F430420

General Info

Members Datasets Scaffolds Average Seq Length
386 196 772 99

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_101015856|Ga0070671_1010158561
Length 117
Sequence MYERRGERRRGSGVGATEQQEKHYGYHGDKDALVKRLHRIEGQVRGIEKMVVDDRYCIDILTQLGAVTTALESLGFQILDQHVKHCVAGALASGDEADAQQKSEELLEAVKRFAKVK

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
85 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
87 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
88 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
89 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
99 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
131 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 11.92
Rhizosphere 87.31
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_101015856 3300005355 Bacteria 727
2 Ga0070683_100886468 3300005329 Bacteria 856
3 Ga0070683_101216509 3300005329 Bacteria 724
4 Ga0070666_11507062 3300005335 Bacteria 503
5 Ga0070680_101477572 3300005336 Bacteria 589
6 Ga0070691_10096309 3300005341 Bacteria 1465
7 Ga0070687_100215843 3300005343 Bacteria 1172
8 Ga0070668_101284852 3300005347 Bacteria 665
9 Ga0070674_100033180 3300005356 Bacteria 3434
10 Ga0070673_100347909 3300005364 Bacteria 1315
11 Ga0070667_100003811 3300005367 Bacteria 12823
12 Ga0070667_101681154 3300005367 Bacteria 597
13 Ga0070714_101328704 3300005435 Bacteria 702
14 Ga0070714_101708086 3300005435 Bacteria 615
15 Ga0070705_100933896 3300005440 Bacteria 700
16 Ga0070700_100452143 3300005441 Bacteria 978
17 Ga0070708_100343376 3300005445 Bacteria 1407
18 Ga0070662_100804738 3300005457 Bacteria 799
19 Ga0070681_10165528 3300005458 Bacteria 2134
20 Ga0070681_10451666 3300005458 Bacteria 1197
21 Ga0068867_100342613 3300005459 Bacteria 1245
22 Ga0070685_10504002 3300005466 Bacteria 857
23 Ga0070707_100024453 3300005468 Bacteria 5722
24 Ga0070698_100180406 3300005471 Bacteria 2050
25 Ga0070698_101376823 3300005471 Bacteria 656
26 Ga0070699_100331107 3300005518 Bacteria 1370
27 Ga0070699_102184899 3300005518 Bacteria 505
28 Ga0070679_100154777 3300005530 Bacteria 2268
29 Ga0070684_100146204 3300005535 Bacteria 2140
30 Ga0070684_100478745 3300005535 Bacteria 1152
31 Ga0070684_100813554 3300005535 Bacteria 874
32 Ga0070686_101506423 3300005544 Bacteria 567
33 Ga0070695_101149604 3300005545 Bacteria 637
34 Ga0070696_102020645 3300005546 Bacteria 501
35 Ga0068855_101529836 3300005563 Bacteria 684
36 Ga0068854_101804182 3300005578 Bacteria 561
37 Ga0068856_100825138 3300005614 Unclassified 947
38 Ga0068852_100585327 3300005616 Bacteria 1119
39 Ga0068859_101239030 3300005617 Bacteria 822
40 Ga0068864_101273348 3300005618 Bacteria 735
41 Ga0068870_10668674 3300005840 Bacteria 713
42 Ga0081455_10021665 3300005937 Bacteria 6021
43 Ga0081455_10113093 3300005937 Bacteria 2154
44 Ga0081455_10159302 3300005937 Bacteria 1732
45 Ga0081455_10976141 3300005937 Bacteria 525
46 Ga0070717_10366257 3300006028 Bacteria 1291
47 Ga0075365_10408200 3300006038 Bacteria 959
48 Ga0075365_10508852 3300006038 Bacteria 851
49 Ga0070715_10554014 3300006163 Bacteria 667
50 Ga0070712_101543091 3300006175 Bacteria 581
51 Ga0097621_100276913 3300006237 Bacteria 1476
52 Ga0068871_101610829 3300006358 Bacteria 615
53 Ga0075428_100123670 3300006844 Bacteria 2816
54 Ga0075428_101011701 3300006844 Bacteria 880
55 Ga0075428_101241245 3300006844 Bacteria 785
56 Ga0075430_100070528 3300006846 Bacteria 2931
57 Ga0075431_100268514 3300006847 Bacteria 1730
58 Ga0075433_10512991 3300006852 Bacteria 1055
59 Ga0075433_10843092 3300006852 Bacteria 800
60 Ga0075434_100137878 3300006871 Bacteria 2459
61 Ga0068865_100362182 3300006881 Bacteria 1178
62 Ga0075436_100273652 3300006914 Bacteria 1206
