F430437

General Info

Members Datasets Scaffolds Average Seq Length
386 143 772 304

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100008142|Ga0070706_10000814210
Length 335
Sequence MDLRGHLECGGLVRAQVALGRYVLRRLIQAVPLLLGISIASFAILRAVPGGPTSVYESNPNITDEDIKRLEHAFGLDQPLPLQYLNWLGQFVTGDWGYSYISHRPVLALIGERLPNTITLMGSVFLTVLVLSLIIGTLTAVKQYSLFDHVVTGATFAFLSTPTFWLGLLLIIVFGLQLRLFPLGGMATLGAPSDIGDRLRHLVLPVATIALVQLGSHVRYLRASMLETINQDYMRTARAKGLGEHIVIARHALKNAAIPYVTVIALDLPELFVGALVTEQIFGWPGMGRLFWDSATRSDYPILMGILAVSSTLIVLANLLADVVYGYLDPRIRFG

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
81 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
82 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
87 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
88 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
89 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
94 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
95 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
112 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
113 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
114 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
140 2501939600 Micromonospora sp. L5 Isolate Unclassified
141 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
142 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
143 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 0
Isolates 1.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.26
Rhizosphere 98.7
Stem 0
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100008142 3300005467 Bacteria 9779
2 Ga0070690_100027525 3300005330 Bacteria 3514
3 Ga0068869_100033364 3300005334 Bacteria 3634
4 Ga0070680_100019936 3300005336 Bacteria 5317
5 Ga0070691_10050838 3300005341 Bacteria 1978
6 Ga0070687_100069224 3300005343 Bacteria 1889
7 Ga0070692_10016616 3300005345 Bacteria 3501
8 Ga0070692_10040183 3300005345 Bacteria 2391
9 Ga0070669_100049364 3300005353 Bacteria 3072
10 Ga0070674_100376954 3300005356 Bacteria 1153
11 Ga0070673_100295671 3300005364 Bacteria 1424
12 Ga0070688_100116804 3300005365 Bacteria 1782
13 Ga0070701_10003914 3300005438 Bacteria 5950
14 Ga0070705_100097441 3300005440 Bacteria 1848
15 Ga0070705_100227784 3300005440 Bacteria 1294
16 Ga0070705_100437423 3300005440 Unclassified 978
17 Ga0070700_100142013 3300005441 Bacteria 1633
18 Ga0070694_100082068 3300005444 Bacteria 2244
19 Ga0070708_100013420 3300005445 Bacteria 6706
20 Ga0070708_100051514 3300005445 Bacteria 3647
21 Ga0070708_100251132 3300005445 Bacteria 1662
22 Ga0070708_100358100 3300005445 Bacteria 1375
23 Ga0070685_10253788 3300005466 Bacteria 1166
24 Ga0070706_100017150 3300005467 Bacteria 6690
25 Ga0070706_100034330 3300005467 Bacteria 4685
26 Ga0070706_100038722 3300005467 Bacteria 4400
27 Ga0070706_100097445 3300005467 Bacteria 2731
28 Ga0070706_100158269 3300005467 Bacteria 2114
29 Ga0070707_100057225 3300005468 Bacteria 3740
30 Ga0070707_100064881 3300005468 Bacteria 3507
31 Ga0070707_100069007 3300005468 Bacteria 3402
32 Ga0070707_100159814 3300005468 Bacteria 2195
33 Ga0070707_100216928 3300005468 Unclassified 1864
34 Ga0070698_100000442 3300005471 Bacteria 44057
35 Ga0070698_100025855 3300005471 Bacteria 6117
36 Ga0070698_100039234 3300005471 Bacteria 4875
37 Ga0070698_100042872 3300005471 Bacteria 4641
38 Ga0070698_100189518 3300005471 Bacteria 1994
39 Ga0070698_100196026 3300005471 Bacteria 1956
40 Ga0070698_100281111 3300005471 Bacteria 1596
41 Ga0070699_100000086 3300005518 Bacteria 88406
42 Ga0070699_100037560 3300005518 Bacteria 4193
43 Ga0070699_100167786 3300005518 Bacteria 1945
44 Ga0070699_100176645 3300005518 Bacteria 1894
45 Ga0070699_100288203 3300005518 Bacteria 1472
46 Ga0070697_100023732 3300005536 Bacteria 4880
47 Ga0070697_100115091 3300005536 Bacteria 2245
48 Ga0070672_100056408 3300005543 Bacteria 3081
