F430507

General Info

Members Datasets Scaffolds Average Seq Length
386 203 772 213

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10765072|Ga0163162_107650722
Length 226
Sequence MRVIVADDAVLFREGLARVLTDAGFDVTTVGDARALLEQVRQDPPDAVVVDIRMPPTHTTEGLDAAKALKDSHPGIGVLVLSAHVEANYALELLESGVTGAGYLLKERVSDLDELTDAVRRVALGGVVLDPSVVALLVGRKRVRNPLDDLTDRERDVLAVMAEGRSNQAISEQLHLSPKTVEAYVRGVFTKLGLYQAVDDNRRVLAVLAFLAADGAQPGSASGPVR

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
121 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
122 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
125 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
131 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
132 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
152 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
158 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
159 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
163 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
200 2508501039 Frankia saprophytica CN3 Isolate Nodule
201 2687453737 Frankia sp. BMG5.36 Isolate Nodule
202 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
203 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 0
Isolates 1.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0.52
Rhizoplane 17.1
Rhizosphere 79.79
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10765072 3300013306 Bacteria 1084
2 JGI25406J46586_10022029 3300003203 Bacteria 2548
3 rootL2_10136599 3300003322 Bacteria 1410
4 JGI25407J50210_10010571 3300003373 Bacteria 2350
5 JGI25407J50210_10042957 3300003373 Bacteria 1156
6 JGI25405J52794_10016014 3300003911 Bacteria 1477
7 Ga0070683_100176162 3300005329 Bacteria 2030
8 Ga0070683_100315000 3300005329 Bacteria 1489
9 Ga0070670_100349804 3300005331 Bacteria 1298
10 Ga0070680_100226974 3300005336 Bacteria 1577
11 Ga0070692_10000314 3300005345 Bacteria 13848
12 Ga0070668_100333480 3300005347 Bacteria 1280
13 Ga0070668_100366297 3300005347 Bacteria 1223
14 Ga0070668_100538321 3300005347 Bacteria 1015
15 Ga0070671_100001169 3300005355 Bacteria 19598
16 Ga0070671_100244034 3300005355 Bacteria 1525
17 Ga0070703_10002737 3300005406 Bacteria 5062
18 Ga0070713_100033650 3300005436 Bacteria 4108
19 Ga0070713_100163344 3300005436 Bacteria 1989
20 Ga0070710_10035855 3300005437 Bacteria 2707
21 Ga0070711_100012410 3300005439 Bacteria 5322
22 Ga0070705_100068764 3300005440 Bacteria 2133
23 Ga0070700_100780447 3300005441 Bacteria 767
24 Ga0070694_100353704 3300005444 Bacteria 1139
25 Ga0070694_100591687 3300005444 Bacteria 892
26 Ga0070708_100005117 3300005445 Bacteria 10380
27 Ga0070708_100005454 3300005445 Bacteria 10082
28 Ga0070708_100031967 3300005445 Unclassified 4560
29 Ga0070708_100034487 3300005445 Bacteria 4404
30 Ga0070708_100161913 3300005445 Bacteria 2085
31 Ga0070708_100433111 3300005445 Bacteria 1240
32 Ga0070706_100000067 3300005467 Bacteria 120566
33 Ga0070706_100000077 3300005467 Bacteria 113837
34 Ga0070706_100008153 3300005467 Bacteria 9772
35 Ga0070706_100011967 3300005467 Bacteria 8051
36 Ga0070706_100018164 3300005467 Bacteria 6488
37 Ga0070706_100038551 3300005467 Bacteria 4410
38 Ga0070707_100002921 3300005468 Bacteria 16209
39 Ga0070707_100004068 3300005468 Bacteria 13743
40 Ga0070707_100007560 3300005468 Bacteria 10089
41 Ga0070707_100012294 3300005468 Bacteria 7993
42 Ga0070707_100014985 3300005468 Bacteria 7276
43 Ga0070707_100021007 3300005468 Bacteria 6165
44 Ga0070707_100077187 3300005468 Bacteria 3214
45 Ga0070707_100364652 3300005468 Bacteria 1403
46 Ga0070698_100004903 3300005471 Bacteria 14680
47 Ga0070698_100009473 3300005471 Bacteria 10431
48 Ga0070698_100017483 3300005471 Bacteria 7557
49 Ga0070698_100045180 3300005471 Bacteria 4509
50 Ga0070698_100123441 3300005471 Bacteria 2548
51 Ga0070698_100376748 3300005471 Bacteria 1351
52 Ga0070698_100378193 3300005471 Bacteria 1349
53 Ga0070699_100000390 3300005518 Bacteria 42635
54 Ga0070699_100000963 3300005518 Bacteria 26820
55 Ga0070699_100012381 3300005518 Bacteria 7361
56 Ga0070699_100019046 3300005518 Bacteria 5903
57 Ga0070699_100069178 3300005518 Bacteria 3067