63 Ga0075436_100667482 3300006914 Bacteria 769
64 Ga0097620_101238816 3300006931 Bacteria 822
65 Ga0075435_100965478 3300007076 Bacteria 744
66 Ga0075435_101818794 3300007076 Bacteria 535
67 Ga0111539_10104393 3300009094 Bacteria 3325
68 Ga0111539_10178697 3300009094 Bacteria 2479
69 Ga0111539_10791715 3300009094 Bacteria 1103
70 Ga0105245_10061280 3300009098 Bacteria 3391
71 Ga0105245_10701598 3300009098 Bacteria 1045
72 Ga0114129_10148445 3300009147 Bacteria 3210
73 Ga0114129_10384689 3300009147 Bacteria 1852
74 Ga0105243_10402332 3300009148 Bacteria 1272
75 Ga0105243_12154230 3300009148 Bacteria 594
76 Ga0105242_11031441 3300009176 Bacteria 832
77 Ga0105248_10316084 3300009177 Bacteria 1759
78 Ga0105248_10553350 3300009177 Bacteria 1298
79 Ga0105248_11693432 3300009177 Bacteria 717
80 Ga0105248_13261584 3300009177 Bacteria 516
81 Ga0105237_11741154 3300009545 Bacteria 631
82 Ga0105238_11782884 3300009551 Bacteria 647
83 Ga0105239_10253873 3300010375 Bacteria 1975
84 Ga0105239_11574182 3300010375 Bacteria 760
85 Ga0157369_11854185 3300013105 Bacteria 612
86 Ga0157374_10218215 3300013296 Bacteria 1871
87 Ga0163162_10373745 3300013306 Bacteria 1558
88 Ga0157375_10068584 3300013308 Bacteria 3549
89 Ga0157375_10298686 3300013308 Bacteria 1774
90 Ga0163163_10628202 3300014325 Bacteria 1137
91 Ga0157380_12275810 3300014326 Bacteria 606
92 Ga0157380_12505886 3300014326 Bacteria 582
93 Ga0157380_13013618 3300014326 Bacteria 537
94 Ga0207707_10377475 3300025912 Bacteria 1219
95 Ga0207652_10056315 3300025921 Bacteria 3385
96 Ga0207646_10020967 3300025922 Bacteria 6045
97 Ga0207687_10922032 3300025927 Bacteria 748
98 Ga0207664_10269333 3300025929 Bacteria 1492
99 Ga0207706_10674690 3300025933 Bacteria 884
100 Ga0207709_11331793 3300025935 Bacteria 594
101 Ga0207661_10707431 3300025944 Bacteria 927
102 Ga0207661_11279323 3300025944 Bacteria 674
103 Ga0207667_11531575 3300025949 Bacteria 637
104 Ga0207651_11067984 3300025960 Bacteria 723
105 Ga0207658_10004445 3300025986 Bacteria 9751
106 Ga0207678_11985798 3300026067 Bacteria 506
107 Ga0207702_10537257 3300026078 Bacteria 1142
108 Ga0207428_10142586 3300027907 Bacteria 1827
109 Ga0265327_10084056 3300031251 Bacteria 1565
110 Ga0265327_10415991 3300031251 Bacteria 583
111 Ga0307408_100241172 3300031548 Bacteria 1486
112 Ga0265314_10184932 3300031711 Bacteria 1245
113 Ga0307406_11101232 3300031901 Bacteria 686
114 Ga0307411_11141535 3300032005 Bacteria 704
115 Ga0373952_0065247 3300035092 Bacteria 899
116 Ga0373936_0036275 3300035113 Bacteria 1965
117 Ga0373936_0488637 3300035113 Bacteria 572
118 Ga0373939_0109446 3300035114 Bacteria 960
119 Ga0373939_0403925 3300035114 Bacteria 567
120 Ga0373942_0024715 3300035207 Bacteria 1543
121 Ga0373961_0417678 3300035241 Bacteria 518
122 Ga0373931_0403621 3300035691 Bacteria 866
123 Ga0373933_0425674 3300035724 Bacteria 867
124 Ga0373933_0512453 3300035724 Bacteria 786
125 Ga0373947_0695137 3300035725 Bacteria 694
126 Ga0373947_0706551 3300035725 Bacteria 688
127 Ga0373925_0434863 3300037068 Bacteria 1073
128 Ga0395899_0001108 3300037312 Bacteria 24135
129 Ga0395899_0002173 3300037312 Bacteria 16120
130 Ga0395899_0031167 3300037312 Bacteria 4007
131 Ga0395899_0079777 3300037312 Bacteria 2384
132 Ga0395899_0100185 3300037312 Bacteria 2092
133 Ga0395899_0252020 3300037312 Bacteria 1211
134 Ga0395899_0429880 3300037312 Bacteria 868
135 Ga0395900_0004980 3300037418 Bacteria 13963
136 Ga0395900_0007691 3300037418 Bacteria 11113
137 Ga0395900_0015521 3300037418 Bacteria 7764
138 Ga0395900_0019954 3300037418 Bacteria 6833
139 Ga0395900_0057986 3300037418 Bacteria 3986
140 Ga0395900_0083657 3300037418 Bacteria 3278