49 Ga0070695_100059436 3300005545 Bacteria 2475
50 Ga0070695_100061365 3300005545 Bacteria 2439
51 Ga0070696_100080359 3300005546 Bacteria 2308
52 Ga0070696_100106187 3300005546 Bacteria 2018
53 Ga0070693_100083955 3300005547 Bacteria 1905
54 Ga0070704_100020393 3300005549 Bacteria 4273
55 Ga0070704_100053044 3300005549 Bacteria 2864
56 Ga0070704_100060222 3300005549 Bacteria 2712
57 Ga0070704_100291926 3300005549 Bacteria 1355
58 Ga0068857_100015237 3300005577 Bacteria 6709
59 Ga0068857_100024781 3300005577 Bacteria 5284
60 Ga0070702_100383302 3300005615 Bacteria 1000
61 Ga0068859_100201623 3300005617 Bacteria 2074
62 Ga0068859_100266430 3300005617 Bacteria 1805
63 Ga0068859_100426379 3300005617 Bacteria 1423
64 Ga0068861_100273071 3300005719 Bacteria 1452
65 Ga0068863_100154896 3300005841 Bacteria 2194
66 Ga0068863_100578783 3300005841 Bacteria 1110
67 Ga0068858_100116608 3300005842 Bacteria 2495
68 Ga0068860_100063727 3300005843 Bacteria 3500
69 Ga0068862_100013677 3300005844 Bacteria 6721
70 Ga0068862_100121850 3300005844 Bacteria 2299
71 Ga0068862_100258578 3300005844 Bacteria 1589
72 Ga0081538_10015948 3300005981 Bacteria 5790
73 Ga0075428_100000294 3300006844 Bacteria 48733
74 Ga0075428_100000301 3300006844 Bacteria 48491
75 Ga0075428_100012275 3300006844 Bacteria 9527
76 Ga0075428_100022046 3300006844 Bacteria 7050
77 Ga0075428_100023669 3300006844 Bacteria 6798
78 Ga0075428_100181907 3300006844 Bacteria 2275
79 Ga0075428_100313424 3300006844 Bacteria 1686
80 Ga0075430_100000122 3300006846 Bacteria 48376
81 Ga0075430_100001055 3300006846 Bacteria 21787
82 Ga0075430_100084433 3300006846 Bacteria 2659
83 Ga0075430_100087336 3300006846 Bacteria 2610
84 Ga0075430_100143820 3300006846 Bacteria 1986
85 Ga0075430_100254515 3300006846 Bacteria 1455
86 Ga0075431_100000385 3300006847 Bacteria 35359
87 Ga0075431_100000529 3300006847 Bacteria 31987
88 Ga0075431_100001658 3300006847 Bacteria 20867
89 Ga0075431_100003179 3300006847 Bacteria 15881
90 Ga0075431_100010991 3300006847 Bacteria 9112
91 Ga0075431_100040926 3300006847 Bacteria 4777
92 Ga0075431_100051196 3300006847 Bacteria 4260
93 Ga0075431_100064998 3300006847 Bacteria 3767
94 Ga0075431_100137135 3300006847 Bacteria 2523
95 Ga0075433_10004856 3300006852 Bacteria 10514
96 Ga0075433_10018761 3300006852 Bacteria 5755
97 Ga0075433_10025218 3300006852 Bacteria 5025
98 Ga0075433_10038312 3300006852 Bacteria 4140
99 Ga0075433_10441660 3300006852 Bacteria 1147
100 Ga0075434_100002213 3300006871 Bacteria 16961
101 Ga0075434_100016191 3300006871 Bacteria 7166
102 Ga0075434_100030766 3300006871 Bacteria 5288
103 Ga0075429_100000817 3300006880 Bacteria 24421
104 Ga0075429_100005164 3300006880 Bacteria 11230
105 Ga0075429_100010605 3300006880 Bacteria 7972
106 Ga0075429_100044682 3300006880 Bacteria 3853
107 Ga0075429_100135416 3300006880 Bacteria 2156
108 Ga0075429_100205210 3300006880 Bacteria 1727
109 Ga0075429_100249101 3300006880 Bacteria 1556
110 Ga0075436_100019338 3300006914 Bacteria 4668
111 Ga0075436_100085306 3300006914 Bacteria 2192
112 Ga0097620_100201614 3300006931 Bacteria 2074
113 Ga0097620_100266441 3300006931 Bacteria 1805
114 Ga0097620_100426371 3300006931 Bacteria 1423
115 Ga0075435_100019965 3300007076 Bacteria 5122
116 Ga0075435_100193656 3300007076 Bacteria 1721
117 Ga0099794_10103494 3300007265 Bacteria 1422
118 Ga0111539_10003223 3300009094 Bacteria 21579
119 Ga0111539_10003599 3300009094 Bacteria 20430
120 Ga0111539_10054432 3300009094 Bacteria 4761
121 Ga0111539_10093986 3300009094 Bacteria 3522
122 Ga0111539_10340208 3300009094 Bacteria 1747
123 Ga0105245_10315022 3300009098 Bacteria 1540
124 Ga0105247_10074307 3300009101 Bacteria 2131
125 Ga0114129_10000002 3300009147 Bacteria 204413
126 Ga0114129_10002108 3300009147 Bacteria 27390
127 Ga0114129_10016473 3300009147 Bacteria 10522