58 Ga0070699_100201120 3300005518 Bacteria 1771
59 Ga0070699_100240723 3300005518 Bacteria 1615
60 Ga0070699_100399363 3300005518 Bacteria 1243
61 Ga0070679_100048330 3300005530 Bacteria 4239
62 Ga0070697_100015643 3300005536 Bacteria 5958
63 Ga0070697_100034176 3300005536 Bacteria 4098
64 Ga0070697_100061982 3300005536 Bacteria 3051
65 Ga0070697_100101557 3300005536 Unclassified 2390
66 Ga0070697_100236082 3300005536 Bacteria 1561
67 Ga0070686_100880445 3300005544 Bacteria 727
68 Ga0070695_100008511 3300005545 Bacteria 6089
69 Ga0070695_100235917 3300005545 Bacteria 1325
70 Ga0070696_100003406 3300005546 Bacteria 10605
71 Ga0070696_100383946 3300005546 Bacteria 1095
72 Ga0070704_100004969 3300005549 Bacteria 7723
73 Ga0070704_100005987 3300005549 Bacteria 7131
74 Ga0068857_100029591 3300005577 Bacteria 4833
75 Ga0068856_100160223 3300005614 Bacteria 2260
76 Ga0068859_100002483 3300005617 Bacteria 18758
77 Ga0068859_100020598 3300005617 Bacteria 6617
78 Ga0068864_100378987 3300005618 Bacteria 1340
79 Ga0068861_100064871 3300005719 Bacteria 2811
80 Ga0068863_100007761 3300005841 Bacteria 10491
81 Ga0068858_100000133 3300005842 Bacteria 77704
82 Ga0068862_100001253 3300005844 Bacteria 23865
83 Ga0081455_10000298 3300005937 Bacteria 65765
84 Ga0081455_10004995 3300005937 Bacteria 14669
85 Ga0081455_10190090 3300005937 Bacteria 1547
86 Ga0081538_10011780 3300005981 Bacteria 7058
87 Ga0081538_10014663 3300005981 Bacteria 6124
88 Ga0081538_10115965 3300005981 Bacteria 1301
89 Ga0081539_10000777 3300005985 Bacteria 62303
90 Ga0070717_10004591 3300006028 Bacteria 9999
91 Ga0070717_10017317 3300006028 Bacteria 5605
92 Ga0070717_10020734 3300006028 Bacteria 5175
93 Ga0070717_10106222 3300006028 Bacteria 2390
94 Ga0075365_10009281 3300006038 Bacteria 5643
95 Ga0070715_10002948 3300006163 Bacteria 5318
96 Ga0070716_100007648 3300006173 Bacteria 5330
97 Ga0070716_100022977 3300006173 Bacteria 3301
98 Ga0070712_100012866 3300006175 Bacteria 5330
99 Ga0070712_100320473 3300006175 Bacteria 1260
100 Ga0075428_100010093 3300006844 Bacteria 10490
101 Ga0075430_100066567 3300006846 Bacteria 3025
102 Ga0075430_100296569 3300006846 Bacteria 1337
103 Ga0075431_100001803 3300006847 Bacteria 20211
104 Ga0075431_100001963 3300006847 Bacteria 19621
105 Ga0075431_100021939 3300006847 Bacteria 6528
106 Ga0075433_10016009 3300006852 Bacteria 6168
107 Ga0075433_10151568 3300006852 Bacteria 2062
108 Ga0075434_100013165 3300006871 Bacteria 7859
109 Ga0075434_100134887 3300006871 Bacteria 2488
110 Ga0075429_100644584 3300006880 Bacteria 928
111 Ga0075436_100014438 3300006914 Bacteria 5409
112 Ga0075436_100033784 3300006914 Bacteria 3525
113 Ga0075436_100190242 3300006914 Bacteria 1452
114 Ga0097620_100002483 3300006931 Bacteria 18758
115 Ga0097620_100020599 3300006931 Bacteria 6617
116 Ga0075435_100023452 3300007076 Bacteria 4774
117 Ga0075435_100024705 3300007076 Bacteria 4667
118 Ga0075435_100645857 3300007076 Bacteria 918
119 Ga0099794_10242942 3300007265 Bacteria 928
120 Ga0111539_10017115 3300009094 Bacteria 8973
121 Ga0111539_10104755 3300009094 Bacteria 3319
122 Ga0105245_10332834 3300009098 Bacteria 1499
123 Ga0105247_10000974 3300009101 Bacteria 21616
124 Ga0105247_10006798 3300009101 Bacteria 7053
125 Ga0114129_10008673 3300009147 Bacteria 14490
126 Ga0114129_10166976 3300009147 Bacteria 3003
127 Ga0114129_10200004 3300009147 Bacteria 2707
128 Ga0114129_10492799 3300009147 Bacteria 1601
129 Ga0105243_10036972 3300009148 Bacteria 3792
130 Ga0105248_10023332 3300009177 Bacteria 6872
131 Ga0105249_10002739 3300009553 Bacteria 15248
132 Ga0105249_10129821 3300009553 Bacteria 2404
133 Ga0157374_10465275 3300013296 Bacteria 1267
134 Ga0157375_10669152 3300013308 Bacteria 1193
135 Ga0163163_10007254 3300014325 Bacteria 9772
136 Ga0163163_10039995 3300014325 Bacteria 4578
137 Ga0157377_10425320 3300014745 Bacteria 911
138 Ga0157379_10001823 3300014968 Bacteria 17596
139 Ga0157379_10018262 3300014968 Bacteria 6181
140 Ga0157379_10159830 3300014968 Bacteria 2034
141 Ga0157379_10457667 3300014968 Bacteria 1179
142 Ga0157376_10816599 3300014969 Bacteria 946