141 Ga0395900_0120521 3300037418 Bacteria 2692
142 Ga0395900_0145095 3300037418 Bacteria 2427
143 Ga0395900_0257017 3300037418 Bacteria 1746
144 Ga0395898_0002026 3300037466 Bacteria 25402
145 Ga0395898_0014172 3300037466 Bacteria 8198
146 Ga0395898_0014219 3300037466 Bacteria 8183
147 Ga0395898_0016034 3300037466 Bacteria 7674
148 Ga0395898_0037495 3300037466 Bacteria 4807
149 Ga0395898_0079946 3300037466 Bacteria 3153
150 Ga0395898_0186916 3300037466 Bacteria 1980
151 Ga0395898_0334824 3300037466 Bacteria 1443
152 Ga0395898_0460052 3300037466 Bacteria 1211
153 Ga0395898_1511200 3300037466 Bacteria 597
154 Ga0395905_0004863 3300037471 Bacteria 13848
155 Ga0395905_0008004 3300037471 Bacteria 10444
156 Ga0395905_0015870 3300037471 Bacteria 7155
157 Ga0395905_0026108 3300037471 Bacteria 5508
158 Ga0395905_0031534 3300037471 Bacteria 4990
159 Ga0395905_0081278 3300037471 Bacteria 3037
160 Ga0395905_0121076 3300037471 Bacteria 2460
161 Ga0395905_0166510 3300037471 Bacteria 2071
162 Ga0395905_0824873 3300037471 Bacteria 830
163 Ga0395901_0032733 3300038443 Bacteria 5363
164 Ga0395901_0054093 3300038443 Bacteria 4171
165 Ga0395901_0064178 3300038443 Bacteria 3822
166 Ga0395901_0104183 3300038443 Bacteria 2977
167 Ga0395901_0105629 3300038443 Bacteria 2955
168 Ga0395901_0156111 3300038443 Bacteria 2397
169 Ga0395901_0179822 3300038443 Bacteria 2218
170 Ga0395901_0400500 3300038443 Bacteria 1410
171 Ga0395901_0514743 3300038443 Bacteria 1216
172 Ga0395901_1072476 3300038443 Bacteria 777
173 Ga0439448_0280553 3300042005 Bacteria 590
174 Ga0439460_0325913 3300042461 Bacteria 539
175 Ga0466965_0080125 3300044683 Bacteria 1650
176 Ga0466961_0045730 3300044693 Bacteria 2800
177 Ga0466963_0327867 3300044694 Bacteria 1078
178 Ga0466963_0870900 3300044694 Bacteria 635
179 Ga0466964_0170384 3300044706 Bacteria 1025
180 Ga0466971_0005662 3300044719 Bacteria 5430
181 Ga0466968_0227517 3300044735 Bacteria 880
182 Ga0466957_0000852 3300044842 Bacteria 15652
183 Ga0466957_0014699 3300044842 Bacteria 4561
184 Ga0466957_0485595 3300044842 Bacteria 855
185 Ga0466960_0219460 3300044901 Bacteria 1046
186 Ga0466959_0010475 3300045049 Bacteria 6632
187 Ga0466959_0305765 3300045049 Bacteria 1088
188 Ga0451576_1491354 3300045051 Bacteria 703
189 Ga0466958_0003772 3300045836 Bacteria 7913
190 Ga0466958_0183082 3300045836 Bacteria 1330
191 Ga0466967_0017062 3300045976 Bacteria 5749
192 Ga0466967_0018605 3300045976 Bacteria 5558
193 Ga0466967_0136232 3300045976 Bacteria 2283
194 Ga0466967_0609760 3300045976 Bacteria 1078
195 Ga0495617_275672 3300046452 Bacteria 516
196 Ga0495603_0254591 3300046455 Bacteria 1011
197 Ga0495629_0002879 3300046459 Bacteria 13150
198 Ga0495629_0858285 3300046459 Unclassified 597
199 Ga0495651_0732334 3300046462 Bacteria 614
200 Ga0495582_0580655 3300046473 Bacteria 648
201 Ga0495608_0606074 3300046511 Bacteria 657
202 Ga0495628_0487303 3300046516 Bacteria 892
203 Ga0495630_0935660 3300046517 Bacteria 660
204 Ga0495644_0177272 3300046523 Bacteria 819
205 Ga0495644_0251804 3300046523 Bacteria 686
206 Ga0495640_0622197 3300046533 Bacteria 651
207 Ga0495586_0315273 3300046535 Bacteria 897
208 Ga0495667_0555731 3300046559 Bacteria 717
209 Ga0495634_0418452 3300046642 Bacteria 794
210 Ga0495634_0595782 3300046642 Bacteria 642
211 Ga0495635_0475077 3300046663 Bacteria 825
212 Ga0495599_0398528 3300046678 Bacteria 820
213 Ga0495623_0382325 3300046679 Bacteria 761
214 Ga0495658_0253288 3300046683 Bacteria 1108
215 Ga0495613_0026986 3300046689 Bacteria 4275
216 Ga0495613_0528674 3300046689 Bacteria 791
217 Ga0495613_0673800 3300046689 Bacteria 683
218 Ga0495613_1108250 3300046689 Bacteria 505
219 Ga0495589_0209321 3300046794 Bacteria 918
