacteria 14550
301 Ga0501035_0029463 3300049822 Bacteria 5005
302 Ga0501035_0072287 3300049822 Bacteria 3053
303 Ga0501035_0095381 3300049822 Bacteria 2615
304 Ga0501035_0141153 3300049822 Bacteria 2094
305 Ga0501035_0202965 3300049822 Bacteria 1699
306 Ga0501035_0439274 3300049822 Bacteria 1081
307 Ga0501044_0008206 3300049823 Bacteria 11459
308 Ga0501044_0009479 3300049823 Bacteria 10601
309 Ga0501044_0016365 3300049823 Bacteria 7964
310 Ga0501044_0050764 3300049823 Bacteria 4278
311 Ga0501044_0161463 3300049823 Bacteria 2217
312 Ga0501045_0535078 3300049824 Bacteria 869
313 nmdc:mga03n38_24760_c1 3300050490 Bacteria 2457
314 nmdc:mga0yw44_108645_c1 3300050492 Bacteria 1775
315 nmdc:mga06z11_9351_c1 3300050494 Bacteria 4128
316 nmdc:mga07m45_166761_c1 3300050496 Bacteria 1279
317 Ga0500644_0180115 3300053088 Bacteria 864
318 Ga0500566_0267087 3300053094 Bacteria 823
319 Ga0500640_001709 3300053095 Bacteria 6841
320 Ga0500553_110891 3300053101 Bacteria 1155
321 Ga0500560_000130 3300053107 Bacteria 8088
322 Ga0500572_014209 3300053111 Bacteria 1985
323 Ga0500559_0276461 3300053136 Bacteria 790
324 Ga0500600_0179523 3300053149 Bacteria 1020
325 Ga0500624_006601 3300053157 Bacteria 1574
326 Ga0466962_0015466 3300061719 Bacteria 3679
327 Ga0466962_0018208 3300061719 Bacteria 3379
328 Ga0466962_0095814 3300061719 Bacteria 1423
329 Ga0466962_0120796 3300061719 Bacteria 1264
330 2547406519 2547132111 Bacteria 8013147
331 2554259557 2554235005 Bacteria 6457341
332 2585303516 2582581313 Bacteria 10042643
333 2585316999 2582581314 Bacteria 11452267
334 2616695609 2616644814 Bacteria 11555299
335 2643946562 2643221587 Bacteria 7586415
336 2644268007 2643221647 Bacteria 10741251
337 2644269381 2643221647 Bacteria 10741251
338 2644389086 2643221670 Bacteria 6497041
339 2644434366 2643221677 Bacteria 7584031
340 2644443683 2643221678 Bacteria 9540101
341 2784586736 2784132148 Bacteria 8627943
342 2785345750 2784746763 Bacteria 9783172
343 2785367139 2784746768 Bacteria 10036182
344 2786668187 2786546132 Bacteria 10419719
345 2804843722 2802429296 Bacteria 7227771
346 2808847645 2808606359 Bacteria 9866990
347 2808918379 2808606375 Bacteria 9466072
348 2809230303 2808606448 Bacteria 8656184
349 2812360330 2811994879 Bacteria 9313447
350 2812482430 2811994917 Bacteria 7761064
351 2852637699 2852635781 Bacteria 8251373
352 2862289673 2862281513 Bacteria 9621493
353 2862392094 2862382967 Bacteria 10317375
354 2862510406 2862507626 Bacteria 9425308
355 2862583732 2862574272 Bacteria 10567477
356 2863406985 2863404153 Bacteria 9672205
357 2867435585 2867428634 Bacteria 9590268
358 2877683407 2877676314 Bacteria 9512378
359 2912726118 2912723979 Bacteria 8557534
360 2912758879 2912757875 Bacteria 7940295
361 2918502508 2918501144 Bacteria 8668083
362 2919472206 2919468124 Bacteria 9133025
363 2946065558 2946064051 Bacteria 8957905
364 2947231851 2947224130 Bacteria 9938529
365 2954011085 2954002825 Bacteria 9173742
366 2954388654 2954380949 Bacteria 10050426
367 2954674470 2954673503 Bacteria 9685905
368 2954689662 2954682443 Bacteria 9862841
369 2954699445 2954691527 Bacteria 10720516
370 2954702773 2954701450 Bacteria 10834262
371 2954718385 2954711539 Bacteria 10867210
372 2954728355 2954721474 Bacteria 10456478
373 2954733454 2954731030 Bacteria 10243860
374 2954747251 2954740390 Bacteria 10229294
375 2954752337 2954749733 Bacteria 10366972
376 2954766366 2954759201 Bacteria 9358192
377 3006395397 3006393351 Bacteria 6615579
378 3006490454 3006486233 Bacteria 8157040
379 8008561300 8008558824 Bacteria 10610750
380 8008580762 8008574985 Bacteria 7815457
381 8023625014 8023623736 Bacteria 8593882
382 8025414823 8025413630 Bacteria 7014048
383 8048408153 8048406513 Bacteria 8936924
384 8055068868 8055066027 Bacteria 9479577
385 8055177575 8055172936 Bacteria 9305943
386 8056835715 8056829672 Bacteria 9045328
387 JGI24737J22298_10033897
388 Ga0006562J51391_1114890
389 Ga0068869_100673347
390 Ga0075365_10099608
391 Ga0075363_100041901
392 Ga0075367_10008484