143 Ga0207653_10000438 3300025885 Bacteria 17151
144 Ga0207692_10005183 3300025898 Bacteria 5203
145 Ga0207692_10013038 3300025898 Bacteria 3593
146 Ga0207710_10000038 3300025900 Bacteria 241794
147 Ga0207710_10000102 3300025900 Bacteria 110426
148 Ga0207699_10005564 3300025906 Bacteria 6042
149 Ga0207684_10000003 3300025910 Bacteria 766933
150 Ga0207684_10000099 3300025910 Bacteria 163128
151 Ga0207684_10003815 3300025910 Bacteria 14533
152 Ga0207684_10005888 3300025910 Bacteria 11228
153 Ga0207684_10010773 3300025910 Bacteria 8025
154 Ga0207684_10062660 3300025910 Bacteria 3157
155 Ga0207684_10074517 3300025910 Bacteria 2883
156 Ga0207693_10020287 3300025915 Bacteria 5288
157 Ga0207693_10522033 3300025915 Bacteria 926
158 Ga0207663_10002997 3300025916 Bacteria 8177
159 Ga0207660_10001564 3300025917 Bacteria 15345
160 Ga0207652_10039767 3300025921 Bacteria 3992
161 Ga0207652_10762170 3300025921 Bacteria 861
162 Ga0207646_10000031 3300025922 Bacteria 219144
163 Ga0207646_10000588 3300025922 Bacteria 47466
164 Ga0207646_10001121 3300025922 Bacteria 34180
165 Ga0207646_10001430 3300025922 Bacteria 29665
166 Ga0207646_10001696 3300025922 Bacteria 26787
167 Ga0207646_10003616 3300025922 Bacteria 17308
168 Ga0207646_10005947 3300025922 Bacteria 12724
169 Ga0207646_10017995 3300025922 Bacteria 6598
170 Ga0207646_10065396 3300025922 Unclassified 3246
171 Ga0207646_10080376 3300025922 Bacteria 2915
172 Ga0207650_10478578 3300025925 Bacteria 1039
173 Ga0207700_10009260 3300025928 Bacteria 6143
174 Ga0207700_10018292 3300025928 Bacteria 4704
175 Ga0207664_10027893 3300025929 Bacteria 4285
176 Ga0207664_10086101 3300025929 Bacteria 2566
177 Ga0207709_10055034 3300025935 Bacteria 2456
178 Ga0207709_10214382 3300025935 Bacteria 1384
179 Ga0207704_10057924 3300025938 Bacteria 2383
180 Ga0207665_10013929 3300025939 Bacteria 5288
181 Ga0207711_10081040 3300025941 Bacteria 2835
182 Ga0207661_10501602 3300025944 Bacteria 1109
183 Ga0207668_10436681 3300025972 Bacteria 1114
184 Ga0207668_10551151 3300025972 Bacteria 999
185 Ga0207703_10000003 3300026035 Bacteria 532213
186 Ga0207703_10000058 3300026035 Bacteria 138087
187 Ga0207703_10006850 3300026035 Bacteria 9074
188 Ga0207702_10020886 3300026078 Bacteria 5417
189 Ga0207641_10003113 3300026088 Bacteria 14915
190 Ga0207674_10121379 3300026116 Bacteria 2581
191 Ga0207675_100038061 3300026118 Bacteria 4488
192 Ga0207428_10025216 3300027907 Bacteria 4978
193 Ga0268265_10000057 3300028380 Bacteria 155346
194 Ga0307516_10002156 3300031730 Bacteria 26709
195 Ga0307413_10144533 3300031824 Bacteria 1649
196 Ga0307410_10058212 3300031852 Bacteria 2634
197 Ga0307406_10241387 3300031901 Bacteria 1355
198 Ga0307406_10368630 3300031901 Bacteria 1128
199 Ga0307409_100043197 3300031995 Bacteria 3382
200 Ga0307409_100059049 3300031995 Bacteria 2983
201 Ga0307409_100111367 3300031995 Bacteria 2296
202 Ga0307409_100878840 3300031995 Bacteria 909
203 Ga0307414_10077652 3300032004 Bacteria 2418
204 Ga0307411_10270369 3300032005 Bacteria 1347
205 Ga0307415_100000165 3300032126 Bacteria 29375
206 Ga0307415_100017978 3300032126 Bacteria 4255
207 Ga0373951_0002463 3300035091 Bacteria 4667
208 Ga0373943_0449240 3300035170 Bacteria 749
209 Ga0373935_0157430 3300035692 Bacteria 1546
210 Ga0373947_0158854 3300035725 Bacteria 1461
211 Ga0395900_0337353 3300037418 Bacteria 1484
212 Ga0439463_031151 3300042016 Bacteria 1346
213 Ga0466967_0068813 3300045976 Bacteria 3162
214 Ga0495592_0037733 3300046454 Bacteria 3637
215 Ga0495603_0027428 3300046455 Bacteria 3437
216 Ga0495629_0030140 3300046459 Bacteria 3847
217 Ga0495629_0097867 3300046459 Bacteria 2047
218 Ga0495641_0258830 3300046461 Bacteria 783
219 Ga0495651_0033301 3300046462 Bacteria 4019
220 Ga0495653_0019946 3300046463 Bacteria 5434
221 Ga0495653_0423398 3300046463 Bacteria 842
222 Ga0495582_0033173 3300046473 Bacteria 2838
223 Ga0495605_0009890 3300046474 Bacteria 5348
224 Ga0495662_0157352 3300046476 Bacteria 1119
225 Ga0495664_0015754 3300046477 Bacteria 4302
226 Ga0495664_0169947 3300046477 Bacteria 1323
227 Ga0495584_0061625 3300046491 Bacteria 1886
228 Ga0495585_0011063 3300046492 Bacteria 5357