220 Ga0495676_0980910 3300047321 Bacteria 540
221 Ga0495684_0414148 3300047471 Bacteria 943
222 Ga0496100_0193457 3300048903 Bacteria 1478
223 Ga0496100_0487556 3300048903 Bacteria 948
224 Ga0496100_1013459 3300048903 Bacteria 653
225 Ga0496101_0207475 3300048904 Bacteria 1517
226 Ga0496101_1038200 3300048904 Bacteria 644
227 Ga0496102_0005106 3300048905 Bacteria 11119
228 Ga0496102_1585402 3300048905 Bacteria 573
229 Ga0496103_0170043 3300048906 Bacteria 1399
230 Ga0496104_0002750 3300048907 Bacteria 15145
231 Ga0496104_0122425 3300048907 Bacteria 2497
232 Ga0496104_0487463 3300048907 Bacteria 1144
233 Ga0496104_0698158 3300048907 Bacteria 922
234 Ga0496105_0009844 3300048908 Bacteria 7492
235 Ga0496106_0044706 3300048909 Bacteria 3325
236 Ga0496106_0157172 3300048909 Bacteria 1796
237 Ga0496106_0658993 3300048909 Bacteria 836
238 Ga0496106_1566267 3300048909 Bacteria 505
239 Ga0496107_0007379 3300048910 Bacteria 7582
240 Ga0496107_0668800 3300048910 Bacteria 765
241 Ga0496107_1055137 3300048910 Bacteria 588
242 Ga0496108_0044275 3300048911 Bacteria 3717
243 Ga0496108_0348035 3300048911 Bacteria 1293
244 Ga0496108_0381146 3300048911 Bacteria 1231
245 Ga0496109_0050880 3300048912 Bacteria 3773
246 Ga0496109_0086386 3300048912 Bacteria 2897
247 Ga0496109_0101947 3300048912 Bacteria 2664
248 Ga0496109_0453574 3300048912 Bacteria 1211
249 Ga0496109_0485678 3300048912 Unclassified 1166
250 Ga0496109_1174903 3300048912 Bacteria 704
251 Ga0496110_0062471 3300048913 Bacteria 3289
252 Ga0496110_0151555 3300048913 Bacteria 2099
253 Ga0496110_0353572 3300048913 Bacteria 1338
254 Ga0496110_0584375 3300048913 Bacteria 1014
255 Ga0496111_0001995 3300048914 Bacteria 12140
256 Ga0496111_0159691 3300048914 Bacteria 1673
257 Ga0496111_0293322 3300048914 Bacteria 1206
258 Ga0496112_0004613 3300048915 Bacteria 11720
259 Ga0496112_0010772 3300048915 Bacteria 8316
260 Ga0496112_0015040 3300048915 Bacteria 7203
261 Ga0496112_0026134 3300048915 Bacteria 5613
262 Ga0496112_0183525 3300048915 Bacteria 2056
263 Ga0496112_0238035 3300048915 Bacteria 1774
264 Ga0496113_0010926 3300048916 Bacteria 6028
265 Ga0496113_0082999 3300048916 Bacteria 2458
266 Ga0496113_0453837 3300048916 Bacteria 1030
267 Ga0496115_0107462 3300048918 Bacteria 2291
268 Ga0501031_0010474 3300049568 Bacteria 6039
269 Ga0501031_0050548 3300049568 Bacteria 2708
270 Ga0501031_0055603 3300049568 Bacteria 2578
271 Ga0501031_0186073 3300049568 Bacteria 1356
272 Ga0501032_0059620 3300049569 Bacteria 2561
273 Ga0501032_0213133 3300049569 Bacteria 1258
274 Ga0501033_0035738 3300049570 Bacteria 3724
275 Ga0501034_0009879 3300049571 Bacteria 9976
276 Ga0501036_0003717 3300049572 Bacteria 12234
277 Ga0501036_1343705 3300049572 Bacteria 580
278 Ga0501037_0006663 3300049573 Bacteria 8445
279 Ga0501038_0019614 3300049574 Bacteria 6091
280 Ga0501039_0003326 3300049575 Bacteria 12016
281 Ga0501039_0678479 3300049575 Bacteria 806
282 Ga0501040_0003162 3300049576 Bacteria 10667
283 Ga0501040_0175175 3300049576 Bacteria 1520
284 Ga0501041_0004122 3300049577 Bacteria 8403
285 Ga0501041_0012584 3300049577 Bacteria 5011
286 Ga0501041_0079861 3300049577 Bacteria 2013
287 Ga0501041_0190115 3300049577 Bacteria 1286
288 Ga0501042_0007069 3300049578 Bacteria 7333
289 Ga0501042_0036861 3300049578 Bacteria 3469
290 Ga0501042_0333454 3300049578 Bacteria 1096
291 Ga0501043_0192504 3300049579 Bacteria 1585
292 Ga0501043_0222864 3300049579 Bacteria 1458
293 Ga0501043_0412620 3300049579 Bacteria 1019
294 Ga0501046_0043169 3300049580 Bacteria 3590
295 Ga0501046_0211054 3300049580 Bacteria 1441
296 Ga0501046_0224601 3300049580 Bacteria 1389
297 Ga0501046_0541564 3300049580 Bacteria 830
298 Ga0501047_0028431 3300049581 Bacteria 5390