128 Ga0114129_10020610 3300009147 Bacteria 9373
129 Ga0114129_10039942 3300009147 Bacteria 6619
130 Ga0114129_10047588 3300009147 Bacteria 6025
131 Ga0114129_10072859 3300009147 Bacteria 4787
132 Ga0114129_10158608 3300009147 Bacteria 3093
133 Ga0114129_10218551 3300009147 Bacteria 2572
134 Ga0114129_10655013 3300009147 Bacteria 1355
135 Ga0105243_10086479 3300009148 Bacteria 2572
136 Ga0105241_10038005 3300009174 Bacteria 3629
137 Ga0105242_10010075 3300009176 Bacteria 7238
138 Ga0105242_10191977 3300009176 Bacteria 1809
139 Ga0105249_10122040 3300009553 Bacteria 2478
140 Ga0105249_10339171 3300009553 Bacteria 1519
141 Ga0163162_10136987 3300013306 Bacteria 2559
142 Ga0163162_10220434 3300013306 Bacteria 2027
143 Ga0163163_10437855 3300014325 Bacteria 1367
144 Ga0163161_10189863 3300017792 Bacteria 1579
145 Ga0207710_10098285 3300025900 Bacteria 1378
146 Ga0207684_10002934 3300025910 Bacteria 16883
147 Ga0207684_10018107 3300025910 Bacteria 6036
148 Ga0207684_10020529 3300025910 Bacteria 5645
149 Ga0207684_10026992 3300025910 Bacteria 4896
150 Ga0207684_10211713 3300025910 Bacteria 1672
151 Ga0207660_10205150 3300025917 Bacteria 1541
152 Ga0207646_10006505 3300025922 Bacteria 12062
153 Ga0207646_10044374 3300025922 Bacteria 3990
154 Ga0207646_10062684 3300025922 Bacteria 3319
155 Ga0207646_10075432 3300025922 Bacteria 3013
156 Ga0207646_10090011 3300025922 Bacteria 2747
157 Ga0207646_10131447 3300025922 Bacteria 2253
158 Ga0207681_10078802 3300025923 Bacteria 2320
159 Ga0207686_10018581 3300025934 Bacteria 3938
160 Ga0207686_10325057 3300025934 Bacteria 1151
161 Ga0207709_10008954 3300025935 Bacteria 5523
162 Ga0207669_10417052 3300025937 Bacteria 1056
163 Ga0207704_10230040 3300025938 Bacteria 1378
164 Ga0207691_10020997 3300025940 Bacteria 6172
165 Ga0207711_10061398 3300025941 Bacteria 3240
166 Ga0207689_10023717 3300025942 Bacteria 5146
167 Ga0207640_10529497 3300025981 Bacteria 986
168 Ga0207703_10074391 3300026035 Bacteria 2813
169 Ga0207641_10025713 3300026088 Bacteria 4854
170 Ga0207641_10191088 3300026088 Bacteria 1882
171 Ga0207648_10040489 3300026089 Bacteria 4094
172 Ga0207648_10122334 3300026089 Bacteria 2288
173 Ga0207648_10320571 3300026089 Bacteria 1393
174 Ga0207674_10014947 3300026116 Bacteria 8552
175 Ga0207674_10039946 3300026116 Bacteria 4861
176 Ga0207675_100022867 3300026118 Bacteria 5817
177 Ga0207675_100592756 3300026118 Bacteria 1111
178 Ga0209999_1014255 3300027543 Bacteria 1444
179 Ga0207428_10000548 3300027907 Bacteria 44649
180 Ga0207428_10054163 3300027907 Bacteria 3195
181 Ga0207428_10100054 3300027907 Bacteria 2241
182 Ga0268265_10007648 3300028380 Bacteria 7292
183 Ga0268265_10022135 3300028380 Bacteria 4461
184 Ga0268264_10106358 3300028381 Bacteria 2449
185 Ga0307408_100047165 3300031548 Bacteria 3084
186 Ga0307408_100052249 3300031548 Bacteria 2947
187 Ga0316579_10004876 3300031691 Bacteria 5366
188 Ga0316576_10032032 3300031727 Bacteria 3735
189 Ga0316577_10000200 3300031733 Bacteria 20047
190 Ga0316577_10212082 3300031733 Unclassified 1094
191 Ga0307410_10048317 3300031852 Bacteria 2849
192 Ga0307410_10271079 3300031852 Bacteria 1328
193 Ga0307416_100059644 3300032002 Bacteria 3102
194 Ga0307411_10091906 3300032005 Bacteria 2121
195 Ga0373949_0054976 3300035090 Bacteria 1012
196 Ga0373941_0017828 3300035115 Bacteria 1952
197 Ga0316582_0007326 3300036647 Bacteria 5869
198 Ga0316584_0000400 3300036712 Bacteria 22577
199 Ga0316584_0098652 3300036712 Archaea 2187
200 Ga0316584_0311992 3300036712 Bacteria 1137
201 Ga0395898_0006966 3300037466 Bacteria 12018
202 Ga0316581_0000814 3300037588 Bacteria 6489
203 Ga0395901_0000511 3300038443 Bacteria 45007
204 Ga0400489_33902 3300039093 Bacteria 5950
205 Ga0439435_0025823 3300042436 Bacteria 1560
206 Ga0439460_0019852 3300042461 Bacteria 1824