229 Ga0495607_0020752 3300046501 Bacteria 4145
230 Ga0495606_0004553 3300046507 Bacteria 13778
231 Ga0495610_0019609 3300046512 Bacteria 3778
232 Ga0495616_0019527 3300046513 Bacteria 3697
233 Ga0495618_0029198 3300046514 Bacteria 3440
234 Ga0495620_0019794 3300046515 Bacteria 3299
235 Ga0495628_0045669 3300046516 Bacteria 3482
236 Ga0495630_0174138 3300046517 Bacteria 1640
237 Ga0495630_0204524 3300046517 Bacteria 1507
238 Ga0495630_0318363 3300046517 Bacteria 1189
239 Ga0495631_0003684 3300046518 Bacteria 8357
240 Ga0495663_0058192 3300046525 Bacteria 1211
241 Ga0495666_0002119 3300046526 Bacteria 9836
242 Ga0495652_0022421 3300046529 Bacteria 5602
243 Ga0495652_0351808 3300046529 Bacteria 1055
244 Ga0495640_0070687 3300046533 Bacteria 2344
245 Ga0495586_0078321 3300046535 Bacteria 1813
246 Ga0495587_0070131 3300046536 Bacteria 2040
247 Ga0495645_0016580 3300046543 Bacteria 5265
248 Ga0495645_0097745 3300046543 Bacteria 2090
249 Ga0495622_0103455 3300046557 Bacteria 1304
250 Ga0495633_0175472 3300046558 Bacteria 987
251 Ga0495656_0180112 3300046615 Bacteria 1038
252 Ga0495634_0488760 3300046642 Bacteria 722
253 Ga0495625_0003758 3300046660 Bacteria 14747
254 Ga0495588_0132676 3300046674 Bacteria 1314
255 Ga0495657_0130844 3300046675 Bacteria 1572
256 Ga0495599_0036208 3300046678 Bacteria 3098
257 Ga0495646_0036614 3300046680 Bacteria 3039
258 Ga0495647_0120994 3300046681 Bacteria 1101
259 Ga0495613_0090344 3300046689 Bacteria 2218
260 Ga0495624_0342519 3300046690 Bacteria 899
261 Ga0495649_0025532 3300046694 Bacteria 3291
262 Ga0495589_0005661 3300046794 Bacteria 6587
263 Ga0495660_0005860 3300046810 Bacteria 7330
264 Ga0495581_0120013 3300047315 Bacteria 1530
265 Ga0495674_0028510 3300047319 Bacteria 5089
266 Ga0495674_0109197 3300047319 Bacteria 2347
267 Ga0495674_0176834 3300047319 Bacteria 1778
268 Ga0495674_0532231 3300047319 Bacteria 937
269 Ga0495676_0062642 3300047321 Bacteria 2902
270 Ga0495680_0057958 3300047322 Bacteria 2994
271 Ga0495680_0271334 3300047322 Bacteria 1198
272 Ga0495683_0004941 3300047323 Bacteria 7459
273 Ga0495687_013644 3300047443 Bacteria 4225
274 Ga0495685_001754 3300047447 Bacteria 6685
275 Ga0495684_0019282 3300047471 Bacteria 5251
276 Ga0495686_0221199 3300047472 Bacteria 1077
277 Ga0495614_0003267 3300048089 Bacteria 7243
278 Ga0495626_0039244 3300048091 Bacteria 2242
279 Ga0496100_0007721 3300048903 Bacteria 5956
280 Ga0496100_0032558 3300048903 Bacteria 3253
281 Ga0496100_0410768 3300048903 Bacteria 1032
282 Ga0496100_0477866 3300048903 Bacteria 958
283 Ga0496101_0000693 3300048904 Bacteria 20313
284 Ga0496101_0014085 3300048904 Bacteria 5371
285 Ga0496101_0029226 3300048904 Bacteria 3855
286 Ga0496101_0070597 3300048904 Bacteria 2558
287 Ga0496102_0001895 3300048905 Bacteria 18038
288 Ga0496102_0029037 3300048905 Bacteria 4945
289 Ga0496102_0277776 3300048905 Bacteria 1579
290 Ga0496102_0292389 3300048905 Bacteria 1536
291 Ga0496102_0703340 3300048905 Bacteria 934
292 Ga0496103_0093789 3300048906 Bacteria 1896
293 Ga0496103_0169368 3300048906 Bacteria 1402
294 Ga0496104_0008227 3300048907 Bacteria 9260
295 Ga0496104_0010748 3300048907 Bacteria 8186
296 Ga0496104_0036231 3300048907 Bacteria 4612
297 Ga0496104_0039142 3300048907 Bacteria 4438
298 Ga0496104_0158684 3300048907 Bacteria 2170
299 Ga0496104_0550664 3300048907 Bacteria 1064
300 Ga0496104_0595422 3300048907 Bacteria 1016
301 Ga0496105_0004023 3300048908 Bacteria 10998
302 Ga0496105_0006173 3300048908 Bacteria 9187
303 Ga0496105_0048058 3300048908 Bacteria 3522
304 Ga0496105_0085411 3300048908 Bacteria 2607
305 Ga0496105_0103758 3300048908 Bacteria 2348
306 Ga0496105_0172028 3300048908 Bacteria 1775
307 Ga0496105_0231695 3300048908 Bacteria 1501
308 Ga0496106_0001176 3300048909 Bacteria 19479
309 Ga0496106_0038033 3300048909 Bacteria 3600
310 Ga0496107_0005130 3300048910 Bacteria 8936
311 Ga0496107_0248632 3300048910 Bacteria 1323
312 Ga0496108_0000168 3300048911 Bacteria 61503
313 Ga0496108_0003471 3300048911 Bacteria 12645
314 Ga0496108_0005952 3300048911 Bacteria 9877
315 Ga0496108_0173956 3300048911 Bacteria 1863