299 Ga0501048_0011097 3300049582 Bacteria 6716
300 Ga0501048_0014778 3300049582 Bacteria 5775
301 Ga0501048_0176031 3300049582 Bacteria 1516
302 Ga0501067_0001144 3300049583 Bacteria 14395
303 Ga0501067_0551145 3300049583 Bacteria 646
304 Ga0501068_0009931 3300049584 Bacteria 5335
305 Ga0501068_0100955 3300049584 Bacteria 1788
306 Ga0501068_0132691 3300049584 Bacteria 1558
307 Ga0501068_0484191 3300049584 Bacteria 802
308 Ga0501069_0003298 3300049585 Bacteria 8280
309 Ga0501069_0107780 3300049585 Bacteria 1584
310 Ga0501070_0020527 3300049586 Bacteria 5540
311 Ga0501070_0088419 3300049586 Bacteria 2564
312 Ga0501070_0088603 3300049586 Bacteria 2561
313 Ga0501070_0593733 3300049586 Bacteria 883
314 Ga0501070_0699500 3300049586 Bacteria 802
315 Ga0501070_1340716 3300049586 Bacteria 545
316 Ga0501071_0018121 3300049587 Bacteria 4869
317 Ga0501071_0926623 3300049587 Bacteria 672
318 Ga0501072_0100286 3300049588 Bacteria 2301
319 Ga0501072_0258409 3300049588 Bacteria 1386
320 Ga0501072_0452271 3300049588 Bacteria 1017
321 Ga0501073_0298444 3300049589 Bacteria 1111
322 Ga0501073_0896003 3300049589 Bacteria 611
323 Ga0501074_0002850 3300049590 Bacteria 12107
324 Ga0501074_0220871 3300049590 Bacteria 1349
325 Ga0501074_1118823 3300049590 Bacteria 553
326 Ga0501075_0012479 3300049591 Bacteria 6039
327 Ga0501075_0065733 3300049591 Bacteria 2736
328 Ga0501076_0001770 3300049592 Bacteria 14622
329 Ga0501076_0022838 3300049592 Bacteria 4812
330 Ga0501076_0898211 3300049592 Bacteria 730
331 Ga0501077_0002902 3300049593 Bacteria 10283
332 Ga0501077_0719971 3300049593 Bacteria 641
333 Ga0501079_0003743 3300049741 Bacteria 11223
334 Ga0501079_0031920 3300049741 Bacteria 4047
335 Ga0501079_0042783 3300049741 Bacteria 3497
336 Ga0501079_0367110 3300049741 Bacteria 1128
337 Ga0501080_0315214 3300049742 Bacteria 1417
338 Ga0501080_0387444 3300049742 Bacteria 1258
339 Ga0501080_0933910 3300049742 Bacteria 755
340 Ga0501080_0950859 3300049742 Bacteria 747
341 Ga0501081_0005118 3300049743 Bacteria 8436
342 Ga0501081_0008256 3300049743 Bacteria 6758
343 Ga0501081_0312204 3300049743 Bacteria 1154
344 Ga0501081_0382236 3300049743 Bacteria 1040
345 Ga0501081_0717761 3300049743 Bacteria 751
346 Ga0501081_0850328 3300049743 Bacteria 687
347 Ga0501083_0034503 3300049744 Bacteria 3459
348 Ga0501083_0059090 3300049744 Bacteria 2565
349 Ga0501035_0033208 3300049822 Bacteria 4693
350 Ga0501035_0339659 3300049822 Bacteria 1258
351 Ga0501035_0688085 3300049822 Bacteria 826
352 Ga0501044_0011263 3300049823 Bacteria 9692
353 Ga0501045_0006828 3300049824 Bacteria 7905
354 Ga0501045_0070330 3300049824 Bacteria 2574
355 nmdc:mga0yw44_510982_c1 3300050492 Bacteria 815
356 nmdc:mga05p37_150011_c1 3300050507 Bacteria 2852
357 nmdc:mga05p37_165465_c1 3300050507 Bacteria 2699
358 nmdc:mga0qj67_28589_c1 3300050509 Bacteria 4328
359 nmdc:mga06r32_303214_c1 3300050510 Bacteria 1583
360 nmdc:mga08y16_173989_c1 3300050511 Bacteria 2235
361 nmdc:mga08y16_211101_c1 3300050511 Bacteria 2010
362 nmdc:mga08y16_24203_c1 3300050511 Bacteria 6409
363 nmdc:mga0n895_119156_c1 3300050512 Bacteria 2660
364 nmdc:mga0rr50_1682033_c1 3300050513 Bacteria 535
365 nmdc:mga08x19_36325_c1 3300050514 Bacteria 3120
366 nmdc:mga08x19_584191_c1 3300050514 Bacteria 791
367 nmdc:mga0a205_224230_c1 3300050515 Bacteria 1764
368 nmdc:mga0a205_364042_c1 3300050515 Bacteria 1312
369 Ga0495601_0074360 3300053077 Bacteria 2174
370 Ga0495619_0352654 3300053085 Bacteria 1018
371 Ga0501084_0003734 3300054114 Bacteria 12363
372 Ga0501084_0028522 3300054114 Bacteria 4667
373 Ga0501084_0148937 3300054114 Bacteria 1972
374 Ga0501084_0863333 3300054114 Bacteria 761
375 Ga0501084_1214112 3300054114 Bacteria 632