207 Ga0451577_0010552 3300042876 Bacteria 8811
208 Ga0453683_0002840 3300044673 Bacteria 13141
209 Ga0451576_0001138 3300045051 Bacteria 48072
210 Ga0451576_0005571 3300045051 Bacteria 15731
211 Ga0451576_0064386 3300045051 Bacteria 3819
212 Ga0451576_0111723 3300045051 Bacteria 2844
213 Ga0451576_0197963 3300045051 Bacteria 2099
214 Ga0495603_0141423 3300046455 Bacteria 1400
215 Ga0496102_0135202 3300048905 Bacteria 2310
216 Ga0501031_0037033 3300049568 Bacteria 3183
217 Ga0501031_0038031 3300049568 Bacteria 3141
218 Ga0501031_0218246 3300049568 Bacteria 1242
219 Ga0501031_0218588 3300049568 Bacteria 1241
220 Ga0501036_0070639 3300049572 Bacteria 2953
221 Ga0501036_0099849 3300049572 Bacteria 2455
222 Ga0501036_0202832 3300049572 Bacteria 1668
223 Ga0501037_0065148 3300049573 Bacteria 2655
224 Ga0501038_0002016 3300049574 Bacteria 18755
225 Ga0501038_0045154 3300049574 Bacteria 3826
226 Ga0501038_0070206 3300049574 Bacteria 2975
227 Ga0501038_0263880 3300049574 Bacteria 1360
228 Ga0501039_0046678 3300049575 Bacteria 3347
229 Ga0501039_0096811 3300049575 Bacteria 2301
230 Ga0501039_0118990 3300049575 Bacteria 2069
231 Ga0501039_0409999 3300049575 Bacteria 1064
232 Ga0501040_0001666 3300049576 Bacteria 14201
233 Ga0501040_0067529 3300049576 Bacteria 2464
234 Ga0501040_0082863 3300049576 Bacteria 2224
235 Ga0501041_0000972 3300049577 Bacteria 15635
236 Ga0501041_0011686 3300049577 Bacteria 5196
237 Ga0501041_0014631 3300049577 Bacteria 4658
238 Ga0501041_0070081 3300049577 Bacteria 2152
239 Ga0501041_0143722 3300049577 Bacteria 1488
240 Ga0501042_0001724 3300049578 Bacteria 13073
241 Ga0501042_0089924 3300049578 Bacteria 2203
242 Ga0501042_0120889 3300049578 Bacteria 1885
243 Ga0501042_0224638 3300049578 Bacteria 1354
244 Ga0501042_0266878 3300049578 Bacteria 1236
245 Ga0501042_0367067 3300049578 Bacteria 1041
246 Ga0501046_0001948 3300049580 Bacteria 19611
247 Ga0501046_0122640 3300049580 Bacteria 1976
248 Ga0501046_0306795 3300049580 Bacteria 1158
249 Ga0501048_0003581 3300049582 Bacteria 11821
250 Ga0501048_0005909 3300049582 Bacteria 9319
251 Ga0501067_0010008 3300049583 Bacteria 5249
252 Ga0501068_0037408 3300049584 Bacteria 2906
253 Ga0501068_0156792 3300049584 Bacteria 1434
254 Ga0501069_0032268 3300049585 Bacteria 2882
255 Ga0501071_0000146 3300049587 Bacteria 29418
256 Ga0501071_0048565 3300049587 Bacteria 3053
257 Ga0501071_0055920 3300049587 Bacteria 2849
258 Ga0501071_0139073 3300049587 Bacteria 1808
259 Ga0501072_0002646 3300049588 Bacteria 13425
260 Ga0501072_0003271 3300049588 Bacteria 12171
261 Ga0501072_0007504 3300049588 Bacteria 8278
262 Ga0501072_0008426 3300049588 Bacteria 7824
263 Ga0501072_0014928 3300049588 Bacteria 5953
264 Ga0501072_0075621 3300049588 Bacteria 2664
265 Ga0501072_0193387 3300049588 Bacteria 1622
266 Ga0501072_0291670 3300049588 Bacteria 1297
267 Ga0501072_0393294 3300049588 Bacteria 1100
268 Ga0501073_0093033 3300049589 Bacteria 2095
269 Ga0501074_0005934 3300049590 Bacteria 8807
270 Ga0501074_0010661 3300049590 Bacteria 6672
271 Ga0501075_0001314 3300049591 Bacteria 16122
272 Ga0501075_0034584 3300049591 Bacteria 3763
273 Ga0501075_0052399 3300049591 Bacteria 3068
274 Ga0501075_0111256 3300049591 Bacteria 2082
275 Ga0501075_0151188 3300049591 Bacteria 1770
276 Ga0501075_0248747 3300049591 Bacteria 1355
277 Ga0501075_0372298 3300049591 Bacteria 1089
278 Ga0501076_0000744 3300049592 Bacteria 21082
279 Ga0501076_0007738 3300049592 Bacteria 7830
280 Ga0501076_0013604 3300049592 Bacteria 6104
281 Ga0501076_0088728 3300049592 Bacteria 2485
282 Ga0501076_0098661 3300049592 Bacteria 2353
283 Ga0501076_0104991 3300049592 Bacteria 2280
284 Ga0501076_0155255 3300049592 Bacteria 1863
285 Ga0501077_0000923 3300049593 Bacteria 17677
286 Ga0501077_0000991 3300049593 Bacteria 17089
287 Ga0501077_0002273 3300049593 Bacteria 11575