316 Ga0496108_0334664 3300048911 Bacteria 1320
317 Ga0496108_0417204 3300048911 Bacteria 1172
318 Ga0496109_0001261 3300048912 Bacteria 21025
319 Ga0496109_0013635 3300048912 Bacteria 7059
320 Ga0496109_0036702 3300048912 Bacteria 4425
321 Ga0496109_0100812 3300048912 Bacteria 2679
322 Ga0496109_0101817 3300048912 Bacteria 2666
323 Ga0496109_0198312 3300048912 Bacteria 1887
324 Ga0496110_0005817 3300048913 Bacteria 9691
325 Ga0496110_0081216 3300048913 Bacteria 2890
326 Ga0496110_0303116 3300048913 Bacteria 1455
327 Ga0496110_0363556 3300048913 Bacteria 1318
328 Ga0496111_0005834 3300048914 Bacteria 7940
329 Ga0496111_0108685 3300048914 Bacteria 2042
330 Ga0496111_0170175 3300048914 Bacteria 1619
331 Ga0496112_0005141 3300048915 Bacteria 11248
332 Ga0496112_0028614 3300048915 Bacteria 5381
333 Ga0496112_0057650 3300048915 Bacteria 3824
334 Ga0496113_0080015 3300048916 Bacteria 2502
335 Ga0496113_0331641 3300048916 Bacteria 1220
336 Ga0496114_0000668 3300048917 Bacteria 25433
337 Ga0496114_0018943 3300048917 Bacteria 5576
338 Ga0496114_0045747 3300048917 Bacteria 3637
339 Ga0496114_0048928 3300048917 Bacteria 3517
340 Ga0496114_0102137 3300048917 Bacteria 2449
341 Ga0496114_0209546 3300048917 Bacteria 1709
342 Ga0496115_0001634 3300048918 Bacteria 16139
343 Ga0496115_0018232 3300048918 Bacteria 5385
344 Ga0496115_0021903 3300048918 Bacteria 4942
345 Ga0496119_0009215 3300048922 Bacteria 8517
346 Ga0496119_0009887 3300048922 Bacteria 8102
347 Ga0496119_0018033 3300048922 Bacteria 5275
348 Ga0496120_0003847 3300048923 Bacteria 13192
349 Ga0496121_0001495 3300048924 Bacteria 39366
350 Ga0496121_0004935 3300048924 Bacteria 17501
351 Ga0495678_069053 3300049459 Bacteria 1301
352 Ga0501041_0386233 3300049577 Bacteria 886
353 Ga0501048_0107169 3300049582 Bacteria 1973
354 Ga0501072_0387588 3300049588 Bacteria 1109
355 Ga0501076_0369245 3300049592 Bacteria 1179
356 nmdc:mga05p37_152_c1 3300050507 Bacteria 65549
357 nmdc:mga05p37_9032_c1 3300050507 Bacteria 11787
358 nmdc:mga09592_63_c1 3300050508 Bacteria 60777
359 nmdc:mga0qj67_285751_c1 3300050509 Bacteria 1337
360 nmdc:mga0qj67_39354_c1 3300050509 Bacteria 3712
361 nmdc:mga06r32_1466_c1 3300050510 Bacteria 21247
362 nmdc:mga06r32_1726_c1 3300050510 Bacteria 19669
363 nmdc:mga06r32_2230_c1 3300050510 Bacteria 17368
364 nmdc:mga08y16_414765_c1 3300050511 Bacteria 1377
365 nmdc:mga08y16_6384_c1 3300050511 Bacteria 12364
366 nmdc:mga0n895_253298_c1 3300050512 Bacteria 1787
367 nmdc:mga0n895_269368_c1 3300050512 Bacteria 1728
368 nmdc:mga0n895_75612_c1 3300050512 Bacteria 3348
369 nmdc:mga0rr50_15925_c1 3300050513 Bacteria 4977
370 nmdc:mga0rr50_514948_c1 3300050513 Bacteria 1018
371 nmdc:mga08x19_115694_c1 3300050514 Bacteria 1793
372 nmdc:mga08x19_122492_c1 3300050514 Bacteria 1744
373 nmdc:mga08x19_75817_c1 3300050514 Bacteria 2200
374 nmdc:mga0a205_20045_c1 3300050515 Bacteria 6309
375 nmdc:mga0a205_266789_c1 3300050515 Bacteria 1589
376 nmdc:mga0a205_675255_c1 3300050515 Bacteria 884
377 nmdc:mga0a205_768692_c1 3300050515 Bacteria 811
378 nmdc:mga0a205_9870_c1 3300050515 Bacteria 8757
379 Ga0495601_0010798 3300053077 Bacteria 5450
380 Ga0495601_0253897 3300053077 Bacteria 1148
381 Ga0495619_0028871 3300053085 Bacteria 3580
382 Ga0530510_0340978 3300061734 Bacteria 1125
383 2508670860 2508501039 Bacteria 9978592
384 2689956181 2687453737 Bacteria 11203906
385 2895885169 2895880812 Bacteria 11255272
386 8025480277 8025478263 Bacteria 8209203
387 Ga0163162_10765072
388 JGI25406J46586_10022029
389 rootL2_10136599
390 JGI25407J50210_10010571
391 JGI25407J50210_10042957
392 JGI25405J52794_10016014
393 Ga0070683_100176162
394 Ga0070683_100315000
395 Ga0070670_100349804
396 Ga0070680_100226974
397 Ga0070692_10000314
398 Ga0070668_100333480
399 Ga0070668_100366297
400 Ga0070668_100538321
401 Ga0070671_100001169
402 Ga0070671_100244034
403 Ga0070703_10002737
404 Ga0070713_100033650
405 Ga0070713_100163344
406 Ga0070710_10035855
407 Ga0070711_100012410
408 Ga0070705_100068764
409 Ga0070700_100780447
410 Ga0070694_100353704
411 Ga0070694_100591687
412 Ga0070708_100005117
413 Ga0070708_100005454
414 Ga0070708_100031967