376 Ga0590071_119564 3300059421 Bacteria 672
377 Ga0501082_0005285 3300060353 Bacteria 11223
378 Ga0501082_0050950 3300060353 Bacteria 3569
379 Ga0501082_0122313 3300060353 Bacteria 2256
380 Ga0501082_0561726 3300060353 Bacteria 998
381 Ga0466962_0001933 3300061719 Bacteria 9756
382 Ga0466962_0360073 3300061719 Bacteria 725
383 Ga0530510_0002110 3300061734 Bacteria 13640
384 Ga0530510_0007324 3300061734 Bacteria 7679
385 Ga0530510_0025852 3300061734 Bacteria 4199
386 Ga0530510_0466572 3300061734 Bacteria 955
387 Ga0070671_101015856
388 Ga0070683_100886468
389 Ga0070683_101216509
390 Ga0070666_11507062
391 Ga0070680_101477572
392 Ga0070691_10096309
393 Ga0070687_100215843
394 Ga0070668_101284852
395 Ga0070674_100033180
396 Ga0070673_100347909
397 Ga0070667_100003811
398 Ga0070667_101681154
399 Ga0070714_101328704
400 Ga0070714_101708086
401 Ga0070705_100933896
402 Ga0070700_100452143
403 Ga0070708_100343376
404 Ga0070662_100804738
405 Ga0070681_10165528
406 Ga0070681_10451666
407 Ga0068867_100342613
408 Ga0070685_10504002
409 Ga0070707_100024453
410 Ga0070698_100180406
411 Ga0070698_101376823
412 Ga0070699_100331107
413 Ga0070699_102184899
414 Ga0070679_100154777
415 Ga0070684_100146204
416 Ga0070684_100478745
417 Ga0070684_100813554
418 Ga0070686_101506423
419 Ga0070695_101149604
420 Ga0070696_102020645
421 Ga0068855_101529836
422 Ga0068854_101804182
423 Ga0068856_100825138
424 Ga0068852_100585327
425 Ga0068859_101239030
426 Ga0068864_101273348
427 Ga0068870_10668674
428 Ga0081455_10021665
429 Ga0081455_10113093
430 Ga0081455_10159302
431 Ga0081455_10976141
432 Ga0070717_10366257
433 Ga0075365_10408200
434 Ga0075365_10508852
435 Ga0070715_10554014
436 Ga0070712_101543091
437 Ga0097621_100276913
438 Ga0068871_101610829
439 Ga0075428_100123670
440 Ga0075428_101011701
441 Ga0075428_101241245
442 Ga0075430_100070528
443 Ga0075431_100268514
444 Ga0075433_10512991
445 Ga0075433_10843092
446 Ga0075434_100137878
447 Ga0068865_100362182
448 Ga0075436_100273652
449 Ga0075436_100667482
450 Ga0097620_101238816
451 Ga0075435_100965478
452 Ga0075435_101818794
453 Ga0111539_10104393
454 Ga0111539_10178697
455 Ga0111539_10791715
456 Ga0105245_10061280
457 Ga0105245_10701598
458 Ga0114129_10148445
459 Ga0114129_10384689
460 Ga0105243_10402332
461 Ga0105243_12154230
462 Ga0105242_11031441
463 Ga0105248_10316084
464 Ga0105248_10553350
465 Ga0105248_11693432
466 Ga0105248_13261584
467 Ga0105237_11741154
468 Ga0105238_11782884
469 Ga0105239_10253873
470 Ga0105239_11574182
471 Ga0157369_11854185
472 Ga0157374_10218215
473 Ga0163162_10373745
474 Ga0157375_10068584
475 Ga0157375_10298686
476 Ga0163163_10628202
477 Ga0157380_12275810
478 Ga0157380_12505886
479 Ga0157380_13013618
480 Ga0207707_10377475
481 Ga0207652_10056315
482 Ga0207646_10020967
483 Ga0207687_10922032
484 Ga0207664_10269333
485 Ga0207706_10674690
486 Ga0207709_11331793
487 Ga0207661_10707431
488 Ga0207661_11279323
489 Ga0207667_11531575
490 Ga0207651_11067984
491 Ga0207658_10004445
492 Ga0207678_11985798
493 Ga0207702_10537257
494 Ga0207428_10142586
495 Ga0265327_10084056
496 Ga0265327_10415991
497 Ga0307408_100241172
498 Ga0265314_10184932
499 Ga0307406_11101232
500 Ga0307411_11141535
501 Ga0373952_0065247
502 Ga0373936_0036275
503 Ga0373936_0488637
504 Ga0373939_0109446
505 Ga0373939_0403925
506 Ga0373942_0024715
507 Ga0373961_0417678
508 Ga0373931_0403621
509 Ga0373933_0425674
510 Ga0373933_0512453
511 Ga0373947_0695137
512 Ga0373947_0706551
513 Ga0373925_0434863
514 Ga0395899_0001108
515 Ga0395899_0002173
516 Ga0395899_0031167
517 Ga0395899_0079777
518 Ga0395899_0100185
519 Ga0395899_0252020
520 Ga0395899_0429880
521 Ga0395900_0004980
522 Ga0395900_0007691