288 Ga0501077_0271707 3300049593 Bacteria 1078
289 Ga0501079_0000292 3300049741 Bacteria 30851
290 Ga0501079_0005300 3300049741 Bacteria 9593
291 Ga0501079_0007711 3300049741 Bacteria 8147
292 Ga0501079_0143648 3300049741 Bacteria 1859
293 Ga0501079_0157488 3300049741 Bacteria 1770
294 Ga0501079_0430025 3300049741 Bacteria 1036
295 Ga0501080_0000228 3300049742 Bacteria 42084
296 Ga0501080_0021152 3300049742 Bacteria 6021
297 Ga0501080_0166043 3300049742 Bacteria 2037
298 Ga0501081_0000416 3300049743 Bacteria 23512
299 Ga0501081_0004018 3300049743 Bacteria 9435
300 Ga0501081_0005179 3300049743 Bacteria 8391
301 Ga0501081_0010986 3300049743 Bacteria 5919
302 Ga0501081_0031769 3300049743 Bacteria 3578
303 Ga0501081_0243944 3300049743 Bacteria 1310
304 Ga0501035_0536390 3300049822 Bacteria 960
305 Ga0501045_0001822 3300049824 Bacteria 14382
306 Ga0501045_0011463 3300049824 Bacteria 6228
307 Ga0501045_0057916 3300049824 Bacteria 2836
308 Ga0501045_0096013 3300049824 Bacteria 2193
309 Ga0501045_0130446 3300049824 Bacteria 1868
310 Ga0501045_0310608 3300049824 Bacteria 1173
311 nmdc:mga05p37_100_c1 3300050507 Bacteria 77275
312 nmdc:mga05p37_1069113_c1 3300050507 Bacteria 849
313 nmdc:mga05p37_112702_c1 3300050507 Bacteria 3345
314 nmdc:mga05p37_132801_c1 3300050507 Bacteria 3054
315 nmdc:mga05p37_1366_c1 3300050507 Bacteria 28371
316 nmdc:mga05p37_15309_c1 3300050507 Bacteria 9214
317 nmdc:mga05p37_16443_c1 3300050507 Bacteria 8914
318 nmdc:mga05p37_261229_c1 3300050507 Bacteria 2072
319 nmdc:mga05p37_26126_c1 3300050507 Bacteria 7100
320 nmdc:mga05p37_307590_c1 3300050507 Bacteria 1880
321 nmdc:mga05p37_316981_c1 3300050507 Bacteria 1847
322 nmdc:mga05p37_7438_c1 3300050507 Bacteria 12921
323 nmdc:mga09592_15956_c1 3300050508 Bacteria 6137
324 nmdc:mga09592_345877_c1 3300050508 Bacteria 1287
325 nmdc:mga09592_3529_c1 3300050508 Bacteria 12634
326 nmdc:mga09592_5927_c1 3300050508 Bacteria 9962
327 nmdc:mga09592_97286_c1 3300050508 Bacteria 2519
328 nmdc:mga0qj67_107632_c1 3300050509 Bacteria 2249
329 nmdc:mga0qj67_1164_c1 3300050509 Bacteria 18212
330 nmdc:mga0qj67_125745_c1 3300050509 Bacteria 2075
331 nmdc:mga0qj67_245_c1 3300050509 Bacteria 36988
332 nmdc:mga0qj67_79643_c1 3300050509 Bacteria 2624
333 nmdc:mga0qj67_8788_c1 3300050509 Bacteria 7498
334 nmdc:mga06r32_120_c1 3300050510 Bacteria 56649
335 nmdc:mga06r32_151345_c1 3300050510 Bacteria 2299
336 nmdc:mga06r32_1625_c1 3300050510 Bacteria 20282
337 nmdc:mga06r32_2096_c1 3300050510 Bacteria 17861
338 nmdc:mga06r32_2181_c1 3300050510 Bacteria 17541
339 nmdc:mga06r32_2430_c1 3300050510 Bacteria 16667
340 nmdc:mga06r32_484061_c1 3300050510 Unclassified 1215
341 nmdc:mga06r32_75768_c1 3300050510 Bacteria 3266
342 nmdc:mga08y16_140012_c1 3300050511 Bacteria 2515
343 nmdc:mga08y16_2010_c2 3300050511 Bacteria 19390
344 nmdc:mga08y16_239950_c1 3300050511 Bacteria 1874
345 nmdc:mga08y16_74261_c1 3300050511 Bacteria 3543
346 nmdc:mga0n895_25864_c1 3300050512 Bacteria 5551
347 nmdc:mga0n895_4415_c2 3300050512 Bacteria 9681
348 nmdc:mga0n895_607529_c1 3300050512 Bacteria 1095
349 nmdc:mga0n895_8524_c1 3300050512 Bacteria 8883
350 nmdc:mga0rr50_12340_c1 3300050513 Bacteria 5519
351 nmdc:mga0rr50_143175_c1 3300050513 Bacteria 1925
352 nmdc:mga08x19_1593_c1 3300050514 Bacteria 14077
353 nmdc:mga08x19_71688_c1 3300050514 Bacteria 2259
354 nmdc:mga0a205_150_c2 3300050515 Bacteria 5988
355 nmdc:mga0a205_22230_c1 3300050515 Bacteria 6005
356 nmdc:mga0a205_292765_c1 3300050515 Bacteria 1502
357 nmdc:mga0a205_32451_c1 3300050515 Bacteria 5007
358 nmdc:mga0a205_34151_c1 3300050515 Bacteria 4880
359 nmdc:mga0a205_426466_c1 3300050515 Bacteria 1188
360 nmdc:mga0a205_7212_c1 3300050515 Bacteria 10051
361 Ga0495619_0012005 3300053085 Bacteria 5458
362 Ga0501084_0002964 3300054114 Bacteria 13745
363 Ga0501084_0003579 3300054114 Bacteria 12611