415 Ga0070708_100034487
416 Ga0070708_100161913
417 Ga0070708_100433111
418 Ga0070706_100000067
419 Ga0070706_100000077
420 Ga0070706_100008153
421 Ga0070706_100011967
422 Ga0070706_100018164
423 Ga0070706_100038551
424 Ga0070707_100002921
425 Ga0070707_100004068
426 Ga0070707_100007560
427 Ga0070707_100012294
428 Ga0070707_100014985
429 Ga0070707_100021007
430 Ga0070707_100077187
431 Ga0070707_100364652
432 Ga0070698_100004903
433 Ga0070698_100009473
434 Ga0070698_100017483
435 Ga0070698_100045180
436 Ga0070698_100123441
437 Ga0070698_100376748
438 Ga0070698_100378193
439 Ga0070699_100000390
440 Ga0070699_100000963
441 Ga0070699_100012381
442 Ga0070699_100019046
443 Ga0070699_100069178
444 Ga0070699_100201120
445 Ga0070699_100240723
446 Ga0070699_100399363
447 Ga0070679_100048330
448 Ga0070697_100015643
449 Ga0070697_100034176
450 Ga0070697_100061982
451 Ga0070697_100101557
452 Ga0070697_100236082
453 Ga0070686_100880445
454 Ga0070695_100008511
455 Ga0070695_100235917
456 Ga0070696_100003406
457 Ga0070696_100383946
458 Ga0070704_100004969
459 Ga0070704_100005987
460 Ga0068857_100029591
461 Ga0068856_100160223
462 Ga0068859_100002483
463 Ga0068859_100020598
464 Ga0068864_100378987
465 Ga0068861_100064871
466 Ga0068863_100007761
467 Ga0068858_100000133
468 Ga0068862_100001253
469 Ga0081455_10000298
470 Ga0081455_10004995
471 Ga0081455_10190090
472 Ga0081538_10011780
473 Ga0081538_10014663
474 Ga0081538_10115965
475 Ga0081539_10000777
476 Ga0070717_10004591
477 Ga0070717_10017317
478 Ga0070717_10020734
479 Ga0070717_10106222
480 Ga0075365_10009281
481 Ga0070715_10002948
482 Ga0070716_100007648
483 Ga0070716_100022977
484 Ga0070712_100012866
485 Ga0070712_100320473
486 Ga0075428_100010093
487 Ga0075430_100066567
488 Ga0075430_100296569
489 Ga0075431_100001803
490 Ga0075431_100001963
491 Ga0075431_100021939
492 Ga0075433_10016009
493 Ga0075433_10151568
494 Ga0075434_100013165
495 Ga0075434_100134887
496 Ga0075429_100644584
497 Ga0075436_100014438
498 Ga0075436_100033784
499 Ga0075436_100190242
500 Ga0097620_100002483
501 Ga0097620_100020599
502 Ga0075435_100023452
503 Ga0075435_100024705
504 Ga0075435_100645857
505 Ga0099794_10242942
506 Ga0111539_10017115
507 Ga0111539_10104755
508 Ga0105245_10332834
509 Ga0105247_10000974
510 Ga0105247_10006798
511 Ga0114129_10008673
512 Ga0114129_10166976
513 Ga0114129_10200004
514 Ga0114129_10492799
515 Ga0105243_10036972
516 Ga0105248_10023332
517 Ga0105249_10002739
518 Ga0105249_10129821
519 Ga0157374_10465275
520 Ga0157375_10669152
521 Ga0163163_10007254
522 Ga0163163_10039995
523 Ga0157377_10425320
524 Ga0157379_10001823
525 Ga0157379_10018262
526 Ga0157379_10159830
527 Ga0157379_10457667
528 Ga0157376_10816599
529 Ga0207653_10000438
530 Ga0207692_10005183
531 Ga0207692_10013038
532 Ga0207710_10000038
533 Ga0207710_10000102
534 Ga0207699_10005564
535 Ga0207684_10000003
536 Ga0207684_10000099
537 Ga0207684_10003815
538 Ga0207684_10005888
539 Ga0207684_10010773
540 Ga0207684_10062660
541 Ga0207684_10074517
542 Ga0207693_10020287
543 Ga0207693_10522033
544 Ga0207663_10002997
545 Ga0207660_10001564
546 Ga0207652_10039767
547 Ga0207652_10762170
548 Ga0207646_10000031
549 Ga0207646_10000588
550 Ga0207646_10001121
551 Ga0207646_10001430
552 Ga0207646_10001696
553 Ga0207646_10003616
554 Ga0207646_10005947
555 Ga0207646_10017995
556 Ga0207646_10065396
557 Ga0207646_10080376
558 Ga0207650_10478578
559 Ga0207700_10009260
560 Ga0207700_10018292
561 Ga0207664_10027893
562 Ga0207664_10086101
563 Ga0207709_10055034
564 Ga0207709_10214382
565 Ga0207704_10057924
566 Ga0207665_10013929
567 Ga0207711_10081040
568 Ga0207661_10501602
569 Ga0207668_10436681
570 Ga0207668_10551151
571 Ga0207703_10000003
572 Ga0207703_10000058
573 Ga0207703_10006850
574 Ga0207702_10020886
575 Ga0207641_10003113
576 Ga0207674_10121379
577 Ga0207675_100038061
578 Ga0207428_10025216
579 Ga0268265_10000057
580 Ga0307516_10002156
581 Ga0307413_10144533
582 Ga0307410_10058212
583 Ga0307406_10241387
584 Ga0307406_10368630
585 Ga0307409_100043197
586 Ga0307409_100059049
587 Ga0307409_100111367
588 Ga0307409_100878840
589 Ga0307414_10077652