393 Ga0099826_10022112
394 Ga0105239_11472660
395 Ga0105246_10005653
396 Ga0157369_10844502
397 Ga0182008_10000988
398 Ga0182006_1038947
399 Ga0182007_10000233
400 Ga0207702_10374464
401 Ga0207674_10675884
402 Ga0209371_1019129
403 Ga0209371_1044935
404 Ga0307517_10006575
405 Ga0307515_10002608
406 Ga0307515_10242460
407 Ga0268256_1020870
408 Ga0268256_1028431
409 Ga0307511_10004244
410 Ga0307511_10052842
411 Ga0307511_10167312
412 Ga0307512_10022223
413 Ga0307512_10041864
414 Ga0307513_10033849
415 Ga0307509_10034363
416 Ga0307509_10035488
417 Ga0307509_10036407
418 Ga0307408_101230013
419 Ga0307508_10004671
420 Ga0307508_10014305
421 Ga0307508_10037263
422 Ga0307508_10350424
423 Ga0307514_10130546
424 Ga0307516_10017376
425 Ga0307516_10244157
426 Ga0307518_10019613
427 Ga0307518_10043040
428 Ga0307410_10493761
429 Ga0307507_10023054
430 Ga0307507_10091054
431 Ga0307510_10025621
432 Ga0307510_10027250
433 Ga0307510_10213641
434 Ga0307510_10265060
435 Ga0373945_0422976
436 Ga0395899_0284038
437 Ga0395900_0295853
438 Ga0395905_0125650
439 Ga0439436_0002040
440 Ga0439439_0001308
441 Ga0439439_0006978
442 Ga0451789_1015524
443 Ga0451807_2695814
444 Ga0451853_3387313
445 Ga0439433_0029887
446 Ga0439442_044454
447 Ga0439442_047235
448 Ga0439448_0005783
449 Ga0439448_0043136
450 Ga0439449_0001359
451 Ga0439455_0006207
452 Ga0439457_000613
453 Ga0439457_001721
454 Ga0439457_052178
455 Ga0439462_0011495
456 Ga0450890_021744
457 Ga0450894_003830
458 Ga0450896_010669
459 Ga0450898_031418
460 Ga0450899_002545
461 Ga0450903_000035
462 Ga0450906_004484
463 Ga0439458_0069479
464 Ga0466969_0047446
465 Ga0466972_0000856
466 Ga0466972_0007453
467 Ga0466972_0009861
468 Ga0466972_0231009
469 Ga0466966_0013191
470 Ga0466966_0060650
471 Ga0466966_0133283
472 Ga0466961_0019498
473 Ga0466961_0034774
474 Ga0466961_0481359
475 Ga0466963_0003307
476 Ga0466963_0012550
477 Ga0466963_0054879
478 Ga0466963_0236250
479 Ga0466963_0649802
480 Ga0466963_0935916
481 Ga0466964_0204602
482 Ga0466971_0037422
483 Ga0466968_0075657
484 Ga0466970_0018751
485 Ga0466970_0200098
486 Ga0466970_0485812
487 Ga0466957_0396166
488 Ga0466957_0594151
489 Ga0466960_0008149
490 Ga0466960_0127543
491 Ga0466960_0624065
492 Ga0466959_0137694
493 Ga0466959_0241667
494 Ga0466958_0064603
495 Ga0466958_0079839
496 Ga0466967_0042786
497 Ga0466967_0257385
498 Ga0466967_0296999
499 Ga0466967_0371191
500 Ga0466967_0407000
501 Ga0466967_0552631
502 Ga0495592_0016299
503 Ga0495592_0038153
504 Ga0495603_0013742
505 Ga0495603_0020755
506 Ga0495590_0019395
507 Ga0495629_0016734
508 Ga0495629_0026156
509 Ga0495629_0105827
510 Ga0495629_0118395
511 Ga0495638_0084987
512 Ga0495638_0125867
513 Ga0495651_0000887
514 Ga0495651_0035341
515 Ga0495580_0088769
516 Ga0495582_0092498
517 Ga0495582_0212677
518 Ga0495605_0001852
519 Ga0495605_0129384
520 Ga0495662_0008535
521 Ga0495662_0087749
522 Ga0495662_0162240
523 Ga0495662_0169559
524 Ga0495664_0003842
525 Ga0495664_0065712
526 Ga0495594_0018848
527 Ga0495594_0684091
528 Ga0495596_0018788
529 Ga0495607_0029640
530 Ga0495583_0076761
531 Ga0495583_0082244
532 Ga0495606_0099060
533 Ga0495608_0149242
534 Ga0495610_0041496
535 Ga0495610_0245626
536 Ga0495616_0002501
537 Ga0495618_0010566
538 Ga0495618_0114535
539 Ga0495620_0019145
540 Ga0495620_0101550
541 Ga0495620_0160529
542 Ga0495628_0058184
543 Ga0495628_0426987
544 Ga0495630_0046585
545 Ga0495631_0021852
546 Ga0495632_0214694
547 Ga0495637_0052614
548 Ga0495643_0005887
549 Ga0495643_0092229
550 Ga0495643_0360549
551 Ga0495648_0039275
552 Ga0495648_0149414
553 Ga0495666_0017505
554 Ga0495642_0049231
555 Ga0495652_0049938
556 Ga0495654_0020771
557 Ga0495640_0108701
558 Ga0495586_0447311
559 Ga0495587_0003878
560 Ga0495587_0064611
561 Ga0495609_0019727
562 Ga0495597_0017372
563 Ga0495622_0083888
564 Ga0495633_0018949
565 Ga0495633_0077727
566 Ga0495667_0106172
567 Ga0495656_0023279
568 Ga0495668_0008702
569 Ga0495634_0008624
570 Ga0495634_0255089
571 Ga0495611_0103159
572 Ga0495625_0158674