364 Ga0501084_0048322 3300054114 Bacteria 3562
365 Ga0501084_0119184 3300054114 Bacteria 2218
366 Ga0501084_0218701 3300054114 Bacteria 1607
367 Ga0590077_034635 3300059426 Bacteria 1110
368 Ga0501082_0001896 3300060353 Bacteria 18374
369 Ga0501082_0012444 3300060353 Bacteria 7312
370 Ga0501082_0015741 3300060353 Bacteria 6505
371 Ga0501082_0029046 3300060353 Bacteria 4764
372 Ga0501082_0100794 3300060353 Bacteria 2498
373 Ga0501082_0202522 3300060353 Bacteria 1727
374 Ga0501082_0254216 3300060353 Bacteria 1529
375 Ga0530510_0000017 3300061734 Bacteria 84530
376 Ga0530510_0003431 3300061734 Bacteria 10901
377 Ga0530510_0005969 3300061734 Bacteria 8448
378 Ga0530510_0012829 3300061734 Bacteria 5891
379 Ga0530510_0089558 3300061734 Bacteria 2243
380 Ga0530510_0103947 3300061734 Bacteria 2078
381 Ga0530510_0111197 3300061734 Bacteria 2007
382 Ga0530510_0122092 3300061734 Bacteria 1913
383 2501939744 2501939600 Bacteria 6907073
384 2856858373 2856858025 Bacteria 7255264
385 2889791702 2889790730 Bacteria 5689708
386 649813390 649633069 Bacteria 6962533
387 Ga0070706_100008142
388 Ga0070690_100027525
389 Ga0068869_100033364
390 Ga0070680_100019936
391 Ga0070691_10050838
392 Ga0070687_100069224
393 Ga0070692_10016616
394 Ga0070692_10040183
395 Ga0070669_100049364
396 Ga0070674_100376954
397 Ga0070673_100295671
398 Ga0070688_100116804
399 Ga0070701_10003914
400 Ga0070705_100097441
401 Ga0070705_100227784
402 Ga0070705_100437423
403 Ga0070700_100142013
404 Ga0070694_100082068
405 Ga0070708_100013420
406 Ga0070708_100051514
407 Ga0070708_100251132
408 Ga0070708_100358100
409 Ga0070685_10253788
410 Ga0070706_100017150
411 Ga0070706_100034330
412 Ga0070706_100038722
413 Ga0070706_100097445
414 Ga0070706_100158269
415 Ga0070707_100057225
416 Ga0070707_100064881
417 Ga0070707_100069007
418 Ga0070707_100159814
419 Ga0070707_100216928
420 Ga0070698_100000442
421 Ga0070698_100025855
422 Ga0070698_100039234
423 Ga0070698_100042872
424 Ga0070698_100189518
425 Ga0070698_100196026
426 Ga0070698_100281111
427 Ga0070699_100000086
428 Ga0070699_100037560
429 Ga0070699_100167786
430 Ga0070699_100176645
431 Ga0070699_100288203
432 Ga0070697_100023732
433 Ga0070697_100115091
434 Ga0070672_100056408
435 Ga0070695_100059436
436 Ga0070695_100061365
437 Ga0070696_100080359
438 Ga0070696_100106187
439 Ga0070693_100083955
440 Ga0070704_100020393
441 Ga0070704_100053044
442 Ga0070704_100060222
443 Ga0070704_100291926
444 Ga0068857_100015237
445 Ga0068857_100024781
446 Ga0070702_100383302
447 Ga0068859_100201623
448 Ga0068859_100266430
449 Ga0068859_100426379
450 Ga0068861_100273071
451 Ga0068863_100154896
452 Ga0068863_100578783
453 Ga0068858_100116608
454 Ga0068860_100063727
455 Ga0068862_100013677
456 Ga0068862_100121850
457 Ga0068862_100258578
458 Ga0081538_10015948
459 Ga0075428_100000294
460 Ga0075428_100000301
461 Ga0075428_100012275
462 Ga0075428_100022046
463 Ga0075428_100023669
464 Ga0075428_100181907
465 Ga0075428_100313424
466 Ga0075430_100000122
467 Ga0075430_100001055
468 Ga0075430_100084433
469 Ga0075430_100087336
470 Ga0075430_100143820
471 Ga0075430_100254515
472 Ga0075431_100000385
473 Ga0075431_100000529
474 Ga0075431_100001658
475 Ga0075431_100003179
476 Ga0075431_100010991
477 Ga0075431_100040926
478 Ga0075431_100051196
479 Ga0075431_100064998
480 Ga0075431_100137135
481 Ga0075433_10004856
482 Ga0075433_10018761
483 Ga0075433_10025218
484 Ga0075433_10038312
485 Ga0075433_10441660
486 Ga0075434_100002213
487 Ga0075434_100016191
488 Ga0075434_100030766
489 Ga0075429_100000817
490 Ga0075429_100005164
491 Ga0075429_100010605
492 Ga0075429_100044682
493 Ga0075429_100135416
494 Ga0075429_100205210
495 Ga0075429_100249101
496 Ga0075436_100019338
497 Ga0075436_100085306
498 Ga0097620_100201614
499 Ga0097620_100266441
500 Ga0097620_100426371