590 Ga0307411_10270369
591 Ga0307415_100000165
592 Ga0307415_100017978
593 Ga0373951_0002463
594 Ga0373943_0449240
595 Ga0373935_0157430
596 Ga0373947_0158854
597 Ga0395900_0337353
598 Ga0439463_031151
599 Ga0466967_0068813
600 Ga0495592_0037733
601 Ga0495603_0027428
602 Ga0495629_0030140
603 Ga0495629_0097867
604 Ga0495641_0258830
605 Ga0495651_0033301
606 Ga0495653_0019946
607 Ga0495653_0423398
608 Ga0495582_0033173
609 Ga0495605_0009890
610 Ga0495662_0157352
611 Ga0495664_0015754
612 Ga0495664_0169947
613 Ga0495584_0061625
614 Ga0495585_0011063
615 Ga0495607_0020752
616 Ga0495606_0004553
617 Ga0495610_0019609
618 Ga0495616_0019527
619 Ga0495618_0029198
620 Ga0495620_0019794
621 Ga0495628_0045669
622 Ga0495630_0174138
623 Ga0495630_0204524
624 Ga0495630_0318363
625 Ga0495631_0003684
626 Ga0495663_0058192
627 Ga0495666_0002119
628 Ga0495652_0022421
629 Ga0495652_0351808
630 Ga0495640_0070687
631 Ga0495586_0078321
632 Ga0495587_0070131
633 Ga0495645_0016580
634 Ga0495645_0097745
635 Ga0495622_0103455
636 Ga0495633_0175472
637 Ga0495656_0180112
638 Ga0495634_0488760
639 Ga0495625_0003758
640 Ga0495588_0132676
641 Ga0495657_0130844
642 Ga0495599_0036208
643 Ga0495646_0036614
644 Ga0495647_0120994
645 Ga0495613_0090344
646 Ga0495624_0342519
647 Ga0495649_0025532
648 Ga0495589_0005661
649 Ga0495660_0005860
650 Ga0495581_0120013
651 Ga0495674_0028510
652 Ga0495674_0109197
653 Ga0495674_0176834
654 Ga0495674_0532231
655 Ga0495676_0062642
656 Ga0495680_0057958
657 Ga0495680_0271334
658 Ga0495683_0004941
659 Ga0495687_013644
660 Ga0495685_001754
661 Ga0495684_0019282
662 Ga0495686_0221199
663 Ga0495614_0003267
664 Ga0495626_0039244
665 Ga0496100_0007721
666 Ga0496100_0032558
667 Ga0496100_0410768
668 Ga0496100_0477866
669 Ga0496101_0000693
670 Ga0496101_0014085
671 Ga0496101_0029226
672 Ga0496101_0070597
673 Ga0496102_0001895
674 Ga0496102_0029037
675 Ga0496102_0277776
676 Ga0496102_0292389
677 Ga0496102_0703340
678 Ga0496103_0093789
679 Ga0496103_0169368
680 Ga0496104_0008227
681 Ga0496104_0010748
682 Ga0496104_0036231
683 Ga0496104_0039142
684 Ga0496104_0158684
685 Ga0496104_0550664
686 Ga0496104_0595422
687 Ga0496105_0004023
688 Ga0496105_0006173
689 Ga0496105_0048058
690 Ga0496105_0085411
691 Ga0496105_0103758
692 Ga0496105_0172028
693 Ga0496105_0231695
694 Ga0496106_0001176
695 Ga0496106_0038033
696 Ga0496107_0005130
697 Ga0496107_0248632
698 Ga0496108_0000168
699 Ga0496108_0003471
700 Ga0496108_0005952
701 Ga0496108_0173956
702 Ga0496108_0334664
703 Ga0496108_0417204
704 Ga0496109_0001261
705 Ga0496109_0013635
706 Ga0496109_0036702
707 Ga0496109_0100812
708 Ga0496109_0101817
709 Ga0496109_0198312
710 Ga0496110_0005817
711 Ga0496110_0081216
712 Ga0496110_0303116
713 Ga0496110_0363556
714 Ga0496111_0005834
715 Ga0496111_0108685
716 Ga0496111_0170175
717 Ga0496112_0005141
718 Ga0496112_0028614
719 Ga0496112_0057650
720 Ga0496113_0080015
721 Ga0496113_0331641
722 Ga0496114_0000668
723 Ga0496114_0018943
724 Ga0496114_0045747
725 Ga0496114_0048928
726 Ga0496114_0102137
727 Ga0496114_0209546
728 Ga0496115_0001634
729 Ga0496115_0018232
730 Ga0496115_0021903
731 Ga0496119_0009215
732 Ga0496119_0009887
733 Ga0496119_0018033
734 Ga0496120_0003847
735 Ga0496121_0001495
736 Ga0496121_0004935
737 Ga0495678_069053
738 Ga0501041_0386233
739 Ga0501048_0107169
740 Ga0501072_0387588
741 Ga0501076_0369245
742 nmdc:mga05p37_152_c1
743 nmdc:mga05p37_9032_c1
744 nmdc:mga09592_63_c1
745 nmdc:mga0qj67_285751_c1
746 nmdc:mga0qj67_39354_c1
747 nmdc:mga06r32_1466_c1
748 nmdc:mga06r32_1726_c1
749 nmdc:mga06r32_2230_c1
750 nmdc:mga08y16_414765_c1
751 nmdc:mga08y16_6384_c1
752 nmdc:mga0n895_253298_c1
753 nmdc:mga0n895_269368_c1
754 nmdc:mga0n895_75612_c1
755 nmdc:mga0rr50_15925_c1
756 nmdc:mga0rr50_514948_c1
757 nmdc:mga08x19_115694_c1
758 nmdc:mga08x19_122492_c1
759 nmdc:mga08x19_75817_c1
760 nmdc:mga0a205_20045_c1
761 nmdc:mga0a205_266789_c1
762 nmdc:mga0a205_675255_c1
763 nmdc:mga0a205_768692_c1
764 nmdc:mga0a205_9870_c1
765 Ga0495601_0010798
766 Ga0495601_0253897
767 Ga0495619_0028871
768 Ga0530510_0340978
769 2508670860
770 2689956181
771 2895885169
772 8025480277