573 Ga0495635_0037077
574 Ga0495635_0053285
575 Ga0495635_0126478
576 Ga0495661_0012164
577 Ga0495661_0285717
578 Ga0495588_0171797
579 Ga0495657_0002935
580 Ga0495657_0016035
581 Ga0495657_0264450
582 Ga0495599_0080511
583 Ga0495646_0001643
584 Ga0495658_0007199
585 Ga0495613_0008134
586 Ga0495613_0014244
587 Ga0495613_0087120
588 Ga0495613_0183468
589 Ga0495613_0229582
590 Ga0495613_0266733
591 Ga0495624_0053443
592 Ga0495671_0037972
593 Ga0495671_0167634
594 Ga0495589_0012487
595 Ga0495589_0098133
596 Ga0495589_0161407
597 Ga0495589_0167090
598 Ga0495600_0108265
599 Ga0495581_0005916
600 Ga0495581_0028712
601 Ga0495581_0064174
602 Ga0495604_0002330
603 Ga0495636_0014419
604 Ga0495636_0139147
605 Ga0495674_0069109
606 Ga0495676_0021284
607 Ga0495676_0028426
608 Ga0495676_0071319
609 Ga0495680_0058865
610 Ga0495683_0127363
611 Ga0495687_002189
612 Ga0495687_009809
613 Ga0495675_0021328
614 Ga0495675_0098233
615 Ga0495685_003632
616 Ga0495685_009371
617 Ga0495685_034327
618 Ga0495685_049364
619 Ga0495681_0007185
620 Ga0495681_0011826
621 Ga0495684_0130506
622 Ga0495686_0133763
623 Ga0495686_0368427
624 Ga0495593_0015383
625 Ga0495593_0125864
626 Ga0495593_0363270
627 Ga0495602_0032789
628 Ga0495614_0017751
629 Ga0495614_0358414
630 Ga0495626_0019475
631 Ga0496104_1182591
632 Ga0496113_0399928
633 Ga0496123_0272384
634 Ga0495678_018241
635 Ga0495682_0116951
636 Ga0501031_0009267
637 Ga0501032_0019173
638 Ga0501033_0012975
639 Ga0501033_0109412
640 Ga0501033_0193228
641 Ga0501033_0310084
642 Ga0501033_0398928
643 Ga0501034_0002413
644 Ga0501034_0097015
645 Ga0501034_0122095
646 Ga0501034_1037466
647 Ga0501036_0003697
648 Ga0501036_0019650
649 Ga0501036_0068704
650 Ga0501036_0334123
651 Ga0501037_0052751
652 Ga0501037_0374720
653 Ga0501038_0021236
654 Ga0501038_0062919
655 Ga0501038_0095286
656 Ga0501039_0007760
657 Ga0501039_0887537
658 Ga0501042_0032102
659 Ga0501042_0603357
660 Ga0501043_0000622
661 Ga0501043_0011247
662 Ga0501043_0154904
663 Ga0501043_0270297
664 Ga0501046_0001707
665 Ga0501046_0079698
666 Ga0501046_0424326
667 Ga0501047_0007343
668 Ga0501047_0049327
669 Ga0501047_0088343
670 Ga0501048_0020957
671 Ga0501048_0152565
672 Ga0501048_0533730
673 Ga0501069_0162901
674 Ga0501070_0002372
675 Ga0501070_0152512
676 Ga0501070_0222554
677 Ga0501070_0506370
678 Ga0501070_0851154
679 Ga0501071_0253014
680 Ga0501073_0352215
681 Ga0501074_0006744
682 Ga0501080_0113219
683 Ga0501080_0163280
684 Ga0501083_0280561
685 Ga0501083_0593608
686 Ga0501035_0003716
687 Ga0501035_0029463
688 Ga0501035_0072287
689 Ga0501035_0095381
690 Ga0501035_0141153
691 Ga0501035_0202965
692 Ga0501035_0439274
693 Ga0501044_0008206
694 Ga0501044_0009479
695 Ga0501044_0016365
696 Ga0501044_0050764
697 Ga0501044_0161463
698 Ga0501045_0535078
699 nmdc:mga03n38_24760_c1
700 nmdc:mga0yw44_108645_c1
701 nmdc:mga06z11_9351_c1
702 nmdc:mga07m45_166761_c1
703 Ga0500644_0180115
704 Ga0500566_0267087
705 Ga0500640_001709
706 Ga0500553_110891
707 Ga0500560_000130
708 Ga0500572_014209
709 Ga0500559_0276461
710 Ga0500600_0179523
711 Ga0500624_006601
712 Ga0466962_0015466
713 Ga0466962_0018208
714 Ga0466962_0095814
715 Ga0466962_0120796
716 2547406519
717 2554259557
718 2585303516
719 2585316999
720 2616695609
721 2643946562
722 2644268007
723 2644269381
724 2644389086
725 2644434366
726 2644443683
727 2784586736
728 2785345750
729 2785367139
730 2786668187
731 2804843722
732 2808847645
733 2808918379
734 2809230303
735 2812360330
736 2812482430
737 2852637699
738 2862289673
739 2862392094
740 2862510406
741 2862583732
742 2863406985
743 2867435585
744 2877683407
745 2912726118
746 2912758879
747 2918502508
748 2919472206
749 2946065558
750 2947231851
751 2954011085
752 2954388654
753 2954674470
754 2954689662
755 2954699445
756 2954702773
757 2954718385
758 2954728355
759 2954733454
760 2954747251
761 2954752337
762 2954766366
763 3006395397
764 3006490454
765 8008561300
766 8008580762
767 8023625014
768 8025414823
769 8048408153
770 8055068868
771 8055177575
772 8056835715