523 Ga0395900_0015521
524 Ga0395900_0019954
525 Ga0395900_0057986
526 Ga0395900_0083657
527 Ga0395900_0120521
528 Ga0395900_0145095
529 Ga0395900_0257017
530 Ga0395898_0002026
531 Ga0395898_0014172
532 Ga0395898_0014219
533 Ga0395898_0016034
534 Ga0395898_0037495
535 Ga0395898_0079946
536 Ga0395898_0186916
537 Ga0395898_0334824
538 Ga0395898_0460052
539 Ga0395898_1511200
540 Ga0395905_0004863
541 Ga0395905_0008004
542 Ga0395905_0015870
543 Ga0395905_0026108
544 Ga0395905_0031534
545 Ga0395905_0081278
546 Ga0395905_0121076
547 Ga0395905_0166510
548 Ga0395905_0824873
549 Ga0395901_0032733
550 Ga0395901_0054093
551 Ga0395901_0064178
552 Ga0395901_0104183
553 Ga0395901_0105629
554 Ga0395901_0156111
555 Ga0395901_0179822
556 Ga0395901_0400500
557 Ga0395901_0514743
558 Ga0395901_1072476
559 Ga0439448_0280553
560 Ga0439460_0325913
561 Ga0466965_0080125
562 Ga0466961_0045730
563 Ga0466963_0327867
564 Ga0466963_0870900
565 Ga0466964_0170384
566 Ga0466971_0005662
567 Ga0466968_0227517
568 Ga0466957_0000852
569 Ga0466957_0014699
570 Ga0466957_0485595
571 Ga0466960_0219460
572 Ga0466959_0010475
573 Ga0466959_0305765
574 Ga0451576_1491354
575 Ga0466958_0003772
576 Ga0466958_0183082
577 Ga0466967_0017062
578 Ga0466967_0018605
579 Ga0466967_0136232
580 Ga0466967_0609760
581 Ga0495617_275672
582 Ga0495603_0254591
583 Ga0495629_0002879
584 Ga0495629_0858285
585 Ga0495651_0732334
586 Ga0495582_0580655
587 Ga0495608_0606074
588 Ga0495628_0487303
589 Ga0495630_0935660
590 Ga0495644_0177272
591 Ga0495644_0251804
592 Ga0495640_0622197
593 Ga0495586_0315273
594 Ga0495667_0555731
595 Ga0495634_0418452
596 Ga0495634_0595782
597 Ga0495635_0475077
598 Ga0495599_0398528
599 Ga0495623_0382325
600 Ga0495658_0253288
601 Ga0495613_0026986
602 Ga0495613_0528674
603 Ga0495613_0673800
604 Ga0495613_1108250
605 Ga0495589_0209321
606 Ga0495676_0980910
607 Ga0495684_0414148
608 Ga0496100_0193457
609 Ga0496100_0487556
610 Ga0496100_1013459
611 Ga0496101_0207475
612 Ga0496101_1038200
613 Ga0496102_0005106
614 Ga0496102_1585402
615 Ga0496103_0170043
616 Ga0496104_0002750
617 Ga0496104_0122425
618 Ga0496104_0487463
619 Ga0496104_0698158
620 Ga0496105_0009844
621 Ga0496106_0044706
622 Ga0496106_0157172
623 Ga0496106_0658993
624 Ga0496106_1566267
625 Ga0496107_0007379
626 Ga0496107_0668800
627 Ga0496107_1055137
628 Ga0496108_0044275
629 Ga0496108_0348035
630 Ga0496108_0381146
631 Ga0496109_0050880
632 Ga0496109_0086386
633 Ga0496109_0101947
634 Ga0496109_0453574
635 Ga0496109_0485678
636 Ga0496109_1174903
637 Ga0496110_0062471
638 Ga0496110_0151555
639 Ga0496110_0353572
640 Ga0496110_0584375
641 Ga0496111_0001995
642 Ga0496111_0159691
643 Ga0496111_0293322
644 Ga0496112_0004613
645 Ga0496112_0010772
646 Ga0496112_0015040
647 Ga0496112_0026134
648 Ga0496112_0183525
649 Ga0496112_0238035
650 Ga0496113_0010926
651 Ga0496113_0082999
652 Ga0496113_0453837
653 Ga0496115_0107462
654 Ga0501031_0010474
655 Ga0501031_0050548
656 Ga0501031_0055603
657 Ga0501031_0186073
658 Ga0501032_0059620
659 Ga0501032_0213133
660 Ga0501033_0035738
661 Ga0501034_0009879
662 Ga0501036_0003717
663 Ga0501036_1343705
664 Ga0501037_0006663
665 Ga0501038_0019614
666 Ga0501039_0003326
667 Ga0501039_0678479
668 Ga0501040_0003162
669 Ga0501040_0175175
670 Ga0501041_0004122
671 Ga0501041_0012584
672 Ga0501041_0079861
673 Ga0501041_0190115
674 Ga0501042_0007069
675 Ga0501042_0036861
676 Ga0501042_0333454
677 Ga0501043_0192504
678 Ga0501043_0222864
679 Ga0501043_0412620
680 Ga0501046_0043169
681 Ga0501046_0211054
682 Ga0501046_0224601
683 Ga0501046_0541564
684 Ga0501047_0028431
685 Ga0501048_0011097
686 Ga0501048_0014778
687 Ga0501048_0176031
688 Ga0501067_0001144
689 Ga0501067_0551145