501 Ga0075435_100019965
502 Ga0075435_100193656
503 Ga0099794_10103494
504 Ga0111539_10003223
505 Ga0111539_10003599
506 Ga0111539_10054432
507 Ga0111539_10093986
508 Ga0111539_10340208
509 Ga0105245_10315022
510 Ga0105247_10074307
511 Ga0114129_10000002
512 Ga0114129_10002108
513 Ga0114129_10016473
514 Ga0114129_10020610
515 Ga0114129_10039942
516 Ga0114129_10047588
517 Ga0114129_10072859
518 Ga0114129_10158608
519 Ga0114129_10218551
520 Ga0114129_10655013
521 Ga0105243_10086479
522 Ga0105241_10038005
523 Ga0105242_10010075
524 Ga0105242_10191977
525 Ga0105249_10122040
526 Ga0105249_10339171
527 Ga0163162_10136987
528 Ga0163162_10220434
529 Ga0163163_10437855
530 Ga0163161_10189863
531 Ga0207710_10098285
532 Ga0207684_10002934
533 Ga0207684_10018107
534 Ga0207684_10020529
535 Ga0207684_10026992
536 Ga0207684_10211713
537 Ga0207660_10205150
538 Ga0207646_10006505
539 Ga0207646_10044374
540 Ga0207646_10062684
541 Ga0207646_10075432
542 Ga0207646_10090011
543 Ga0207646_10131447
544 Ga0207681_10078802
545 Ga0207686_10018581
546 Ga0207686_10325057
547 Ga0207709_10008954
548 Ga0207669_10417052
549 Ga0207704_10230040
550 Ga0207691_10020997
551 Ga0207711_10061398
552 Ga0207689_10023717
553 Ga0207640_10529497
554 Ga0207703_10074391
555 Ga0207641_10025713
556 Ga0207641_10191088
557 Ga0207648_10040489
558 Ga0207648_10122334
559 Ga0207648_10320571
560 Ga0207674_10014947
561 Ga0207674_10039946
562 Ga0207675_100022867
563 Ga0207675_100592756
564 Ga0209999_1014255
565 Ga0207428_10000548
566 Ga0207428_10054163
567 Ga0207428_10100054
568 Ga0268265_10007648
569 Ga0268265_10022135
570 Ga0268264_10106358
571 Ga0307408_100047165
572 Ga0307408_100052249
573 Ga0316579_10004876
574 Ga0316576_10032032
575 Ga0316577_10000200
576 Ga0316577_10212082
577 Ga0307410_10048317
578 Ga0307410_10271079
579 Ga0307416_100059644
580 Ga0307411_10091906
581 Ga0373949_0054976
582 Ga0373941_0017828
583 Ga0316582_0007326
584 Ga0316584_0000400
585 Ga0316584_0098652
586 Ga0316584_0311992
587 Ga0395898_0006966
588 Ga0316581_0000814
589 Ga0395901_0000511
590 Ga0400489_33902
591 Ga0439435_0025823
592 Ga0439460_0019852
593 Ga0451577_0010552
594 Ga0453683_0002840
595 Ga0451576_0001138
596 Ga0451576_0005571
597 Ga0451576_0064386
598 Ga0451576_0111723
599 Ga0451576_0197963
600 Ga0495603_0141423
601 Ga0496102_0135202
602 Ga0501031_0037033
603 Ga0501031_0038031
604 Ga0501031_0218246
605 Ga0501031_0218588
606 Ga0501036_0070639
607 Ga0501036_0099849
608 Ga0501036_0202832
609 Ga0501037_0065148
610 Ga0501038_0002016
611 Ga0501038_0045154
612 Ga0501038_0070206
613 Ga0501038_0263880
614 Ga0501039_0046678
615 Ga0501039_0096811
616 Ga0501039_0118990
617 Ga0501039_0409999
618 Ga0501040_0001666
619 Ga0501040_0067529
620 Ga0501040_0082863
621 Ga0501041_0000972
622 Ga0501041_0011686
623 Ga0501041_0014631
624 Ga0501041_0070081
625 Ga0501041_0143722
626 Ga0501042_0001724
627 Ga0501042_0089924
628 Ga0501042_0120889
629 Ga0501042_0224638
630 Ga0501042_0266878
631 Ga0501042_0367067
632 Ga0501046_0001948
633 Ga0501046_0122640
634 Ga0501046_0306795
635 Ga0501048_0003581
636 Ga0501048_0005909
637 Ga0501067_0010008
638 Ga0501068_0037408
639 Ga0501068_0156792
640 Ga0501069_0032268
641 Ga0501071_0000146
642 Ga0501071_0048565
643 Ga0501071_0055920
644 Ga0501071_0139073
645 Ga0501072_0002646
646 Ga0501072_0003271
647 Ga0501072_0007504
648 Ga0501072_0008426
649 Ga0501072_0014928
650 Ga0501072_0075621
651 Ga0501072_0193387
652 Ga0501072_0291670
653 Ga0501072_0393294
654 Ga0501073_0093033
655 Ga0501074_0005934
656 Ga0501074_0010661
657 Ga0501075_0001314
658 Ga0501075_0034584
659 Ga0501075_0052399
660 Ga0501075_0111256
661 Ga0501075_0151188
662 Ga0501075_0248747
663 Ga0501075_0372298
664 Ga0501076_0000744
665 Ga0501076_0007738
666 Ga0501076_0013604
667 Ga0501076_0088728
668 Ga0501076_0098661
669 Ga0501076_0104991
670 Ga0501076_0155255