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01202

SKI

Shikimate kinase

8

163

0.96

PF13238

AAA_18

AAA domain

2

113

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pt5-assembly4.cif.gz_D crystal structure of shikimate kinase (aq_2177) from aquifex aeolicus vf5 0.9224 5 167
2dft-assembly1.cif.gz_A structure of shikimate kinase from mycobacterium tuberculosis complexed with adp and mg at 2.8 angstrons of resolution 0.921 6 164
1kag-assembly2.cif.gz_B crystal structure of the escherichia coli shikimate kinase i (arok) 0.9162 3 167
4loa-assembly1.cif.gz_B x-ray structure of the de-novo design amidase at the resolution 1.8a, northeast structural genomics consortium (nesg) target or398 0.9131 5 167
2g1j-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis shikimate kinase at 2.0 angstrom resolution 0.9079 3 164
ID Description Score Start End Superfamily
4loaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8966 3 168 3.40.50.300
4y0aA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8919 2 167 3.40.50.300
3n2eC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8917 4 167 3.40.50.300
2shkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8904 5 171 3.40.50.300
2pt5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8856 5 167 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0M4DFB8-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9723 1 171 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A062WYE7-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.966 2 166 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-I8R0H0-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9594 2 167 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A7J9VBP3-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9592 3 167 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A7K3LZG8-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.959 3 164 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423

Map