690 Ga0501068_0009931
691 Ga0501068_0100955
692 Ga0501068_0132691
693 Ga0501068_0484191
694 Ga0501069_0003298
695 Ga0501069_0107780
696 Ga0501070_0020527
697 Ga0501070_0088419
698 Ga0501070_0088603
699 Ga0501070_0593733
700 Ga0501070_0699500
701 Ga0501070_1340716
702 Ga0501071_0018121
703 Ga0501071_0926623
704 Ga0501072_0100286
705 Ga0501072_0258409
706 Ga0501072_0452271
707 Ga0501073_0298444
708 Ga0501073_0896003
709 Ga0501074_0002850
710 Ga0501074_0220871
711 Ga0501074_1118823
712 Ga0501075_0012479
713 Ga0501075_0065733
714 Ga0501076_0001770
715 Ga0501076_0022838
716 Ga0501076_0898211
717 Ga0501077_0002902
718 Ga0501077_0719971
719 Ga0501079_0003743
720 Ga0501079_0031920
721 Ga0501079_0042783
722 Ga0501079_0367110
723 Ga0501080_0315214
724 Ga0501080_0387444
725 Ga0501080_0933910
726 Ga0501080_0950859
727 Ga0501081_0005118
728 Ga0501081_0008256
729 Ga0501081_0312204
730 Ga0501081_0382236
731 Ga0501081_0717761
732 Ga0501081_0850328
733 Ga0501083_0034503
734 Ga0501083_0059090
735 Ga0501035_0033208
736 Ga0501035_0339659
737 Ga0501035_0688085
738 Ga0501044_0011263
739 Ga0501045_0006828
740 Ga0501045_0070330
741 nmdc:mga0yw44_510982_c1
742 nmdc:mga05p37_150011_c1
743 nmdc:mga05p37_165465_c1
744 nmdc:mga0qj67_28589_c1
745 nmdc:mga06r32_303214_c1
746 nmdc:mga08y16_173989_c1
747 nmdc:mga08y16_211101_c1
748 nmdc:mga08y16_24203_c1
749 nmdc:mga0n895_119156_c1
750 nmdc:mga0rr50_1682033_c1
751 nmdc:mga08x19_36325_c1
752 nmdc:mga08x19_584191_c1
753 nmdc:mga0a205_224230_c1
754 nmdc:mga0a205_364042_c1
755 Ga0495601_0074360
756 Ga0495619_0352654
757 Ga0501084_0003734
758 Ga0501084_0028522
759 Ga0501084_0148937
760 Ga0501084_0863333
761 Ga0501084_1214112
762 Ga0590071_119564
763 Ga0501082_0005285
764 Ga0501082_0050950
765 Ga0501082_0122313
766 Ga0501082_0561726
767 Ga0466962_0001933
768 Ga0466962_0360073
769 Ga0530510_0002110
770 Ga0530510_0007324
771 Ga0530510_0025852
772 Ga0530510_0466572

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02583

Trns_repr_metal

Metal-sensitive transcriptional repressor

29

112

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mq2-assembly1.cif.gz_C c9a streptococcus pneumoniae cstr in the reduced state, space group p21 0.9729 10 66
5fmn-assembly1.cif.gz_B the nickel-responsive transcriptional regulator inrs 0.9663 10 92
6ahx-assembly1.cif.gz_A-2 copper-sensing operon regulator protein (csorgz) 0.9231 11 65
7mq1-assembly1.cif.gz_B c9a streptococcus pneumoniae cstr in the reduced state, space group c2 0.8788 9 89
5fmn-assembly1.cif.gz_B the nickel-responsive transcriptional regulator inrs 0.8615 10 92
ID Description Score Start End Superfamily
3dkqC02 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9825 14 50 4.10.860.20
5fmnB00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer 0.9663 10 92 1.20.58.1000
5fmnA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer 0.9608 7 92 1.20.58.1000
af_P07814_749_805_1.10.287.10 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.924 12 56 1.10.287.10
5ujjA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9199 12 53 1.10.287.10
ID Description Score Start End GO Terms
AF-A0A7W1M834-F1-model_v4 Metal-sensitive transcriptional regulator 0.9835 13 92 GO:0003677
GO:0005737
GO:0045892
GO:0046872
AF-A0A2H0LKS1-F1-model_v4 Transcriptional regulator 0.9773 13 93 GO:0003677
GO:0005737
GO:0045892
GO:0046872
AF-A0A0P4UXA7-F1-model_v4 Repressor CsoR of the copZA operon 0.9744 7 92 GO:0003677
GO:0005737
GO:0045892
GO:0046872
AF-A0A1Q3P4P3-F1-model_v4 Transcriptional regulator 0.973 10 92 GO:0003677
GO:0005737
GO:0045892
GO:0046872
AF-A0A7V9N9I8-F1-model_v4 Metal-sensitive transcriptional regulator 0.9721 2 96 GO:0003677
GO:0005737
GO:0045892
GO:0046872

Map