671 Ga0501077_0000923
672 Ga0501077_0000991
673 Ga0501077_0002273
674 Ga0501077_0271707
675 Ga0501079_0000292
676 Ga0501079_0005300
677 Ga0501079_0007711
678 Ga0501079_0143648
679 Ga0501079_0157488
680 Ga0501079_0430025
681 Ga0501080_0000228
682 Ga0501080_0021152
683 Ga0501080_0166043
684 Ga0501081_0000416
685 Ga0501081_0004018
686 Ga0501081_0005179
687 Ga0501081_0010986
688 Ga0501081_0031769
689 Ga0501081_0243944
690 Ga0501035_0536390
691 Ga0501045_0001822
692 Ga0501045_0011463
693 Ga0501045_0057916
694 Ga0501045_0096013
695 Ga0501045_0130446
696 Ga0501045_0310608
697 nmdc:mga05p37_100_c1
698 nmdc:mga05p37_1069113_c1
699 nmdc:mga05p37_112702_c1
700 nmdc:mga05p37_132801_c1
701 nmdc:mga05p37_1366_c1
702 nmdc:mga05p37_15309_c1
703 nmdc:mga05p37_16443_c1
704 nmdc:mga05p37_261229_c1
705 nmdc:mga05p37_26126_c1
706 nmdc:mga05p37_307590_c1
707 nmdc:mga05p37_316981_c1
708 nmdc:mga05p37_7438_c1
709 nmdc:mga09592_15956_c1
710 nmdc:mga09592_345877_c1
711 nmdc:mga09592_3529_c1
712 nmdc:mga09592_5927_c1
713 nmdc:mga09592_97286_c1
714 nmdc:mga0qj67_107632_c1
715 nmdc:mga0qj67_1164_c1
716 nmdc:mga0qj67_125745_c1
717 nmdc:mga0qj67_245_c1
718 nmdc:mga0qj67_79643_c1
719 nmdc:mga0qj67_8788_c1
720 nmdc:mga06r32_120_c1
721 nmdc:mga06r32_151345_c1
722 nmdc:mga06r32_1625_c1
723 nmdc:mga06r32_2096_c1
724 nmdc:mga06r32_2181_c1
725 nmdc:mga06r32_2430_c1
726 nmdc:mga06r32_484061_c1
727 nmdc:mga06r32_75768_c1
728 nmdc:mga08y16_140012_c1
729 nmdc:mga08y16_2010_c2
730 nmdc:mga08y16_239950_c1
731 nmdc:mga08y16_74261_c1
732 nmdc:mga0n895_25864_c1
733 nmdc:mga0n895_4415_c2
734 nmdc:mga0n895_607529_c1
735 nmdc:mga0n895_8524_c1
736 nmdc:mga0rr50_12340_c1
737 nmdc:mga0rr50_143175_c1
738 nmdc:mga08x19_1593_c1
739 nmdc:mga08x19_71688_c1
740 nmdc:mga0a205_150_c2
741 nmdc:mga0a205_22230_c1
742 nmdc:mga0a205_292765_c1
743 nmdc:mga0a205_32451_c1
744 nmdc:mga0a205_34151_c1
745 nmdc:mga0a205_426466_c1
746 nmdc:mga0a205_7212_c1
747 Ga0495619_0012005
748 Ga0501084_0002964
749 Ga0501084_0003579
750 Ga0501084_0048322
751 Ga0501084_0119184
752 Ga0501084_0218701
753 Ga0590077_034635
754 Ga0501082_0001896
755 Ga0501082_0012444
756 Ga0501082_0015741
757 Ga0501082_0029046
758 Ga0501082_0100794
759 Ga0501082_0202522
760 Ga0501082_0254216
761 Ga0530510_0000017
762 Ga0530510_0003431
763 Ga0530510_0005969
764 Ga0530510_0012829
765 Ga0530510_0089558
766 Ga0530510_0103947
767 Ga0530510_0111197
768 Ga0530510_0122092
769 2501939744
770 2856858373
771 2889791702
772 649813390

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

132

334

0.99

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

19

121

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8618 76 286
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.8529 77 286
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8282 76 286
7ahd-assembly1.cif.gz_B opua (e190q) occluded 0.827 83 282
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.8187 76 286
ID Description Score Start End Superfamily
af_Q2G1F7_265_478_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9376 73 282 1.10.3720.10
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9312 74 286 1.10.3720.10
af_P75798_87_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9286 75 286 1.10.3720.10
af_Q2FYQ5_85_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9245 66 288 1.10.3720.10
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.923 74 286 1.10.3720.10
ID Description Score Start End GO Terms
AF-R5WZZ0-F1-model_v4 Peptide ABC transporter permease 0.951 42 288 GO:0005886
GO:0055085
AF-A0A259V0P7-F1-model_v4 deleted 0.95 58 290
AF-A0A2I0CXI4-F1-model_v4 ABC transporter permease 0.9491 58 292 GO:0005886
GO:0055085
AF-A0A447LB45-F1-model_v4 deleted 0.9467 65 290
AF-A0A2N2S784-F1-model_v4 Glutathione ABC transporter permease GsiC 0.9465 59 290 GO:0005886
GO:0055085

Map