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

148

209

0.93

PF00072

Response_reg

Response regulator receiver domain

3

120

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x1k-assembly1.cif.gz_B crystal structure of the flagellar expression regulator degu from listeria monocytogenes 0.962 145 210
7r3e-assembly1.cif.gz_A fusion construct of pqse and rhlr in complex with the synthetic antagonist mbtl 0.9574 148 206
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9552 144 210
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9544 146 210
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9542 144 210
ID Description Score Start End Superfamily
af_P52106_149_214_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9663 148 210 1.10.10.10
4hyeB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9648 148 210 1.10.10.10
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9579 148 210 1.10.10.10
3cloA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9539 148 207 1.10.10.10
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9461 148 207 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A538JGH7-F1-model_v4 Response regulator 0.9823 2 131 GO:0000160
GO:0004016
GO:0009190
AF-A0A3N0DSD5-F1-model_v4 Response regulator 0.9793 2 136 GO:0000160
GO:0004016
GO:0009190
AF-A0A538J270-F1-model_v4 Response regulator 0.9783 2 140 GO:0000160
GO:0004016
GO:0009190
AF-A0A1I2SCA5-F1-model_v4 Response regulator receiver domain-containing protein 0.9758 2 131 GO:0000160
GO:0003677
AF-A0A7Y5UE14-F1-model_v4 deleted 0.9748 2 126

Map